diff --git a/dependencies/File_Extractor-0.4.3/7z_C/7zC.txt b/dependencies/File_Extractor-0.4.3/7z_C/7zC.txt deleted file mode 100644 index 98506674..00000000 --- a/dependencies/File_Extractor-0.4.3/7z_C/7zC.txt +++ /dev/null @@ -1,237 +0,0 @@ -7z ANSI-C Decoder 4.48 ----------------------- - -7z ANSI-C Decoder 4.48 Copyright (C) 1999-2006 Igor Pavlov - -7z ANSI-C provides 7z/LZMA decoding. -7z ANSI-C version is simplified version ported from C++ code. - -LZMA is default and general compression method of 7z format -in 7-Zip compression program (www.7-zip.org). LZMA provides high -compression ratio and very fast decompression. - - -LICENSE -------- - -Read lzma.txt for information about license. - - -Files ---------------------- - -7zAlloc.* - Allocate and Free -7zBuffer.* - Buffer structure -7zCrc.* - CRC32 code -7zDecode.* - Low level memory->memory decoding -7zExtract.* - High level stream->memory decoding -7zHeader.* - .7z format constants -7zIn.* - .7z archive opening -7zItem.* - .7z structures -7zMain.c - Test application -7zMethodID.* - MethodID structure -7zTypes.h - Base types and constants - - -How To Use ----------- - -You must download 7-Zip program from www.7-zip.org. - -You can create .7z archive with 7z.exe or 7za.exe: - - 7za.exe a archive.7z *.htm -r -mx -m0fb=255 - -If you have big number of files in archive, and you need fast extracting, -you can use partly-solid archives: - - 7za.exe a archive.7z *.htm -ms=512K -r -mx -m0fb=255 -m0d=512K - -In that example 7-Zip will use 512KB solid blocks. So it needs to decompress only -512KB for extracting one file from such archive. - - -Limitations of current version of 7z ANSI-C Decoder ---------------------------------------------------- - - - It reads only "FileName", "Size", "LastWriteTime" and "CRC" information for each file in archive. - - It supports only LZMA and Copy (no compression) methods with BCJ or BCJ2 filters. - - It converts original UTF-16 Unicode file names to UTF-8 Unicode file names. - -These limitations will be fixed in future versions. - - -Using 7z ANSI-C Decoder Test application: ------------------------------------------ - -Usage: 7zDec - -: - e: Extract files from archive - l: List contents of archive - t: Test integrity of archive - -Example: - - 7zDec l archive.7z - -lists contents of archive.7z - - 7zDec e archive.7z - -extracts files from archive.7z to current folder. - - -How to use .7z Decoder ----------------------- - -.7z Decoder can be compiled in one of two modes: - -1) Default mode. In that mode 7z Decoder will read full compressed - block to RAM before decompressing. - -2) Mode with defined _LZMA_IN_CB. In that mode 7z Decoder can read - compressed block by parts. And you can specify desired buffer size. - So memory requirements can be reduced. But decompressing speed will - be 5-10% lower and code size is slightly larger. - - -Memory allocation -~~~~~~~~~~~~~~~~~ - -7z Decoder uses two memory pools: -1) Temporary pool -2) Main pool -Such scheme can allow you to avoid fragmentation of allocated blocks. - -Steps for using 7z decoder --------------------------- - -Use code at 7zMain.c as example. - -1) Declare variables: - inStream /* implements ISzInStream interface */ - CArchiveDatabaseEx db; /* 7z archive database structure */ - ISzAlloc allocImp; /* memory functions for main pool */ - ISzAlloc allocTempImp; /* memory functions for temporary pool */ - -2) call InitCrcTable(); function to initialize CRC structures. - -3) call SzArDbExInit(&db); function to initialize db structures. - -4) call SzArchiveOpen(inStream, &db, &allocMain, &allocTemp) to open archive - -This function opens archive "inStream" and reads headers to "db". -All items in "db" will be allocated with "allocMain" functions. -SzArchiveOpen function allocates and frees temporary structures by "allocTemp" functions. - -5) List items or Extract items - - Listing code: - ~~~~~~~~~~~~~ - { - UInt32 i; - for (i = 0; i < db.Database.NumFiles; i++) - { - CFileItem *f = db.Database.Files + i; - printf("%10d %s\n", (int)f->Size, f->Name); - } - } - - Extracting code: - ~~~~~~~~~~~~~~~~ - - SZ_RESULT SzExtract( - ISzInStream *inStream, - CArchiveDatabaseEx *db, - UInt32 fileIndex, /* index of file */ - UInt32 *blockIndex, /* index of solid block */ - Byte **outBuffer, /* pointer to pointer to output buffer (allocated with allocMain) */ - size_t *outBufferSize, /* buffer size for output buffer */ - size_t *offset, /* offset of stream for required file in *outBuffer */ - size_t *outSizeProcessed, /* size of file in *outBuffer */ - ISzAlloc *allocMain, - ISzAlloc *allocTemp); - - If you need to decompress more than one file, you can send these values from previous call: - blockIndex, - outBuffer, - outBufferSize, - You can consider "outBuffer" as cache of solid block. If your archive is solid, - it will increase decompression speed. - - After decompressing you must free "outBuffer": - allocImp.Free(outBuffer); - -6) call SzArDbExFree(&db, allocImp.Free) to free allocated items in "db". - - - - -Memory requirements for .7z decoding ------------------------------------- - -Memory usage for Archive opening: - - Temporary pool: - - Memory for compressed .7z headers (if _LZMA_IN_CB is not defined) - - Memory for uncompressed .7z headers - - some other temporary blocks - - Main pool: - - Memory for database: - Estimated size of one file structures in solid archive: - - Size (4 or 8 Bytes) - - CRC32 (4 bytes) - - LastWriteTime (8 bytes) - - Some file information (4 bytes) - - File Name (variable length) + pointer + allocation structures - -Memory usage for archive Decompressing: - - Temporary pool: - - Memory for compressed solid block (if _LZMA_IN_CB is not defined) - - Memory for LZMA decompressing structures - - Main pool: - - Memory for decompressed solid block - - Memory for temprorary buffers, if BCJ2 fileter is used. Usually these - temprorary buffers can be about 15% of solid block size. - - -If _LZMA_IN_CB is defined, 7z Decoder will not allocate memory for -compressed blocks. Instead of this, you must allocate buffer with desired -size before calling 7z Decoder. Use 7zMain.c as example. - - - -EXIT codes ------------ - -7z Decoder functions can return one of the following codes: - -#define SZ_OK (0) -#define SZE_DATA_ERROR (1) -#define SZE_OUTOFMEMORY (2) -#define SZE_CRC_ERROR (3) - -#define SZE_NOTIMPL (4) -#define SZE_FAIL (5) - -#define SZE_ARCHIVE_ERROR (6) - - - -LZMA Defines ------------- - -_LZMA_IN_CB - Use special callback mode for input stream to reduce memory requirements - -_SZ_FILE_SIZE_32 - define it if you need only support for files smaller than 4 GB -_SZ_NO_INT_64 - define it if your compiler doesn't support long long int or __int64. - -_LZMA_PROB32 - it can increase LZMA decompressing speed on some 32-bit CPUs. - -_SZ_ALLOC_DEBUG - define it if you want to debug alloc/free operations to stderr. - - ---- - -http://www.7-zip.org -http://www.7-zip.org/support.html diff --git a/dependencies/File_Extractor-0.4.3/7z_C/7zCrc.c b/dependencies/File_Extractor-0.4.3/7z_C/7zCrc.c deleted file mode 100644 index 1436b993..00000000 --- a/dependencies/File_Extractor-0.4.3/7z_C/7zCrc.c +++ /dev/null @@ -1,32 +0,0 @@ -/* 7zCrc.c */ - -#include "7zCrc.h" - -#define kCrcPoly 0xEDB88320 -UInt32 g_CrcTable[256]; - -void MY_FAST_CALL CrcGenerateTable(void) -{ - UInt32 i; - for (i = 0; i < 256; i++) - { - UInt32 r = i; - int j; - for (j = 0; j < 8; j++) - r = (r >> 1) ^ (kCrcPoly & ~((r & 1) - 1)); - g_CrcTable[i] = r; - } -} - -UInt32 MY_FAST_CALL CrcUpdate(UInt32 v, const void *data, size_t size) -{ - const Byte *p = (const Byte *)data; - for (; size > 0 ; size--, p++) - v = CRC_UPDATE_BYTE(v, *p); - return v; -} - -UInt32 MY_FAST_CALL CrcCalc(const void *data, size_t size) -{ - return CrcUpdate(CRC_INIT_VAL, data, size) ^ 0xFFFFFFFF; -} diff --git a/dependencies/File_Extractor-0.4.3/7z_C/7zCrc.h b/dependencies/File_Extractor-0.4.3/7z_C/7zCrc.h deleted file mode 100644 index 6cb10161..00000000 --- a/dependencies/File_Extractor-0.4.3/7z_C/7zCrc.h +++ /dev/null @@ -1,21 +0,0 @@ -/* 7zCrc.h */ - -#ifndef __7Z_CRC_H -#define __7Z_CRC_H - -#include - -#include "Types.h" - -extern UInt32 g_CrcTable[]; - -void MY_FAST_CALL CrcGenerateTable(void); - -#define CRC_INIT_VAL 0xFFFFFFFF -#define CRC_GET_DIGEST(crc) ((crc) ^ 0xFFFFFFFF) -#define CRC_UPDATE_BYTE(crc, b) (g_CrcTable[((crc) ^ (b)) & 0xFF] ^ ((crc) >> 8)) - -UInt32 MY_FAST_CALL CrcUpdate(UInt32 crc, const void *data, size_t size); -UInt32 MY_FAST_CALL CrcCalc(const void *data, size_t size); - -#endif diff --git a/dependencies/File_Extractor-0.4.3/7z_C/Alloc.c b/dependencies/File_Extractor-0.4.3/7z_C/Alloc.c deleted file mode 100644 index 7b5af420..00000000 --- a/dependencies/File_Extractor-0.4.3/7z_C/Alloc.c +++ /dev/null @@ -1,119 +0,0 @@ -/* Alloc.c */ - -#ifdef _WIN32 -#include -#endif -#include - -#include "Alloc.h" - -/* #define _SZ_ALLOC_DEBUG */ - -/* use _SZ_ALLOC_DEBUG to debug alloc/free operations */ -#ifdef _SZ_ALLOC_DEBUG -#include -int g_allocCount = 0; -int g_allocCountMid = 0; -int g_allocCountBig = 0; -#endif - -void *MyAlloc(size_t size) -{ - if (size == 0) - return 0; - #ifdef _SZ_ALLOC_DEBUG - fprintf(stderr, "\nAlloc %10d bytes; count = %10d", size, g_allocCount++); - #endif - return malloc(size); -} - -void MyFree(void *address) -{ - #ifdef _SZ_ALLOC_DEBUG - if (address != 0) - fprintf(stderr, "\nFree; count = %10d", --g_allocCount); - #endif - free(address); -} - -#ifdef _WIN32 - -void *MidAlloc(size_t size) -{ - if (size == 0) - return 0; - #ifdef _SZ_ALLOC_DEBUG - fprintf(stderr, "\nAlloc_Mid %10d bytes; count = %10d", size, g_allocCountMid++); - #endif - return VirtualAlloc(0, size, MEM_COMMIT, PAGE_READWRITE); -} - -void MidFree(void *address) -{ - #ifdef _SZ_ALLOC_DEBUG - if (address != 0) - fprintf(stderr, "\nFree_Mid; count = %10d", --g_allocCountMid); - #endif - if (address == 0) - return; - VirtualFree(address, 0, MEM_RELEASE); -} - -#ifndef MEM_LARGE_PAGES -#undef _7ZIP_LARGE_PAGES -#endif - -#ifdef _7ZIP_LARGE_PAGES -SIZE_T g_LargePageSize = 0; -typedef SIZE_T (WINAPI *GetLargePageMinimumP)(); -#endif - -void SetLargePageSize() -{ - #ifdef _7ZIP_LARGE_PAGES - SIZE_T size = 0; - GetLargePageMinimumP largePageMinimum = (GetLargePageMinimumP) - GetProcAddress(GetModuleHandle(TEXT("kernel32.dll")), "GetLargePageMinimum"); - if (largePageMinimum == 0) - return; - size = largePageMinimum(); - if (size == 0 || (size & (size - 1)) != 0) - return; - g_LargePageSize = size; - #endif -} - - -void *BigAlloc(size_t size) -{ - if (size == 0) - return 0; - #ifdef _SZ_ALLOC_DEBUG - fprintf(stderr, "\nAlloc_Big %10d bytes; count = %10d", size, g_allocCountBig++); - #endif - - #ifdef _7ZIP_LARGE_PAGES - if (g_LargePageSize != 0 && g_LargePageSize <= (1 << 30) && size >= (1 << 18)) - { - void *res = VirtualAlloc(0, (size + g_LargePageSize - 1) & (~(g_LargePageSize - 1)), - MEM_COMMIT | MEM_LARGE_PAGES, PAGE_READWRITE); - if (res != 0) - return res; - } - #endif - return VirtualAlloc(0, size, MEM_COMMIT, PAGE_READWRITE); -} - -void BigFree(void *address) -{ - #ifdef _SZ_ALLOC_DEBUG - if (address != 0) - fprintf(stderr, "\nFree_Big; count = %10d", --g_allocCountBig); - #endif - - if (address == 0) - return; - VirtualFree(address, 0, MEM_RELEASE); -} - -#endif diff --git a/dependencies/File_Extractor-0.4.3/7z_C/Alloc.h b/dependencies/File_Extractor-0.4.3/7z_C/Alloc.h deleted file mode 100644 index d748cb18..00000000 --- a/dependencies/File_Extractor-0.4.3/7z_C/Alloc.h +++ /dev/null @@ -1,29 +0,0 @@ -/* Alloc.h */ - -#ifndef __COMMON_ALLOC_H -#define __COMMON_ALLOC_H - -#include - -void *MyAlloc(size_t size); -void MyFree(void *address); - -#ifdef _WIN32 - -void SetLargePageSize(); - -void *MidAlloc(size_t size); -void MidFree(void *address); -void *BigAlloc(size_t size); -void BigFree(void *address); - -#else - -#define MidAlloc(size) MyAlloc(size) -#define MidFree(address) MyFree(address) -#define BigAlloc(size) MyAlloc(size) -#define BigFree(address) MyFree(address) - -#endif - -#endif diff --git a/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zAlloc.c b/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zAlloc.c deleted file mode 100644 index 21bb30c7..00000000 --- a/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zAlloc.c +++ /dev/null @@ -1,70 +0,0 @@ -/* 7zAlloc.c */ - -#include -#include "7zAlloc.h" - -/* #define _SZ_ALLOC_DEBUG */ -/* use _SZ_ALLOC_DEBUG to debug alloc/free operations */ - -#ifdef _SZ_ALLOC_DEBUG - -#ifdef _WIN32 -#include -#endif -#include -int g_allocCount = 0; -int g_allocCountTemp = 0; -#endif - -void *SzAlloc(size_t size) -{ - if (size == 0) - return 0; - #ifdef _SZ_ALLOC_DEBUG - fprintf(stderr, "\nAlloc %10d bytes; count = %10d", size, g_allocCount); - g_allocCount++; - #endif - return malloc(size); -} - -void SzFree(void *address) -{ - #ifdef _SZ_ALLOC_DEBUG - if (address != 0) - { - g_allocCount--; - fprintf(stderr, "\nFree; count = %10d", g_allocCount); - } - #endif - free(address); -} - -void *SzAllocTemp(size_t size) -{ - if (size == 0) - return 0; - #ifdef _SZ_ALLOC_DEBUG - fprintf(stderr, "\nAlloc_temp %10d bytes; count = %10d", size, g_allocCountTemp); - g_allocCountTemp++; - #ifdef _WIN32 - return HeapAlloc(GetProcessHeap(), 0, size); - #endif - #endif - return malloc(size); -} - -void SzFreeTemp(void *address) -{ - #ifdef _SZ_ALLOC_DEBUG - if (address != 0) - { - g_allocCountTemp--; - fprintf(stderr, "\nFree_temp; count = %10d", g_allocCountTemp); - } - #ifdef _WIN32 - HeapFree(GetProcessHeap(), 0, address); - return; - #endif - #endif - free(address); -} diff --git a/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zAlloc.h b/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zAlloc.h deleted file mode 100644 index 4ca4170c..00000000 --- a/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zAlloc.h +++ /dev/null @@ -1,20 +0,0 @@ -/* 7zAlloc.h */ - -#ifndef __7Z_ALLOC_H -#define __7Z_ALLOC_H - -#include - -typedef struct _ISzAlloc -{ - void *(*Alloc)(size_t size); - void (*Free)(void *address); /* address can be 0 */ -} ISzAlloc; - -void *SzAlloc(size_t size); -void SzFree(void *address); - -void *SzAllocTemp(size_t size); -void SzFreeTemp(void *address); - -#endif diff --git a/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zBuffer.c b/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zBuffer.c deleted file mode 100644 index 3c4b71e8..00000000 --- a/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zBuffer.c +++ /dev/null @@ -1,29 +0,0 @@ -/* 7zBuffer.c */ - -#include "7zBuffer.h" -#include "7zAlloc.h" - -void SzByteBufferInit(CSzByteBuffer *buffer) -{ - buffer->Capacity = 0; - buffer->Items = 0; -} - -int SzByteBufferCreate(CSzByteBuffer *buffer, size_t newCapacity, void * (*allocFunc)(size_t size)) -{ - buffer->Capacity = newCapacity; - if (newCapacity == 0) - { - buffer->Items = 0; - return 1; - } - buffer->Items = (Byte *)allocFunc(newCapacity); - return (buffer->Items != 0); -} - -void SzByteBufferFree(CSzByteBuffer *buffer, void (*freeFunc)(void *)) -{ - freeFunc(buffer->Items); - buffer->Items = 0; - buffer->Capacity = 0; -} diff --git a/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zBuffer.h b/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zBuffer.h deleted file mode 100644 index 05c6d748..00000000 --- a/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zBuffer.h +++ /dev/null @@ -1,19 +0,0 @@ -/* 7zBuffer.h */ - -#ifndef __7Z_BUFFER_H -#define __7Z_BUFFER_H - -#include -#include "../../Types.h" - -typedef struct _CSzByteBuffer -{ - size_t Capacity; - Byte *Items; -}CSzByteBuffer; - -void SzByteBufferInit(CSzByteBuffer *buffer); -int SzByteBufferCreate(CSzByteBuffer *buffer, size_t newCapacity, void * (*allocFunc)(size_t size)); -void SzByteBufferFree(CSzByteBuffer *buffer, void (*freeFunc)(void *)); - -#endif diff --git a/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zDecode.c b/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zDecode.c deleted file mode 100644 index 20669fcb..00000000 --- a/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zDecode.c +++ /dev/null @@ -1,347 +0,0 @@ -/* 7zDecode.c */ - -#include - -#include "7zDecode.h" -#ifdef _SZ_ONE_DIRECTORY -#include "LzmaDecode.h" -#else -#include "../../Compress/Lzma/LzmaDecode.h" -#include "../../Compress/Branch/BranchX86.h" -#include "../../Compress/Branch/BranchX86_2.h" -#endif - -#define k_Copy 0 -#define k_LZMA 0x30101 -#define k_BCJ 0x03030103 -#define k_BCJ2 0x0303011B - -#ifdef _LZMA_IN_CB - -typedef struct _CLzmaInCallbackImp -{ - ILzmaInCallback InCallback; - ISzInStream *InStream; - CFileSize Size; -} CLzmaInCallbackImp; - -static -int LzmaReadImp(void *object, const unsigned char **buffer, SizeT *size) -{ - CLzmaInCallbackImp *cb = (CLzmaInCallbackImp *)object; - size_t processedSize; - SZ_RESULT res; - size_t curSize = (1 << 20); - if (curSize > cb->Size) - curSize = (size_t)cb->Size; - *size = 0; - res = cb->InStream->Read((void *)cb->InStream, (void **)buffer, curSize, &processedSize); - *size = (SizeT)processedSize; - if (processedSize > curSize) - return (int)SZE_FAIL; - cb->Size -= processedSize; - if (res == SZ_OK) - return 0; - return (int)res; -} - -#endif - -static -SZ_RESULT SzDecodeLzma(CCoderInfo *coder, CFileSize inSize, - #ifdef _LZMA_IN_CB - ISzInStream *inStream, - #else - const Byte *inBuffer, - #endif - Byte *outBuffer, size_t outSize, ISzAlloc *allocMain) -{ - #ifdef _LZMA_IN_CB - CLzmaInCallbackImp lzmaCallback; - #else - SizeT inProcessed; - #endif - - CLzmaDecoderState state; /* it's about 24-80 bytes structure, if int is 32-bit */ - int result; - SizeT outSizeProcessedLoc; - - #ifdef _LZMA_IN_CB - lzmaCallback.Size = inSize; - lzmaCallback.InStream = inStream; - lzmaCallback.InCallback.Read = LzmaReadImp; - #endif - - if (LzmaDecodeProperties(&state.Properties, coder->Properties.Items, - (unsigned)coder->Properties.Capacity) != LZMA_RESULT_OK) - return SZE_FAIL; - - state.Probs = (CProb *)allocMain->Alloc(LzmaGetNumProbs(&state.Properties) * sizeof(CProb)); - if (state.Probs == 0) - return SZE_OUTOFMEMORY; - - #ifdef _LZMA_OUT_READ - if (state.Properties.DictionarySize == 0) - state.Dictionary = 0; - else - { - state.Dictionary = (unsigned char *)allocMain->Alloc(state.Properties.DictionarySize); - if (state.Dictionary == 0) - { - allocMain->Free(state.Probs); - return SZE_OUTOFMEMORY; - } - } - LzmaDecoderInit(&state); - #endif - - result = LzmaDecode(&state, - #ifdef _LZMA_IN_CB - &lzmaCallback.InCallback, - #else - inBuffer, (SizeT)inSize, &inProcessed, - #endif - outBuffer, (SizeT)outSize, &outSizeProcessedLoc); - allocMain->Free(state.Probs); - #ifdef _LZMA_OUT_READ - allocMain->Free(state.Dictionary); - #endif - if (result == LZMA_RESULT_DATA_ERROR) - return SZE_DATA_ERROR; - if (result != LZMA_RESULT_OK) - return SZE_FAIL; - return (outSizeProcessedLoc == outSize) ? SZ_OK : SZE_DATA_ERROR; -} - -#ifdef _LZMA_IN_CB -static -SZ_RESULT SzDecodeCopy(CFileSize inSize, ISzInStream *inStream, Byte *outBuffer) -{ - while (inSize > 0) - { - void *inBuffer; - size_t processedSize, curSize = (1 << 18); - if (curSize > inSize) - curSize = (size_t)(inSize); - RINOK(inStream->Read((void *)inStream, (void **)&inBuffer, curSize, &processedSize)); - if (processedSize == 0) - return SZE_DATA_ERROR; - if (processedSize > curSize) - return SZE_FAIL; - memcpy(outBuffer, inBuffer, processedSize); - outBuffer += processedSize; - inSize -= processedSize; - } - return SZ_OK; -} -#endif - -#define IS_UNSUPPORTED_METHOD(m) ((m) != k_Copy && (m) != k_LZMA) -#define IS_UNSUPPORTED_CODER(c) (IS_UNSUPPORTED_METHOD(c.MethodID) || c.NumInStreams != 1 || c.NumOutStreams != 1) -#define IS_NO_BCJ(c) (c.MethodID != k_BCJ || c.NumInStreams != 1 || c.NumOutStreams != 1) -#define IS_NO_BCJ2(c) (c.MethodID != k_BCJ2 || c.NumInStreams != 4 || c.NumOutStreams != 1) - -static -SZ_RESULT CheckSupportedFolder(const CFolder *f) -{ - if (f->NumCoders < 1 || f->NumCoders > 4) - return SZE_NOTIMPL; - if (IS_UNSUPPORTED_CODER(f->Coders[0])) - return SZE_NOTIMPL; - if (f->NumCoders == 1) - { - if (f->NumPackStreams != 1 || f->PackStreams[0] != 0 || f->NumBindPairs != 0) - return SZE_NOTIMPL; - return SZ_OK; - } - if (f->NumCoders == 2) - { - if (IS_NO_BCJ(f->Coders[1]) || - f->NumPackStreams != 1 || f->PackStreams[0] != 0 || - f->NumBindPairs != 1 || - f->BindPairs[0].InIndex != 1 || f->BindPairs[0].OutIndex != 0) - return SZE_NOTIMPL; - return SZ_OK; - } - if (f->NumCoders == 4) - { - if (IS_UNSUPPORTED_CODER(f->Coders[1]) || - IS_UNSUPPORTED_CODER(f->Coders[2]) || - IS_NO_BCJ2(f->Coders[3])) - return SZE_NOTIMPL; - if (f->NumPackStreams != 4 || - f->PackStreams[0] != 2 || - f->PackStreams[1] != 6 || - f->PackStreams[2] != 1 || - f->PackStreams[3] != 0 || - f->NumBindPairs != 3 || - f->BindPairs[0].InIndex != 5 || f->BindPairs[0].OutIndex != 0 || - f->BindPairs[1].InIndex != 4 || f->BindPairs[1].OutIndex != 1 || - f->BindPairs[2].InIndex != 3 || f->BindPairs[2].OutIndex != 2) - return SZE_NOTIMPL; - return SZ_OK; - } - return SZE_NOTIMPL; -} - -static -CFileSize GetSum(const CFileSize *values, UInt32 index) -{ - CFileSize sum = 0; - UInt32 i; - for (i = 0; i < index; i++) - sum += values[i]; - return sum; -} - -static -SZ_RESULT SzDecode2(const CFileSize *packSizes, const CFolder *folder, - #ifdef _LZMA_IN_CB - ISzInStream *inStream, CFileSize startPos, - #else - const Byte *inBuffer, - #endif - Byte *outBuffer, size_t outSize, ISzAlloc *allocMain, - Byte *tempBuf[]) -{ - UInt32 ci; - size_t tempSizes[3] = { 0, 0, 0}; - size_t tempSize3 = 0; - Byte *tempBuf3 = 0; - - RINOK(CheckSupportedFolder(folder)); - - for (ci = 0; ci < folder->NumCoders; ci++) - { - CCoderInfo *coder = &folder->Coders[ci]; - - if (coder->MethodID == k_Copy || coder->MethodID == k_LZMA) - { - UInt32 si = 0; - CFileSize offset; - CFileSize inSize; - Byte *outBufCur = outBuffer; - size_t outSizeCur = outSize; - if (folder->NumCoders == 4) - { - UInt32 indices[] = { 3, 2, 0 }; - CFileSize unpackSize = folder->UnPackSizes[ci]; - si = indices[ci]; - if (ci < 2) - { - Byte *temp; - outSizeCur = (size_t)unpackSize; - if (outSizeCur != unpackSize) - return SZE_OUTOFMEMORY; - temp = (Byte *)allocMain->Alloc(outSizeCur); - if (temp == 0 && outSizeCur != 0) - return SZE_OUTOFMEMORY; - outBufCur = tempBuf[1 - ci] = temp; - tempSizes[1 - ci] = outSizeCur; - } - else if (ci == 2) - { - if (unpackSize > outSize) - return SZE_OUTOFMEMORY; - tempBuf3 = outBufCur = outBuffer + (outSize - (size_t)unpackSize); - tempSize3 = outSizeCur = (size_t)unpackSize; - } - else - return SZE_NOTIMPL; - } - offset = GetSum(packSizes, si); - inSize = packSizes[si]; - #ifdef _LZMA_IN_CB - RINOK(inStream->Seek(inStream, startPos + offset)); - #endif - - if (coder->MethodID == k_Copy) - { - if (inSize != outSizeCur) - return SZE_DATA_ERROR; - - #ifdef _LZMA_IN_CB - RINOK(SzDecodeCopy(inSize, inStream, outBufCur)); - #else - memcpy(outBufCur, inBuffer + (size_t)offset, (size_t)inSize); - #endif - } - else - { - SZ_RESULT res = SzDecodeLzma(coder, inSize, - #ifdef _LZMA_IN_CB - inStream, - #else - inBuffer + (size_t)offset, - #endif - outBufCur, outSizeCur, allocMain); - RINOK(res) - } - } - else if (coder->MethodID == k_BCJ) - { - UInt32 state; - if (ci != 1) - return SZE_NOTIMPL; - x86_Convert_Init(state); - x86_Convert(outBuffer, outSize, 0, &state, 0); - } - else if (coder->MethodID == k_BCJ2) - { - CFileSize offset = GetSum(packSizes, 1); - CFileSize s3Size = packSizes[1]; - SZ_RESULT res; - if (ci != 3) - return SZE_NOTIMPL; - - #ifdef _LZMA_IN_CB - RINOK(inStream->Seek(inStream, startPos + offset)); - tempSizes[2] = (size_t)s3Size; - if (tempSizes[2] != s3Size) - return SZE_OUTOFMEMORY; - tempBuf[2] = (Byte *)allocMain->Alloc(tempSizes[2]); - if (tempBuf[2] == 0 && tempSizes[2] != 0) - return SZE_OUTOFMEMORY; - res = SzDecodeCopy(s3Size, inStream, tempBuf[2]); - RINOK(res) - #endif - - res = x86_2_Decode( - tempBuf3, tempSize3, - tempBuf[0], tempSizes[0], - tempBuf[1], tempSizes[1], - #ifdef _LZMA_IN_CB - tempBuf[2], tempSizes[2], - #else - inBuffer + (size_t)offset, (size_t)s3Size, - #endif - outBuffer, outSize); - RINOK(res) - } - else - return SZE_NOTIMPL; - } - return SZ_OK; -} - -SZ_RESULT SzDecode(const CFileSize *packSizes, const CFolder *folder, - #ifdef _LZMA_IN_CB - ISzInStream *inStream, CFileSize startPos, - #else - const Byte *inBuffer, - #endif - Byte *outBuffer, size_t outSize, ISzAlloc *allocMain) -{ - Byte *tempBuf[3] = { 0, 0, 0}; - int i; - SZ_RESULT res = SzDecode2(packSizes, folder, - #ifdef _LZMA_IN_CB - inStream, startPos, - #else - inBuffer, - #endif - outBuffer, outSize, allocMain, tempBuf); - for (i = 0; i < 3; i++) - allocMain->Free(tempBuf[i]); - return res; -} diff --git a/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zDecode.h b/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zDecode.h deleted file mode 100644 index 1b472f79..00000000 --- a/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zDecode.h +++ /dev/null @@ -1,18 +0,0 @@ -/* 7zDecode.h */ - -#ifndef __7Z_DECODE_H -#define __7Z_DECODE_H - -#include "7zItem.h" -#include "7zAlloc.h" -#include "7zIn.h" - -SZ_RESULT SzDecode(const CFileSize *packSizes, const CFolder *folder, - #ifdef _LZMA_IN_CB - ISzInStream *stream, CFileSize startPos, - #else - const Byte *inBuffer, - #endif - Byte *outBuffer, size_t outSize, ISzAlloc *allocMain); - -#endif diff --git a/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zExtract.c b/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zExtract.c deleted file mode 100644 index 1760a3ce..00000000 --- a/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zExtract.c +++ /dev/null @@ -1,119 +0,0 @@ -/* 7zExtract.c */ - -#include "7zExtract.h" -#include "7zDecode.h" -#include "../../7zCrc.h" - -SZ_RESULT SzExtract( - ISzInStream *inStream, - CArchiveDatabaseEx *db, - UInt32 fileIndex, - UInt32 *blockIndex, - Byte **outBuffer, - size_t *outBufferSize, - size_t *offset, - size_t *outSizeProcessed, - ISzAlloc *allocMain, - ISzAlloc *allocTemp) -{ - UInt32 folderIndex = db->FileIndexToFolderIndexMap[fileIndex]; - SZ_RESULT res = SZ_OK; - *offset = 0; - *outSizeProcessed = 0; - if (folderIndex == (UInt32)-1) - { - allocMain->Free(*outBuffer); - *blockIndex = folderIndex; - *outBuffer = 0; - *outBufferSize = 0; - return SZ_OK; - } - - if (*outBuffer == 0 || *blockIndex != folderIndex) - { - CFolder *folder = db->Database.Folders + folderIndex; - CFileSize unPackSizeSpec = SzFolderGetUnPackSize(folder); - size_t unPackSize = (size_t)unPackSizeSpec; - CFileSize startOffset = SzArDbGetFolderStreamPos(db, folderIndex, 0); - #ifndef _LZMA_IN_CB - Byte *inBuffer = 0; - size_t processedSize; - CFileSize packSizeSpec; - size_t packSize; - RINOK(SzArDbGetFolderFullPackSize(db, folderIndex, &packSizeSpec)); - packSize = (size_t)packSizeSpec; - if (packSize != packSizeSpec) - return SZE_OUTOFMEMORY; - #endif - if (unPackSize != unPackSizeSpec) - return SZE_OUTOFMEMORY; - *blockIndex = folderIndex; - allocMain->Free(*outBuffer); - *outBuffer = 0; - - RINOK(inStream->Seek(inStream, startOffset)); - - #ifndef _LZMA_IN_CB - if (packSize != 0) - { - inBuffer = (Byte *)allocTemp->Alloc(packSize); - if (inBuffer == 0) - return SZE_OUTOFMEMORY; - } - res = inStream->Read(inStream, inBuffer, packSize, &processedSize); - if (res == SZ_OK && processedSize != packSize) - res = SZE_FAIL; - #endif - if (res == SZ_OK) - { - *outBufferSize = unPackSize; - if (unPackSize != 0) - { - *outBuffer = (Byte *)allocMain->Alloc(unPackSize); - if (*outBuffer == 0) - res = SZE_OUTOFMEMORY; - } - if (res == SZ_OK) - { - res = SzDecode(db->Database.PackSizes + - db->FolderStartPackStreamIndex[folderIndex], folder, - #ifdef _LZMA_IN_CB - inStream, startOffset, - #else - inBuffer, - #endif - *outBuffer, unPackSize, allocTemp); - if (res == SZ_OK) - { - if (folder->UnPackCRCDefined) - { - if (CrcCalc(*outBuffer, unPackSize) != folder->UnPackCRC) - res = SZE_CRC_ERROR; - } - } - } - } - #ifndef _LZMA_IN_CB - allocTemp->Free(inBuffer); - #endif - } - if (res == SZ_OK) - { - UInt32 i; - CFileItem *fileItem = db->Database.Files + fileIndex; - *offset = 0; - for(i = db->FolderStartFileIndex[folderIndex]; i < fileIndex; i++) - *offset += (UInt32)db->Database.Files[i].Size; - *outSizeProcessed = (size_t)fileItem->Size; - if (*offset + *outSizeProcessed > *outBufferSize) - return SZE_FAIL; - { - if (fileItem->IsFileCRCDefined) - { - if (CrcCalc(*outBuffer + *offset, *outSizeProcessed) != fileItem->FileCRC) - res = SZE_CRC_ERROR; - } - } - } - return res; -} diff --git a/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zExtract.h b/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zExtract.h deleted file mode 100644 index e9a4fb4e..00000000 --- a/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zExtract.h +++ /dev/null @@ -1,40 +0,0 @@ -/* 7zExtract.h */ - -#ifndef __7Z_EXTRACT_H -#define __7Z_EXTRACT_H - -#include "7zIn.h" - -/* - SzExtract extracts file from archive - - *outBuffer must be 0 before first call for each new archive. - - Extracting cache: - If you need to decompress more than one file, you can send - these values from previous call: - *blockIndex, - *outBuffer, - *outBufferSize - You can consider "*outBuffer" as cache of solid block. If your archive is solid, - it will increase decompression speed. - - If you use external function, you can declare these 3 cache variables - (blockIndex, outBuffer, outBufferSize) as static in that external function. - - Free *outBuffer and set *outBuffer to 0, if you want to flush cache. -*/ - -SZ_RESULT SzExtract( - ISzInStream *inStream, - CArchiveDatabaseEx *db, - UInt32 fileIndex, /* index of file */ - UInt32 *blockIndex, /* index of solid block */ - Byte **outBuffer, /* pointer to pointer to output buffer (allocated with allocMain) */ - size_t *outBufferSize, /* buffer size for output buffer */ - size_t *offset, /* offset of stream for required file in *outBuffer */ - size_t *outSizeProcessed, /* size of file in *outBuffer */ - ISzAlloc *allocMain, - ISzAlloc *allocTemp); - -#endif diff --git a/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zHeader.c b/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zHeader.c deleted file mode 100644 index 3be4bc27..00000000 --- a/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zHeader.c +++ /dev/null @@ -1,5 +0,0 @@ -/* 7zHeader.c */ - -#include "7zHeader.h" - -Byte k7zSignature[k7zSignatureSize] = {'7', 'z', 0xBC, 0xAF, 0x27, 0x1C}; diff --git a/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zHeader.h b/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zHeader.h deleted file mode 100644 index 3e67cf57..00000000 --- a/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zHeader.h +++ /dev/null @@ -1,55 +0,0 @@ -/* 7zHeader.h */ - -#ifndef __7Z_HEADER_H -#define __7Z_HEADER_H - -#include "../../Types.h" - -#define k7zSignatureSize 6 -extern Byte k7zSignature[k7zSignatureSize]; - -#define k7zMajorVersion 0 - -#define k7zStartHeaderSize 0x20 - -enum EIdEnum -{ - k7zIdEnd, - - k7zIdHeader, - - k7zIdArchiveProperties, - - k7zIdAdditionalStreamsInfo, - k7zIdMainStreamsInfo, - k7zIdFilesInfo, - - k7zIdPackInfo, - k7zIdUnPackInfo, - k7zIdSubStreamsInfo, - - k7zIdSize, - k7zIdCRC, - - k7zIdFolder, - - k7zIdCodersUnPackSize, - k7zIdNumUnPackStream, - - k7zIdEmptyStream, - k7zIdEmptyFile, - k7zIdAnti, - - k7zIdName, - k7zIdCreationTime, - k7zIdLastAccessTime, - k7zIdLastWriteTime, - k7zIdWinAttributes, - k7zIdComment, - - k7zIdEncodedHeader, - - k7zIdStartPos -}; - -#endif diff --git a/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zIn.c b/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zIn.c deleted file mode 100644 index 42e40f5e..00000000 --- a/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zIn.c +++ /dev/null @@ -1,1348 +0,0 @@ -/* 7zIn.c */ - -#include "7zIn.h" -#include "7zDecode.h" -#include "../../7zCrc.h" - -#define RINOM(x) { if((x) == 0) return SZE_OUTOFMEMORY; } - -void SzArDbExInit(CArchiveDatabaseEx *db) -{ - SzArchiveDatabaseInit(&db->Database); - db->FolderStartPackStreamIndex = 0; - db->PackStreamStartPositions = 0; - db->FolderStartFileIndex = 0; - db->FileIndexToFolderIndexMap = 0; -} - -void SzArDbExFree(CArchiveDatabaseEx *db, void (*freeFunc)(void *)) -{ - freeFunc(db->FolderStartPackStreamIndex); - freeFunc(db->PackStreamStartPositions); - freeFunc(db->FolderStartFileIndex); - freeFunc(db->FileIndexToFolderIndexMap); - SzArchiveDatabaseFree(&db->Database, freeFunc); - SzArDbExInit(db); -} - -/* -CFileSize GetFolderPackStreamSize(int folderIndex, int streamIndex) const -{ - return PackSizes[FolderStartPackStreamIndex[folderIndex] + streamIndex]; -} - -CFileSize GetFilePackSize(int fileIndex) const -{ - int folderIndex = FileIndexToFolderIndexMap[fileIndex]; - if (folderIndex >= 0) - { - const CFolder &folderInfo = Folders[folderIndex]; - if (FolderStartFileIndex[folderIndex] == fileIndex) - return GetFolderFullPackSize(folderIndex); - } - return 0; -} -*/ - -#define MY_ALLOC(T, p, size, allocFunc) { if ((size) == 0) p = 0; else \ - if ((p = (T *)allocFunc((size) * sizeof(T))) == 0) return SZE_OUTOFMEMORY; } - -static -SZ_RESULT SzArDbExFill(CArchiveDatabaseEx *db, void * (*allocFunc)(size_t size)) -{ - UInt32 startPos = 0; - CFileSize startPosSize = 0; - UInt32 i; - UInt32 folderIndex = 0; - UInt32 indexInFolder = 0; - MY_ALLOC(UInt32, db->FolderStartPackStreamIndex, db->Database.NumFolders, allocFunc); - for(i = 0; i < db->Database.NumFolders; i++) - { - db->FolderStartPackStreamIndex[i] = startPos; - startPos += db->Database.Folders[i].NumPackStreams; - } - - MY_ALLOC(CFileSize, db->PackStreamStartPositions, db->Database.NumPackStreams, allocFunc); - - for(i = 0; i < db->Database.NumPackStreams; i++) - { - db->PackStreamStartPositions[i] = startPosSize; - startPosSize += db->Database.PackSizes[i]; - } - - MY_ALLOC(UInt32, db->FolderStartFileIndex, db->Database.NumFolders, allocFunc); - MY_ALLOC(UInt32, db->FileIndexToFolderIndexMap, db->Database.NumFiles, allocFunc); - - for (i = 0; i < db->Database.NumFiles; i++) - { - CFileItem *file = db->Database.Files + i; - int emptyStream = !file->HasStream; - if (emptyStream && indexInFolder == 0) - { - db->FileIndexToFolderIndexMap[i] = (UInt32)-1; - continue; - } - if (indexInFolder == 0) - { - /* - v3.13 incorrectly worked with empty folders - v4.07: Loop for skipping empty folders - */ - for (;;) - { - if (folderIndex >= db->Database.NumFolders) - return SZE_ARCHIVE_ERROR; - db->FolderStartFileIndex[folderIndex] = i; - if (db->Database.Folders[folderIndex].NumUnPackStreams != 0) - break; - folderIndex++; - } - } - db->FileIndexToFolderIndexMap[i] = folderIndex; - if (emptyStream) - continue; - indexInFolder++; - if (indexInFolder >= db->Database.Folders[folderIndex].NumUnPackStreams) - { - folderIndex++; - indexInFolder = 0; - } - } - return SZ_OK; -} - - -CFileSize SzArDbGetFolderStreamPos(CArchiveDatabaseEx *db, UInt32 folderIndex, UInt32 indexInFolder) -{ - return db->ArchiveInfo.DataStartPosition + - db->PackStreamStartPositions[db->FolderStartPackStreamIndex[folderIndex] + indexInFolder]; -} - -int SzArDbGetFolderFullPackSize(CArchiveDatabaseEx *db, UInt32 folderIndex, CFileSize *resSize) -{ - UInt32 packStreamIndex = db->FolderStartPackStreamIndex[folderIndex]; - CFolder *folder = db->Database.Folders + folderIndex; - CFileSize size = 0; - UInt32 i; - for (i = 0; i < folder->NumPackStreams; i++) - { - CFileSize t = size + db->Database.PackSizes[packStreamIndex + i]; - if (t < size) - return SZE_FAIL; - size = t; - } - *resSize = size; - return SZ_OK; -} - - -/* -SZ_RESULT SzReadTime(const CObjectVector &dataVector, - CObjectVector &files, UInt64 type) -{ - CBoolVector boolVector; - RINOK(ReadBoolVector2(files.Size(), boolVector)) - - CStreamSwitch streamSwitch; - RINOK(streamSwitch.Set(this, &dataVector)); - - for(int i = 0; i < files.Size(); i++) - { - CFileItem &file = files[i]; - CArchiveFileTime fileTime; - bool defined = boolVector[i]; - if (defined) - { - UInt32 low, high; - RINOK(SzReadUInt32(low)); - RINOK(SzReadUInt32(high)); - fileTime.dwLowDateTime = low; - fileTime.dwHighDateTime = high; - } - switch(type) - { - case k7zIdCreationTime: - file.IsCreationTimeDefined = defined; - if (defined) - file.CreationTime = fileTime; - break; - case k7zIdLastWriteTime: - file.IsLastWriteTimeDefined = defined; - if (defined) - file.LastWriteTime = fileTime; - break; - case k7zIdLastAccessTime: - file.IsLastAccessTimeDefined = defined; - if (defined) - file.LastAccessTime = fileTime; - break; - } - } - return SZ_OK; -} -*/ - -static -SZ_RESULT SafeReadDirect(ISzInStream *inStream, Byte *data, size_t size) -{ - #ifdef _LZMA_IN_CB - while (size > 0) - { - void *inBufferSpec; - size_t processedSize; - const Byte *inBuffer; - RINOK(inStream->Read(inStream, (void **)&inBufferSpec, size, &processedSize)); - inBuffer = (const Byte *)inBufferSpec; - if (processedSize == 0 || processedSize > size) - return SZE_FAIL; - size -= processedSize; - do - { - *data++ = *inBuffer++; - } - while (--processedSize != 0); - } - #else - size_t processedSize; - RINOK(inStream->Read(inStream, data, size, &processedSize)); - if (processedSize != size) - return SZE_FAIL; - #endif - return SZ_OK; -} - -static -SZ_RESULT SafeReadDirectByte(ISzInStream *inStream, Byte *data) -{ - return SafeReadDirect(inStream, data, 1); -} - -static -SZ_RESULT SafeReadDirectUInt32(ISzInStream *inStream, UInt32 *value, UInt32 *crc) -{ - int i; - *value = 0; - for (i = 0; i < 4; i++) - { - Byte b; - RINOK(SafeReadDirectByte(inStream, &b)); - *value |= ((UInt32)b << (8 * i)); - *crc = CRC_UPDATE_BYTE(*crc, b); - } - return SZ_OK; -} - -static -SZ_RESULT SafeReadDirectUInt64(ISzInStream *inStream, UInt64 *value, UInt32 *crc) -{ - int i; - *value = 0; - for (i = 0; i < 8; i++) - { - Byte b; - RINOK(SafeReadDirectByte(inStream, &b)); - *value |= ((UInt64)b << (8 * i)); - *crc = CRC_UPDATE_BYTE(*crc, b); - } - return SZ_OK; -} - -static -int TestSignatureCandidate(Byte *testBytes) -{ - size_t i; - for (i = 0; i < k7zSignatureSize; i++) - if (testBytes[i] != k7zSignature[i]) - return 0; - return 1; -} - -typedef struct _CSzState -{ - Byte *Data; - size_t Size; -}CSzData; - -static -SZ_RESULT SzReadByte(CSzData *sd, Byte *b) -{ - if (sd->Size == 0) - return SZE_ARCHIVE_ERROR; - sd->Size--; - *b = *sd->Data++; - return SZ_OK; -} - -static -SZ_RESULT SzReadBytes(CSzData *sd, Byte *data, size_t size) -{ - size_t i; - for (i = 0; i < size; i++) - { - RINOK(SzReadByte(sd, data + i)); - } - return SZ_OK; -} - -static -SZ_RESULT SzReadUInt32(CSzData *sd, UInt32 *value) -{ - int i; - *value = 0; - for (i = 0; i < 4; i++) - { - Byte b; - RINOK(SzReadByte(sd, &b)); - *value |= ((UInt32)(b) << (8 * i)); - } - return SZ_OK; -} - -static -SZ_RESULT SzReadNumber(CSzData *sd, UInt64 *value) -{ - Byte firstByte; - Byte mask = 0x80; - int i; - RINOK(SzReadByte(sd, &firstByte)); - *value = 0; - for (i = 0; i < 8; i++) - { - Byte b; - if ((firstByte & mask) == 0) - { - UInt64 highPart = firstByte & (mask - 1); - *value += (highPart << (8 * i)); - return SZ_OK; - } - RINOK(SzReadByte(sd, &b)); - *value |= ((UInt64)b << (8 * i)); - mask >>= 1; - } - return SZ_OK; -} - -static -SZ_RESULT SzReadSize(CSzData *sd, CFileSize *value) -{ - UInt64 value64; - RINOK(SzReadNumber(sd, &value64)); - *value = (CFileSize)value64; - return SZ_OK; -} - -static -SZ_RESULT SzReadNumber32(CSzData *sd, UInt32 *value) -{ - UInt64 value64; - RINOK(SzReadNumber(sd, &value64)); - if (value64 >= 0x80000000) - return SZE_NOTIMPL; - if (value64 >= ((UInt64)(1) << ((sizeof(size_t) - 1) * 8 + 2))) - return SZE_NOTIMPL; - *value = (UInt32)value64; - return SZ_OK; -} - -static -SZ_RESULT SzReadID(CSzData *sd, UInt64 *value) -{ - return SzReadNumber(sd, value); -} - -static -SZ_RESULT SzSkeepDataSize(CSzData *sd, UInt64 size) -{ - if (size > sd->Size) - return SZE_ARCHIVE_ERROR; - sd->Size -= (size_t)size; - sd->Data += (size_t)size; - return SZ_OK; -} - -static -SZ_RESULT SzSkeepData(CSzData *sd) -{ - UInt64 size; - RINOK(SzReadNumber(sd, &size)); - return SzSkeepDataSize(sd, size); -} - -static -SZ_RESULT SzReadArchiveProperties(CSzData *sd) -{ - for (;;) - { - UInt64 type; - RINOK(SzReadID(sd, &type)); - if (type == k7zIdEnd) - break; - SzSkeepData(sd); - } - return SZ_OK; -} - -static -SZ_RESULT SzWaitAttribute(CSzData *sd, UInt64 attribute) -{ - for (;;) - { - UInt64 type; - RINOK(SzReadID(sd, &type)); - if (type == attribute) - return SZ_OK; - if (type == k7zIdEnd) - return SZE_ARCHIVE_ERROR; - RINOK(SzSkeepData(sd)); - } -} - -static -SZ_RESULT SzReadBoolVector(CSzData *sd, size_t numItems, Byte **v, void * (*allocFunc)(size_t size)) -{ - Byte b = 0; - Byte mask = 0; - size_t i; - MY_ALLOC(Byte, *v, numItems, allocFunc); - for (i = 0; i < numItems; i++) - { - if (mask == 0) - { - RINOK(SzReadByte(sd, &b)); - mask = 0x80; - } - (*v)[i] = (Byte)(((b & mask) != 0) ? 1 : 0); - mask >>= 1; - } - return SZ_OK; -} - -static -SZ_RESULT SzReadBoolVector2(CSzData *sd, size_t numItems, Byte **v, void * (*allocFunc)(size_t size)) -{ - Byte allAreDefined; - size_t i; - RINOK(SzReadByte(sd, &allAreDefined)); - if (allAreDefined == 0) - return SzReadBoolVector(sd, numItems, v, allocFunc); - MY_ALLOC(Byte, *v, numItems, allocFunc); - for(i = 0; i < numItems; i++) - (*v)[i] = 1; - return SZ_OK; -} - -static -SZ_RESULT SzReadHashDigests( - CSzData *sd, - size_t numItems, - Byte **digestsDefined, - UInt32 **digests, - void * (*allocFunc)(size_t size)) -{ - size_t i; - RINOK(SzReadBoolVector2(sd, numItems, digestsDefined, allocFunc)); - MY_ALLOC(UInt32, *digests, numItems, allocFunc); - for(i = 0; i < numItems; i++) - if ((*digestsDefined)[i]) - { - RINOK(SzReadUInt32(sd, (*digests) + i)); - } - return SZ_OK; -} - -static -SZ_RESULT SzReadPackInfo( - CSzData *sd, - CFileSize *dataOffset, - UInt32 *numPackStreams, - CFileSize **packSizes, - Byte **packCRCsDefined, - UInt32 **packCRCs, - void * (*allocFunc)(size_t size)) -{ - UInt32 i; - RINOK(SzReadSize(sd, dataOffset)); - RINOK(SzReadNumber32(sd, numPackStreams)); - - RINOK(SzWaitAttribute(sd, k7zIdSize)); - - MY_ALLOC(CFileSize, *packSizes, (size_t)*numPackStreams, allocFunc); - - for(i = 0; i < *numPackStreams; i++) - { - RINOK(SzReadSize(sd, (*packSizes) + i)); - } - - for (;;) - { - UInt64 type; - RINOK(SzReadID(sd, &type)); - if (type == k7zIdEnd) - break; - if (type == k7zIdCRC) - { - RINOK(SzReadHashDigests(sd, (size_t)*numPackStreams, packCRCsDefined, packCRCs, allocFunc)); - continue; - } - RINOK(SzSkeepData(sd)); - } - if (*packCRCsDefined == 0) - { - MY_ALLOC(Byte, *packCRCsDefined, (size_t)*numPackStreams, allocFunc); - MY_ALLOC(UInt32, *packCRCs, (size_t)*numPackStreams, allocFunc); - for(i = 0; i < *numPackStreams; i++) - { - (*packCRCsDefined)[i] = 0; - (*packCRCs)[i] = 0; - } - } - return SZ_OK; -} - -static -SZ_RESULT SzReadSwitch(CSzData *sd) -{ - Byte external; - RINOK(SzReadByte(sd, &external)); - return (external == 0) ? SZ_OK: SZE_ARCHIVE_ERROR; -} - -static -SZ_RESULT SzGetNextFolderItem(CSzData *sd, CFolder *folder, void * (*allocFunc)(size_t size)) -{ - UInt32 numCoders; - UInt32 numBindPairs; - UInt32 numPackedStreams; - UInt32 i; - UInt32 numInStreams = 0; - UInt32 numOutStreams = 0; - RINOK(SzReadNumber32(sd, &numCoders)); - folder->NumCoders = numCoders; - - MY_ALLOC(CCoderInfo, folder->Coders, (size_t)numCoders, allocFunc); - - for (i = 0; i < numCoders; i++) - SzCoderInfoInit(folder->Coders + i); - - for (i = 0; i < numCoders; i++) - { - Byte mainByte; - CCoderInfo *coder = folder->Coders + i; - { - unsigned idSize, j; - Byte longID[15]; - RINOK(SzReadByte(sd, &mainByte)); - idSize = (unsigned)(mainByte & 0xF); - RINOK(SzReadBytes(sd, longID, idSize)); - if (idSize > sizeof(coder->MethodID)) - return SZE_NOTIMPL; - coder->MethodID = 0; - for (j = 0; j < idSize; j++) - coder->MethodID |= (CMethodID)longID[idSize - 1 - j] << (8 * j); - - if ((mainByte & 0x10) != 0) - { - RINOK(SzReadNumber32(sd, &coder->NumInStreams)); - RINOK(SzReadNumber32(sd, &coder->NumOutStreams)); - } - else - { - coder->NumInStreams = 1; - coder->NumOutStreams = 1; - } - if ((mainByte & 0x20) != 0) - { - UInt64 propertiesSize = 0; - RINOK(SzReadNumber(sd, &propertiesSize)); - if (!SzByteBufferCreate(&coder->Properties, (size_t)propertiesSize, allocFunc)) - return SZE_OUTOFMEMORY; - RINOK(SzReadBytes(sd, coder->Properties.Items, (size_t)propertiesSize)); - } - } - while ((mainByte & 0x80) != 0) - { - RINOK(SzReadByte(sd, &mainByte)); - RINOK(SzSkeepDataSize(sd, (mainByte & 0xF))); - if ((mainByte & 0x10) != 0) - { - UInt32 n; - RINOK(SzReadNumber32(sd, &n)); - RINOK(SzReadNumber32(sd, &n)); - } - if ((mainByte & 0x20) != 0) - { - UInt64 propertiesSize = 0; - RINOK(SzReadNumber(sd, &propertiesSize)); - RINOK(SzSkeepDataSize(sd, propertiesSize)); - } - } - numInStreams += (UInt32)coder->NumInStreams; - numOutStreams += (UInt32)coder->NumOutStreams; - } - - numBindPairs = numOutStreams - 1; - folder->NumBindPairs = numBindPairs; - - - MY_ALLOC(CBindPair, folder->BindPairs, (size_t)numBindPairs, allocFunc); - - for (i = 0; i < numBindPairs; i++) - { - CBindPair *bindPair = folder->BindPairs + i;; - RINOK(SzReadNumber32(sd, &bindPair->InIndex)); - RINOK(SzReadNumber32(sd, &bindPair->OutIndex)); - } - - numPackedStreams = numInStreams - (UInt32)numBindPairs; - - folder->NumPackStreams = numPackedStreams; - MY_ALLOC(UInt32, folder->PackStreams, (size_t)numPackedStreams, allocFunc); - - if (numPackedStreams == 1) - { - UInt32 j; - UInt32 pi = 0; - for (j = 0; j < numInStreams; j++) - if (SzFolderFindBindPairForInStream(folder, j) < 0) - { - folder->PackStreams[pi++] = j; - break; - } - } - else - for(i = 0; i < numPackedStreams; i++) - { - RINOK(SzReadNumber32(sd, folder->PackStreams + i)); - } - return SZ_OK; -} - -static -SZ_RESULT SzReadUnPackInfo( - CSzData *sd, - UInt32 *numFolders, - CFolder **folders, /* for allocFunc */ - void * (*allocFunc)(size_t size), - ISzAlloc *allocTemp) -{ - UInt32 i; - RINOK(SzWaitAttribute(sd, k7zIdFolder)); - RINOK(SzReadNumber32(sd, numFolders)); - { - RINOK(SzReadSwitch(sd)); - - MY_ALLOC(CFolder, *folders, (size_t)*numFolders, allocFunc); - - for(i = 0; i < *numFolders; i++) - SzFolderInit((*folders) + i); - - for(i = 0; i < *numFolders; i++) - { - RINOK(SzGetNextFolderItem(sd, (*folders) + i, allocFunc)); - } - } - - RINOK(SzWaitAttribute(sd, k7zIdCodersUnPackSize)); - - for(i = 0; i < *numFolders; i++) - { - UInt32 j; - CFolder *folder = (*folders) + i; - UInt32 numOutStreams = SzFolderGetNumOutStreams(folder); - - MY_ALLOC(CFileSize, folder->UnPackSizes, (size_t)numOutStreams, allocFunc); - - for(j = 0; j < numOutStreams; j++) - { - RINOK(SzReadSize(sd, folder->UnPackSizes + j)); - } - } - - for (;;) - { - UInt64 type; - RINOK(SzReadID(sd, &type)); - if (type == k7zIdEnd) - return SZ_OK; - if (type == k7zIdCRC) - { - SZ_RESULT res; - Byte *crcsDefined = 0; - UInt32 *crcs = 0; - res = SzReadHashDigests(sd, *numFolders, &crcsDefined, &crcs, allocTemp->Alloc); - if (res == SZ_OK) - { - for(i = 0; i < *numFolders; i++) - { - CFolder *folder = (*folders) + i; - folder->UnPackCRCDefined = crcsDefined[i]; - folder->UnPackCRC = crcs[i]; - } - } - allocTemp->Free(crcs); - allocTemp->Free(crcsDefined); - RINOK(res); - continue; - } - RINOK(SzSkeepData(sd)); - } -} - -static -SZ_RESULT SzReadSubStreamsInfo( - CSzData *sd, - UInt32 numFolders, - CFolder *folders, - UInt32 *numUnPackStreams, - CFileSize **unPackSizes, - Byte **digestsDefined, - UInt32 **digests, - ISzAlloc *allocTemp) -{ - UInt64 type = 0; - UInt32 i; - UInt32 si = 0; - UInt32 numDigests = 0; - - for(i = 0; i < numFolders; i++) - folders[i].NumUnPackStreams = 1; - *numUnPackStreams = numFolders; - - for (;;) - { - RINOK(SzReadID(sd, &type)); - if (type == k7zIdNumUnPackStream) - { - *numUnPackStreams = 0; - for(i = 0; i < numFolders; i++) - { - UInt32 numStreams; - RINOK(SzReadNumber32(sd, &numStreams)); - folders[i].NumUnPackStreams = numStreams; - *numUnPackStreams += numStreams; - } - continue; - } - if (type == k7zIdCRC || type == k7zIdSize) - break; - if (type == k7zIdEnd) - break; - RINOK(SzSkeepData(sd)); - } - - if (*numUnPackStreams == 0) - { - *unPackSizes = 0; - *digestsDefined = 0; - *digests = 0; - } - else - { - *unPackSizes = (CFileSize *)allocTemp->Alloc((size_t)*numUnPackStreams * sizeof(CFileSize)); - RINOM(*unPackSizes); - *digestsDefined = (Byte *)allocTemp->Alloc((size_t)*numUnPackStreams * sizeof(Byte)); - RINOM(*digestsDefined); - *digests = (UInt32 *)allocTemp->Alloc((size_t)*numUnPackStreams * sizeof(UInt32)); - RINOM(*digests); - } - - for(i = 0; i < numFolders; i++) - { - /* - v3.13 incorrectly worked with empty folders - v4.07: we check that folder is empty - */ - CFileSize sum = 0; - UInt32 j; - UInt32 numSubstreams = folders[i].NumUnPackStreams; - if (numSubstreams == 0) - continue; - if (type == k7zIdSize) - for (j = 1; j < numSubstreams; j++) - { - CFileSize size; - RINOK(SzReadSize(sd, &size)); - (*unPackSizes)[si++] = size; - sum += size; - } - (*unPackSizes)[si++] = SzFolderGetUnPackSize(folders + i) - sum; - } - if (type == k7zIdSize) - { - RINOK(SzReadID(sd, &type)); - } - - for(i = 0; i < *numUnPackStreams; i++) - { - (*digestsDefined)[i] = 0; - (*digests)[i] = 0; - } - - - for(i = 0; i < numFolders; i++) - { - UInt32 numSubstreams = folders[i].NumUnPackStreams; - if (numSubstreams != 1 || !folders[i].UnPackCRCDefined) - numDigests += numSubstreams; - } - - - si = 0; - for (;;) - { - if (type == k7zIdCRC) - { - int digestIndex = 0; - Byte *digestsDefined2 = 0; - UInt32 *digests2 = 0; - SZ_RESULT res = SzReadHashDigests(sd, numDigests, &digestsDefined2, &digests2, allocTemp->Alloc); - if (res == SZ_OK) - { - for (i = 0; i < numFolders; i++) - { - CFolder *folder = folders + i; - UInt32 numSubstreams = folder->NumUnPackStreams; - if (numSubstreams == 1 && folder->UnPackCRCDefined) - { - (*digestsDefined)[si] = 1; - (*digests)[si] = folder->UnPackCRC; - si++; - } - else - { - UInt32 j; - for (j = 0; j < numSubstreams; j++, digestIndex++) - { - (*digestsDefined)[si] = digestsDefined2[digestIndex]; - (*digests)[si] = digests2[digestIndex]; - si++; - } - } - } - } - allocTemp->Free(digestsDefined2); - allocTemp->Free(digests2); - RINOK(res); - } - else if (type == k7zIdEnd) - return SZ_OK; - else - { - RINOK(SzSkeepData(sd)); - } - RINOK(SzReadID(sd, &type)); - } -} - - -static -SZ_RESULT SzReadStreamsInfo( - CSzData *sd, - CFileSize *dataOffset, - CArchiveDatabase *db, - UInt32 *numUnPackStreams, - CFileSize **unPackSizes, /* allocTemp */ - Byte **digestsDefined, /* allocTemp */ - UInt32 **digests, /* allocTemp */ - void * (*allocFunc)(size_t size), - ISzAlloc *allocTemp) -{ - for (;;) - { - UInt64 type; - RINOK(SzReadID(sd, &type)); - if ((UInt64)(int)type != type) - return SZE_FAIL; - switch((int)type) - { - case k7zIdEnd: - return SZ_OK; - case k7zIdPackInfo: - { - RINOK(SzReadPackInfo(sd, dataOffset, &db->NumPackStreams, - &db->PackSizes, &db->PackCRCsDefined, &db->PackCRCs, allocFunc)); - break; - } - case k7zIdUnPackInfo: - { - RINOK(SzReadUnPackInfo(sd, &db->NumFolders, &db->Folders, allocFunc, allocTemp)); - break; - } - case k7zIdSubStreamsInfo: - { - RINOK(SzReadSubStreamsInfo(sd, db->NumFolders, db->Folders, - numUnPackStreams, unPackSizes, digestsDefined, digests, allocTemp)); - break; - } - default: - return SZE_FAIL; - } - } -} - -Byte kUtf8Limits[5] = { 0xC0, 0xE0, 0xF0, 0xF8, 0xFC }; - -static -SZ_RESULT SzReadFileNames(CSzData *sd, UInt32 numFiles, CFileItem *files, - void * (*allocFunc)(size_t size)) -{ - UInt32 i; - for(i = 0; i < numFiles; i++) - { - UInt32 len = 0; - UInt32 pos = 0; - CFileItem *file = files + i; - while(pos + 2 <= sd->Size) - { - int numAdds; - UInt32 value = (UInt32)(sd->Data[pos] | (((UInt32)sd->Data[pos + 1]) << 8)); - pos += 2; - len++; - if (value == 0) - break; - if (value < 0x80) - continue; - if (value >= 0xD800 && value < 0xE000) - { - UInt32 c2; - if (value >= 0xDC00) - return SZE_ARCHIVE_ERROR; - if (pos + 2 > sd->Size) - return SZE_ARCHIVE_ERROR; - c2 = (UInt32)(sd->Data[pos] | (((UInt32)sd->Data[pos + 1]) << 8)); - pos += 2; - if (c2 < 0xDC00 || c2 >= 0xE000) - return SZE_ARCHIVE_ERROR; - value = ((value - 0xD800) << 10) | (c2 - 0xDC00); - } - for (numAdds = 1; numAdds < 5; numAdds++) - if (value < (((UInt32)1) << (numAdds * 5 + 6))) - break; - len += numAdds; - } - - MY_ALLOC(char, file->Name, (size_t)len, allocFunc); - - len = 0; - while(2 <= sd->Size) - { - int numAdds; - UInt32 value = (UInt32)(sd->Data[0] | (((UInt32)sd->Data[1]) << 8)); - SzSkeepDataSize(sd, 2); - if (value < 0x80) - { - file->Name[len++] = (char)value; - if (value == 0) - break; - continue; - } - if (value >= 0xD800 && value < 0xE000) - { - UInt32 c2 = (UInt32)(sd->Data[0] | (((UInt32)sd->Data[1]) << 8)); - SzSkeepDataSize(sd, 2); - value = ((value - 0xD800) << 10) | (c2 - 0xDC00); - } - for (numAdds = 1; numAdds < 5; numAdds++) - if (value < (((UInt32)1) << (numAdds * 5 + 6))) - break; - file->Name[len++] = (char)(kUtf8Limits[numAdds - 1] + (value >> (6 * numAdds))); - do - { - numAdds--; - file->Name[len++] = (char)(0x80 + ((value >> (6 * numAdds)) & 0x3F)); - } - while(numAdds > 0); - - len += numAdds; - } - } - return SZ_OK; -} - -static -SZ_RESULT SzReadHeader2( - CSzData *sd, - CArchiveDatabaseEx *db, /* allocMain */ - CFileSize **unPackSizes, /* allocTemp */ - Byte **digestsDefined, /* allocTemp */ - UInt32 **digests, /* allocTemp */ - Byte **emptyStreamVector, /* allocTemp */ - Byte **emptyFileVector, /* allocTemp */ - Byte **lwtVector, /* allocTemp */ - ISzAlloc *allocMain, - ISzAlloc *allocTemp) -{ - UInt64 type; - UInt32 numUnPackStreams = 0; - UInt32 numFiles = 0; - CFileItem *files = 0; - UInt32 numEmptyStreams = 0; - UInt32 i; - - RINOK(SzReadID(sd, &type)); - - if (type == k7zIdArchiveProperties) - { - RINOK(SzReadArchiveProperties(sd)); - RINOK(SzReadID(sd, &type)); - } - - - if (type == k7zIdMainStreamsInfo) - { - RINOK(SzReadStreamsInfo(sd, - &db->ArchiveInfo.DataStartPosition, - &db->Database, - &numUnPackStreams, - unPackSizes, - digestsDefined, - digests, allocMain->Alloc, allocTemp)); - db->ArchiveInfo.DataStartPosition += db->ArchiveInfo.StartPositionAfterHeader; - RINOK(SzReadID(sd, &type)); - } - - if (type == k7zIdEnd) - return SZ_OK; - if (type != k7zIdFilesInfo) - return SZE_ARCHIVE_ERROR; - - RINOK(SzReadNumber32(sd, &numFiles)); - db->Database.NumFiles = numFiles; - - MY_ALLOC(CFileItem, files, (size_t)numFiles, allocMain->Alloc); - - db->Database.Files = files; - for(i = 0; i < numFiles; i++) - SzFileInit(files + i); - - for (;;) - { - UInt64 type; - UInt64 size; - RINOK(SzReadID(sd, &type)); - if (type == k7zIdEnd) - break; - RINOK(SzReadNumber(sd, &size)); - - if ((UInt64)(int)type != type) - { - RINOK(SzSkeepDataSize(sd, size)); - } - else - switch((int)type) - { - case k7zIdName: - { - RINOK(SzReadSwitch(sd)); - RINOK(SzReadFileNames(sd, numFiles, files, allocMain->Alloc)) - break; - } - case k7zIdEmptyStream: - { - RINOK(SzReadBoolVector(sd, numFiles, emptyStreamVector, allocTemp->Alloc)); - numEmptyStreams = 0; - for (i = 0; i < numFiles; i++) - if ((*emptyStreamVector)[i]) - numEmptyStreams++; - break; - } - case k7zIdEmptyFile: - { - RINOK(SzReadBoolVector(sd, numEmptyStreams, emptyFileVector, allocTemp->Alloc)); - break; - } - case k7zIdLastWriteTime: - { - RINOK(SzReadBoolVector2(sd, numFiles, lwtVector, allocTemp->Alloc)); - RINOK(SzReadSwitch(sd)); - for (i = 0; i < numFiles; i++) - { - CFileItem *f = &files[i]; - Byte defined = (*lwtVector)[i]; - f->IsLastWriteTimeDefined = defined; - f->LastWriteTime.Low = f->LastWriteTime.High = 0; - if (defined) - { - RINOK(SzReadUInt32(sd, &f->LastWriteTime.Low)); - RINOK(SzReadUInt32(sd, &f->LastWriteTime.High)); - } - } - break; - } - default: - { - RINOK(SzSkeepDataSize(sd, size)); - } - } - } - - { - UInt32 emptyFileIndex = 0; - UInt32 sizeIndex = 0; - for(i = 0; i < numFiles; i++) - { - CFileItem *file = files + i; - file->IsAnti = 0; - if (*emptyStreamVector == 0) - file->HasStream = 1; - else - file->HasStream = (Byte)((*emptyStreamVector)[i] ? 0 : 1); - if(file->HasStream) - { - file->IsDirectory = 0; - file->Size = (*unPackSizes)[sizeIndex]; - file->FileCRC = (*digests)[sizeIndex]; - file->IsFileCRCDefined = (Byte)(*digestsDefined)[sizeIndex]; - sizeIndex++; - } - else - { - if (*emptyFileVector == 0) - file->IsDirectory = 1; - else - file->IsDirectory = (Byte)((*emptyFileVector)[emptyFileIndex] ? 0 : 1); - emptyFileIndex++; - file->Size = 0; - file->IsFileCRCDefined = 0; - } - } - } - return SzArDbExFill(db, allocMain->Alloc); -} - -static -SZ_RESULT SzReadHeader( - CSzData *sd, - CArchiveDatabaseEx *db, - ISzAlloc *allocMain, - ISzAlloc *allocTemp) -{ - CFileSize *unPackSizes = 0; - Byte *digestsDefined = 0; - UInt32 *digests = 0; - Byte *emptyStreamVector = 0; - Byte *emptyFileVector = 0; - Byte *lwtVector = 0; - SZ_RESULT res = SzReadHeader2(sd, db, - &unPackSizes, &digestsDefined, &digests, - &emptyStreamVector, &emptyFileVector, &lwtVector, - allocMain, allocTemp); - allocTemp->Free(unPackSizes); - allocTemp->Free(digestsDefined); - allocTemp->Free(digests); - allocTemp->Free(emptyStreamVector); - allocTemp->Free(emptyFileVector); - allocTemp->Free(lwtVector); - return res; -} - -static -SZ_RESULT SzReadAndDecodePackedStreams2( - ISzInStream *inStream, - CSzData *sd, - CSzByteBuffer *outBuffer, - CFileSize baseOffset, - CArchiveDatabase *db, - CFileSize **unPackSizes, - Byte **digestsDefined, - UInt32 **digests, - #ifndef _LZMA_IN_CB - Byte **inBuffer, - #endif - ISzAlloc *allocTemp) -{ - - UInt32 numUnPackStreams = 0; - CFileSize dataStartPos; - CFolder *folder; - #ifndef _LZMA_IN_CB - CFileSize packSize = 0; - UInt32 i = 0; - #endif - CFileSize unPackSize; - SZ_RESULT res; - - RINOK(SzReadStreamsInfo(sd, &dataStartPos, db, - &numUnPackStreams, unPackSizes, digestsDefined, digests, - allocTemp->Alloc, allocTemp)); - - dataStartPos += baseOffset; - if (db->NumFolders != 1) - return SZE_ARCHIVE_ERROR; - - folder = db->Folders; - unPackSize = SzFolderGetUnPackSize(folder); - - RINOK(inStream->Seek(inStream, dataStartPos)); - - #ifndef _LZMA_IN_CB - for (i = 0; i < db->NumPackStreams; i++) - packSize += db->PackSizes[i]; - - MY_ALLOC(Byte, *inBuffer, (size_t)packSize, allocTemp->Alloc); - - RINOK(SafeReadDirect(inStream, *inBuffer, (size_t)packSize)); - #endif - - if (!SzByteBufferCreate(outBuffer, (size_t)unPackSize, allocTemp->Alloc)) - return SZE_OUTOFMEMORY; - - res = SzDecode(db->PackSizes, folder, - #ifdef _LZMA_IN_CB - inStream, dataStartPos, - #else - *inBuffer, - #endif - outBuffer->Items, (size_t)unPackSize, allocTemp); - RINOK(res) - if (folder->UnPackCRCDefined) - if (CrcCalc(outBuffer->Items, (size_t)unPackSize) != folder->UnPackCRC) - return SZE_FAIL; - return SZ_OK; -} - -static -SZ_RESULT SzReadAndDecodePackedStreams( - ISzInStream *inStream, - CSzData *sd, - CSzByteBuffer *outBuffer, - CFileSize baseOffset, - ISzAlloc *allocTemp) -{ - CArchiveDatabase db; - CFileSize *unPackSizes = 0; - Byte *digestsDefined = 0; - UInt32 *digests = 0; - #ifndef _LZMA_IN_CB - Byte *inBuffer = 0; - #endif - SZ_RESULT res; - SzArchiveDatabaseInit(&db); - res = SzReadAndDecodePackedStreams2(inStream, sd, outBuffer, baseOffset, - &db, &unPackSizes, &digestsDefined, &digests, - #ifndef _LZMA_IN_CB - &inBuffer, - #endif - allocTemp); - SzArchiveDatabaseFree(&db, allocTemp->Free); - allocTemp->Free(unPackSizes); - allocTemp->Free(digestsDefined); - allocTemp->Free(digests); - #ifndef _LZMA_IN_CB - allocTemp->Free(inBuffer); - #endif - return res; -} - -static -SZ_RESULT SzArchiveOpen2( - ISzInStream *inStream, - CArchiveDatabaseEx *db, - ISzAlloc *allocMain, - ISzAlloc *allocTemp) -{ - Byte signature[k7zSignatureSize]; - Byte version; - UInt32 crcFromArchive; - UInt64 nextHeaderOffset; - UInt64 nextHeaderSize; - UInt32 nextHeaderCRC; - UInt32 crc = 0; - CFileSize pos = 0; - CSzByteBuffer buffer; - CSzData sd; - SZ_RESULT res; - - if (SafeReadDirect(inStream, signature, k7zSignatureSize)) - return SZE_ARCHIVE_ERROR; - - if (!TestSignatureCandidate(signature)) - return SZE_ARCHIVE_ERROR; - - /* - db.Clear(); - db.ArchiveInfo.StartPosition = _arhiveBeginStreamPosition; - */ - RINOK(SafeReadDirectByte(inStream, &version)); - if (version != k7zMajorVersion) - return SZE_ARCHIVE_ERROR; - RINOK(SafeReadDirectByte(inStream, &version)); - - RINOK(SafeReadDirectUInt32(inStream, &crcFromArchive, &crc)); - - crc = CRC_INIT_VAL; - RINOK(SafeReadDirectUInt64(inStream, &nextHeaderOffset, &crc)); - RINOK(SafeReadDirectUInt64(inStream, &nextHeaderSize, &crc)); - RINOK(SafeReadDirectUInt32(inStream, &nextHeaderCRC, &crc)); - - pos = k7zStartHeaderSize; - db->ArchiveInfo.StartPositionAfterHeader = pos; - - if (CRC_GET_DIGEST(crc) != crcFromArchive) - return SZE_ARCHIVE_ERROR; - - if (nextHeaderSize == 0) - return SZ_OK; - - RINOK(inStream->Seek(inStream, (CFileSize)(pos + nextHeaderOffset))); - - if (!SzByteBufferCreate(&buffer, (size_t)nextHeaderSize, allocTemp->Alloc)) - return SZE_OUTOFMEMORY; - - res = SafeReadDirect(inStream, buffer.Items, (size_t)nextHeaderSize); - if (res == SZ_OK) - { - res = SZE_ARCHIVE_ERROR; - if (CrcCalc(buffer.Items, (UInt32)nextHeaderSize) == nextHeaderCRC) - { - for (;;) - { - UInt64 type; - sd.Data = buffer.Items; - sd.Size = buffer.Capacity; - res = SzReadID(&sd, &type); - if (res != SZ_OK) - break; - if (type == k7zIdHeader) - { - res = SzReadHeader(&sd, db, allocMain, allocTemp); - break; - } - if (type != k7zIdEncodedHeader) - { - res = SZE_ARCHIVE_ERROR; - break; - } - { - CSzByteBuffer outBuffer; - SzByteBufferInit(&outBuffer); - res = SzReadAndDecodePackedStreams(inStream, &sd, &outBuffer, - db->ArchiveInfo.StartPositionAfterHeader, - allocTemp); - if (res != SZ_OK) - { - SzByteBufferFree(&outBuffer, allocTemp->Free); - break; - } - SzByteBufferFree(&buffer, allocTemp->Free); - buffer.Items = outBuffer.Items; - buffer.Capacity = outBuffer.Capacity; - } - } - } - } - SzByteBufferFree(&buffer, allocTemp->Free); - return res; -} - -SZ_RESULT SzArchiveOpen( - ISzInStream *inStream, - CArchiveDatabaseEx *db, - ISzAlloc *allocMain, - ISzAlloc *allocTemp) -{ - SZ_RESULT res = SzArchiveOpen2(inStream, db, allocMain, allocTemp); - if (res != SZ_OK) - SzArDbExFree(db, allocMain->Free); - return res; -} diff --git a/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zIn.h b/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zIn.h deleted file mode 100644 index 8ed3e63c..00000000 --- a/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zIn.h +++ /dev/null @@ -1,56 +0,0 @@ -/* 7zIn.h */ - -#ifndef __7Z_IN_H -#define __7Z_IN_H - -#include "7zHeader.h" -#include "7zItem.h" -#include "7zAlloc.h" -#include "../../Compress/Lzma/LzmaDecode.h" - -typedef struct _CInArchiveInfo -{ - CFileSize StartPositionAfterHeader; - CFileSize DataStartPosition; -}CInArchiveInfo; - -typedef struct _CArchiveDatabaseEx -{ - CArchiveDatabase Database; - CInArchiveInfo ArchiveInfo; - UInt32 *FolderStartPackStreamIndex; - CFileSize *PackStreamStartPositions; - UInt32 *FolderStartFileIndex; - UInt32 *FileIndexToFolderIndexMap; -}CArchiveDatabaseEx; - -void SzArDbExInit(CArchiveDatabaseEx *db); -void SzArDbExFree(CArchiveDatabaseEx *db, void (*freeFunc)(void *)); -CFileSize SzArDbGetFolderStreamPos(CArchiveDatabaseEx *db, UInt32 folderIndex, UInt32 indexInFolder); -int SzArDbGetFolderFullPackSize(CArchiveDatabaseEx *db, UInt32 folderIndex, CFileSize *resSize); - -typedef struct _ISzInStream -{ - #ifdef _LZMA_IN_CB - SZ_RESULT (*Read)( - void *object, /* pointer to ISzInStream itself */ - void **buffer, /* out: pointer to buffer with data */ - size_t maxRequiredSize, /* max required size to read */ - size_t *processedSize); /* real processed size. - processedSize can be less than maxRequiredSize. - If processedSize == 0, then there are no more - bytes in stream. */ - #else - SZ_RESULT (*Read)(void *object, void *buffer, size_t size, size_t *processedSize); - #endif - SZ_RESULT (*Seek)(void *object, CFileSize pos); -} ISzInStream; - - -int SzArchiveOpen( - ISzInStream *inStream, - CArchiveDatabaseEx *db, - ISzAlloc *allocMain, - ISzAlloc *allocTemp); - -#endif diff --git a/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zItem.c b/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zItem.c deleted file mode 100644 index 13bea4b3..00000000 --- a/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zItem.c +++ /dev/null @@ -1,140 +0,0 @@ -/* 7zItem.c */ - -#include "7zItem.h" -#include "7zAlloc.h" - -void SzCoderInfoInit(CCoderInfo *coder) -{ - SzByteBufferInit(&coder->Properties); -} - -void SzCoderInfoFree(CCoderInfo *coder, void (*freeFunc)(void *p)) -{ - SzByteBufferFree(&coder->Properties, freeFunc); - SzCoderInfoInit(coder); -} - -void SzFolderInit(CFolder *folder) -{ - folder->NumCoders = 0; - folder->Coders = 0; - folder->NumBindPairs = 0; - folder->BindPairs = 0; - folder->NumPackStreams = 0; - folder->PackStreams = 0; - folder->UnPackSizes = 0; - folder->UnPackCRCDefined = 0; - folder->UnPackCRC = 0; - folder->NumUnPackStreams = 0; -} - -static -void SzFolderFree(CFolder *folder, void (*freeFunc)(void *p)) -{ - UInt32 i; - if (folder->Coders) - for (i = 0; i < folder->NumCoders; i++) - SzCoderInfoFree(&folder->Coders[i], freeFunc); - freeFunc(folder->Coders); - freeFunc(folder->BindPairs); - freeFunc(folder->PackStreams); - freeFunc(folder->UnPackSizes); - SzFolderInit(folder); -} - -UInt32 SzFolderGetNumOutStreams(CFolder *folder) -{ - UInt32 result = 0; - UInt32 i; - for (i = 0; i < folder->NumCoders; i++) - result += folder->Coders[i].NumOutStreams; - return result; -} - -int SzFolderFindBindPairForInStream(CFolder *folder, UInt32 inStreamIndex) -{ - UInt32 i; - for(i = 0; i < folder->NumBindPairs; i++) - if (folder->BindPairs[i].InIndex == inStreamIndex) - return i; - return -1; -} - - -static -int SzFolderFindBindPairForOutStream(CFolder *folder, UInt32 outStreamIndex) -{ - UInt32 i; - for(i = 0; i < folder->NumBindPairs; i++) - if (folder->BindPairs[i].OutIndex == outStreamIndex) - return i; - return -1; -} - -CFileSize SzFolderGetUnPackSize(CFolder *folder) -{ - int i = (int)SzFolderGetNumOutStreams(folder); - if (i == 0) - return 0; - for (i--; i >= 0; i--) - if (SzFolderFindBindPairForOutStream(folder, i) < 0) - return folder->UnPackSizes[i]; - /* throw 1; */ - return 0; -} - -/* -int FindPackStreamArrayIndex(int inStreamIndex) const -{ - for(int i = 0; i < PackStreams.Size(); i++) - if (PackStreams[i] == inStreamIndex) - return i; - return -1; -} -*/ - -void SzFileInit(CFileItem *fileItem) -{ - fileItem->IsFileCRCDefined = 0; - fileItem->HasStream = 1; - fileItem->IsDirectory = 0; - fileItem->IsAnti = 0; - fileItem->IsLastWriteTimeDefined = 0; - fileItem->Name = 0; -} - -static -void SzFileFree(CFileItem *fileItem, void (*freeFunc)(void *p)) -{ - freeFunc(fileItem->Name); - SzFileInit(fileItem); -} - -void SzArchiveDatabaseInit(CArchiveDatabase *db) -{ - db->NumPackStreams = 0; - db->PackSizes = 0; - db->PackCRCsDefined = 0; - db->PackCRCs = 0; - db->NumFolders = 0; - db->Folders = 0; - db->NumFiles = 0; - db->Files = 0; -} - -void SzArchiveDatabaseFree(CArchiveDatabase *db, void (*freeFunc)(void *)) -{ - UInt32 i; - if (db->Folders) - for (i = 0; i < db->NumFolders; i++) - SzFolderFree(&db->Folders[i], freeFunc); - if (db->Files) - for (i = 0; i < db->NumFiles; i++) - SzFileFree(&db->Files[i], freeFunc); - freeFunc(db->PackSizes); - freeFunc(db->PackCRCsDefined); - freeFunc(db->PackCRCs); - freeFunc(db->Folders); - freeFunc(db->Files); - SzArchiveDatabaseInit(db); -} diff --git a/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zItem.h b/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zItem.h deleted file mode 100644 index 8ba74b42..00000000 --- a/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zItem.h +++ /dev/null @@ -1,95 +0,0 @@ -/* 7zItem.h */ - -#ifndef __7Z_ITEM_H -#define __7Z_ITEM_H - -#include "7zMethodID.h" -#include "7zHeader.h" -#include "7zBuffer.h" - -typedef struct _CCoderInfo -{ - UInt32 NumInStreams; - UInt32 NumOutStreams; - CMethodID MethodID; - CSzByteBuffer Properties; -}CCoderInfo; - -void SzCoderInfoInit(CCoderInfo *coder); -void SzCoderInfoFree(CCoderInfo *coder, void (*freeFunc)(void *p)); - -typedef struct _CBindPair -{ - UInt32 InIndex; - UInt32 OutIndex; -}CBindPair; - -typedef struct _CFolder -{ - UInt32 NumCoders; - CCoderInfo *Coders; - UInt32 NumBindPairs; - CBindPair *BindPairs; - UInt32 NumPackStreams; - UInt32 *PackStreams; - CFileSize *UnPackSizes; - int UnPackCRCDefined; - UInt32 UnPackCRC; - - UInt32 NumUnPackStreams; -}CFolder; - -void SzFolderInit(CFolder *folder); -CFileSize SzFolderGetUnPackSize(CFolder *folder); -int SzFolderFindBindPairForInStream(CFolder *folder, UInt32 inStreamIndex); -UInt32 SzFolderGetNumOutStreams(CFolder *folder); -/*CFileSize SzFolderGetUnPackSize(CFolder *folder);*/ - -typedef struct _CArchiveFileTime -{ - UInt32 Low; - UInt32 High; -} CArchiveFileTime; - -typedef struct _CFileItem -{ - CArchiveFileTime LastWriteTime; - /* - CFileSize StartPos; - UInt32 Attributes; - */ - CFileSize Size; - UInt32 FileCRC; - char *Name; - - Byte IsFileCRCDefined; - Byte HasStream; - Byte IsDirectory; - Byte IsAnti; - Byte IsLastWriteTimeDefined; - /* - int AreAttributesDefined; - int IsLastWriteTimeDefined; - int IsStartPosDefined; - */ -}CFileItem; - -void SzFileInit(CFileItem *fileItem); - -typedef struct _CArchiveDatabase -{ - UInt32 NumPackStreams; - CFileSize *PackSizes; - Byte *PackCRCsDefined; - UInt32 *PackCRCs; - UInt32 NumFolders; - CFolder *Folders; - UInt32 NumFiles; - CFileItem *Files; -}CArchiveDatabase; - -void SzArchiveDatabaseInit(CArchiveDatabase *db); -void SzArchiveDatabaseFree(CArchiveDatabase *db, void (*freeFunc)(void *)); - - -#endif diff --git a/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zMethodID.c b/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zMethodID.c deleted file mode 100644 index a7e825de..00000000 --- a/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zMethodID.c +++ /dev/null @@ -1,10 +0,0 @@ -/* 7zMethodID.c */ - -#include "7zMethodID.h" - -/* -int AreMethodsEqual(CMethodID *a1, CMethodID *a2) -{ - return (*a1 == *a2) ? 1 : 0; -} -*/ diff --git a/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zMethodID.h b/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zMethodID.h deleted file mode 100644 index 57f22a50..00000000 --- a/dependencies/File_Extractor-0.4.3/7z_C/Archive/7z/7zMethodID.h +++ /dev/null @@ -1,10 +0,0 @@ -/* 7zMethodID.h */ - -#ifndef __7Z_METHOD_ID_H -#define __7Z_METHOD_ID_H - -#include "../../Types.h" - -typedef UInt64 CMethodID; - -#endif diff --git a/dependencies/File_Extractor-0.4.3/7z_C/Compress/Branch/BranchTypes.h b/dependencies/File_Extractor-0.4.3/7z_C/Compress/Branch/BranchTypes.h deleted file mode 100644 index 1bed56a9..00000000 --- a/dependencies/File_Extractor-0.4.3/7z_C/Compress/Branch/BranchTypes.h +++ /dev/null @@ -1,51 +0,0 @@ -/* BranchTypes.h */ - -#ifndef __BRANCHTYPES_H -#define __BRANCHTYPES_H - -#ifndef _7ZIP_BYTE_DEFINED -#define _7ZIP_BYTE_DEFINED -typedef unsigned char Byte; -#endif - -#ifndef _7ZIP_UINT16_DEFINED -#define _7ZIP_UINT16_DEFINED -typedef unsigned short UInt16; -#endif - -#ifndef _7ZIP_UINT32_DEFINED -#define _7ZIP_UINT32_DEFINED -#ifdef _LZMA_UINT32_IS_ULONG -typedef unsigned long UInt32; -#else -typedef unsigned int UInt32; -#endif -#endif - -#ifndef _7ZIP_UINT64_DEFINED -#define _7ZIP_UINT64_DEFINED -#ifdef _SZ_NO_INT_64 -typedef unsigned long UInt64; -#else -#if defined(_MSC_VER) || defined(__BORLANDC__) -typedef unsigned __int64 UInt64; -#else -typedef unsigned long long int UInt64; -#endif -#endif -#endif - -/* #define _LZMA_NO_SYSTEM_SIZE_T */ -/* You can use it, if you don't want */ - -#ifndef _7ZIP_SIZET_DEFINED -#define _7ZIP_SIZET_DEFINED -#ifdef _LZMA_NO_SYSTEM_SIZE_T -typedef UInt32 SizeT; -#else -#include -typedef size_t SizeT; -#endif -#endif - -#endif diff --git a/dependencies/File_Extractor-0.4.3/7z_C/Compress/Branch/BranchX86.c b/dependencies/File_Extractor-0.4.3/7z_C/Compress/Branch/BranchX86.c deleted file mode 100644 index fd1d334e..00000000 --- a/dependencies/File_Extractor-0.4.3/7z_C/Compress/Branch/BranchX86.c +++ /dev/null @@ -1,84 +0,0 @@ -/* BranchX86.c */ - -#include "BranchX86.h" - -#define Test86MSByte(b) ((b) == 0 || (b) == 0xFF) - -const Byte kMaskToAllowedStatus[8] = {1, 1, 1, 0, 1, 0, 0, 0}; -const Byte kMaskToBitNumber[8] = {0, 1, 2, 2, 3, 3, 3, 3}; - -SizeT x86_Convert(Byte *buffer, SizeT endPos, UInt32 nowPos, UInt32 *prevMaskMix, int encoding) -{ - SizeT bufferPos = 0, prevPosT; - UInt32 prevMask = *prevMaskMix & 0x7; - if (endPos < 5) - return 0; - nowPos += 5; - prevPosT = (SizeT)0 - 1; - - for(;;) - { - Byte *p = buffer + bufferPos; - Byte *limit = buffer + endPos - 4; - for (; p < limit; p++) - if ((*p & 0xFE) == 0xE8) - break; - bufferPos = (SizeT)(p - buffer); - if (p >= limit) - break; - prevPosT = bufferPos - prevPosT; - if (prevPosT > 3) - prevMask = 0; - else - { - prevMask = (prevMask << ((int)prevPosT - 1)) & 0x7; - if (prevMask != 0) - { - Byte b = p[4 - kMaskToBitNumber[prevMask]]; - if (!kMaskToAllowedStatus[prevMask] || Test86MSByte(b)) - { - prevPosT = bufferPos; - prevMask = ((prevMask << 1) & 0x7) | 1; - bufferPos++; - continue; - } - } - } - prevPosT = bufferPos; - - if (Test86MSByte(p[4])) - { - UInt32 src = ((UInt32)p[4] << 24) | ((UInt32)p[3] << 16) | ((UInt32)p[2] << 8) | ((UInt32)p[1]); - UInt32 dest; - for (;;) - { - Byte b; - int index; - if (encoding) - dest = (nowPos + (UInt32)bufferPos) + src; - else - dest = src - (nowPos + (UInt32)bufferPos); - if (prevMask == 0) - break; - index = kMaskToBitNumber[prevMask] * 8; - b = (Byte)(dest >> (24 - index)); - if (!Test86MSByte(b)) - break; - src = dest ^ ((1 << (32 - index)) - 1); - } - p[4] = (Byte)(~(((dest >> 24) & 1) - 1)); - p[3] = (Byte)(dest >> 16); - p[2] = (Byte)(dest >> 8); - p[1] = (Byte)dest; - bufferPos += 5; - } - else - { - prevMask = ((prevMask << 1) & 0x7) | 1; - bufferPos++; - } - } - prevPosT = bufferPos - prevPosT; - *prevMaskMix = ((prevPosT > 3) ? 0 : ((prevMask << ((int)prevPosT - 1)) & 0x7)); - return bufferPos; -} diff --git a/dependencies/File_Extractor-0.4.3/7z_C/Compress/Branch/BranchX86.h b/dependencies/File_Extractor-0.4.3/7z_C/Compress/Branch/BranchX86.h deleted file mode 100644 index 5dfd02a7..00000000 --- a/dependencies/File_Extractor-0.4.3/7z_C/Compress/Branch/BranchX86.h +++ /dev/null @@ -1,12 +0,0 @@ -/* BranchX86.h */ - -#ifndef __BRANCHX86_H -#define __BRANCHX86_H - -#include "BranchTypes.h" - -#define x86_Convert_Init(state) { state = 0; } - -SizeT x86_Convert(Byte *buffer, SizeT endPos, UInt32 nowPos, UInt32 *state, int encoding); - -#endif diff --git a/dependencies/File_Extractor-0.4.3/7z_C/Compress/Branch/BranchX86_2.c b/dependencies/File_Extractor-0.4.3/7z_C/Compress/Branch/BranchX86_2.c deleted file mode 100644 index b33ebef0..00000000 --- a/dependencies/File_Extractor-0.4.3/7z_C/Compress/Branch/BranchX86_2.c +++ /dev/null @@ -1,135 +0,0 @@ -/* BranchX86_2.c */ - -#include "BranchX86_2.h" - -#include "../../Alloc.h" - -#ifdef _LZMA_PROB32 -#define CProb UInt32 -#else -#define CProb UInt16 -#endif - -#define IsJcc(b0, b1) ((b0) == 0x0F && ((b1) & 0xF0) == 0x80) -#define IsJ(b0, b1) ((b1 & 0xFE) == 0xE8 || IsJcc(b0, b1)) - -#define kNumTopBits 24 -#define kTopValue ((UInt32)1 << kNumTopBits) - -#define kNumBitModelTotalBits 11 -#define kBitModelTotal (1 << kNumBitModelTotalBits) -#define kNumMoveBits 5 - -#define RC_READ_BYTE (*Buffer++) - -#define RC_INIT2 Code = 0; Range = 0xFFFFFFFF; \ - { int i; for(i = 0; i < 5; i++) { RC_TEST; Code = (Code << 8) | RC_READ_BYTE; }} - -#define RC_TEST { if (Buffer == BufferLim) return BCJ2_RESULT_DATA_ERROR; } - -#define RC_INIT(buffer, bufferSize) Buffer = buffer; BufferLim = buffer + bufferSize; RC_INIT2 - -#define RC_NORMALIZE if (Range < kTopValue) { RC_TEST; Range <<= 8; Code = (Code << 8) | RC_READ_BYTE; } - -#define IfBit0(p) RC_NORMALIZE; bound = (Range >> kNumBitModelTotalBits) * *(p); if (Code < bound) -#define UpdateBit0(p) Range = bound; *(p) += (kBitModelTotal - *(p)) >> kNumMoveBits; -#define UpdateBit1(p) Range -= bound; Code -= bound; *(p) -= (*(p)) >> kNumMoveBits; -/* #define UpdateBit0(p) Range = bound; *(p) = (CProb)(*(p) + ((kBitModelTotal - *(p)) >> kNumMoveBits)); */ -/* #define UpdateBit1(p) Range -= bound; Code -= bound; *(p) = (CProb)(*(p) - (*(p) >> kNumMoveBits)); */ - -int x86_2_Decode( - const Byte *buf0, SizeT size0, - const Byte *buf1, SizeT size1, - const Byte *buf2, SizeT size2, - const Byte *buf3, SizeT size3, - Byte *outBuf, SizeT outSize) -{ - CProb p[256 + 2]; - SizeT inPos = 0, outPos = 0; - - const Byte *Buffer, *BufferLim; - UInt32 Range, Code; - Byte prevByte = 0; - - unsigned int i; - for (i = 0; i < sizeof(p) / sizeof(p[0]); i++) - p[i] = kBitModelTotal >> 1; - RC_INIT(buf3, size3); - - if (outSize == 0) - return BCJ2_RESULT_OK; - - for (;;) - { - Byte b; - CProb *prob; - UInt32 bound; - - SizeT limit = size0 - inPos; - if (outSize - outPos < limit) - limit = outSize - outPos; - while (limit != 0) - { - Byte b = buf0[inPos]; - outBuf[outPos++] = b; - if (IsJ(prevByte, b)) - break; - inPos++; - prevByte = b; - limit--; - } - - if (limit == 0 || outPos == outSize) - break; - - b = buf0[inPos++]; - - if (b == 0xE8) - prob = p + prevByte; - else if (b == 0xE9) - prob = p + 256; - else - prob = p + 257; - - IfBit0(prob) - { - UpdateBit0(prob) - prevByte = b; - } - else - { - UInt32 dest; - const Byte *v; - UpdateBit1(prob) - if (b == 0xE8) - { - v = buf1; - if (size1 < 4) - return BCJ2_RESULT_DATA_ERROR; - buf1 += 4; - size1 -= 4; - } - else - { - v = buf2; - if (size2 < 4) - return BCJ2_RESULT_DATA_ERROR; - buf2 += 4; - size2 -= 4; - } - dest = (((UInt32)v[0] << 24) | ((UInt32)v[1] << 16) | - ((UInt32)v[2] << 8) | ((UInt32)v[3])) - ((UInt32)outPos + 4); - outBuf[outPos++] = (Byte)dest; - if (outPos == outSize) - break; - outBuf[outPos++] = (Byte)(dest >> 8); - if (outPos == outSize) - break; - outBuf[outPos++] = (Byte)(dest >> 16); - if (outPos == outSize) - break; - outBuf[outPos++] = prevByte = (Byte)(dest >> 24); - } - } - return (outPos == outSize) ? BCJ2_RESULT_OK : BCJ2_RESULT_DATA_ERROR; -} diff --git a/dependencies/File_Extractor-0.4.3/7z_C/Compress/Branch/BranchX86_2.h b/dependencies/File_Extractor-0.4.3/7z_C/Compress/Branch/BranchX86_2.h deleted file mode 100644 index ec94d93d..00000000 --- a/dependencies/File_Extractor-0.4.3/7z_C/Compress/Branch/BranchX86_2.h +++ /dev/null @@ -1,28 +0,0 @@ -/* BranchX86_2.h */ - -#ifndef __BRANCHX86_2_H -#define __BRANCHX86_2_H - -#include "BranchTypes.h" - -#define BCJ2_RESULT_OK 0 -#define BCJ2_RESULT_DATA_ERROR 1 - -/* -Conditions: - outSize <= FullOutputSize, - where FullOutputSize is full size of output stream of x86_2 filter. - -If buf0 overlaps outBuf, there are two required conditions: - 1) (buf0 >= outBuf) - 2) (buf0 + size0 >= outBuf + FullOutputSize). -*/ - -int x86_2_Decode( - const Byte *buf0, SizeT size0, - const Byte *buf1, SizeT size1, - const Byte *buf2, SizeT size2, - const Byte *buf3, SizeT size3, - Byte *outBuf, SizeT outSize); - -#endif diff --git a/dependencies/File_Extractor-0.4.3/7z_C/Compress/Lzma/LzmaDecode.c b/dependencies/File_Extractor-0.4.3/7z_C/Compress/Lzma/LzmaDecode.c deleted file mode 100644 index 5b425113..00000000 --- a/dependencies/File_Extractor-0.4.3/7z_C/Compress/Lzma/LzmaDecode.c +++ /dev/null @@ -1,584 +0,0 @@ -/* - LzmaDecode.c - LZMA Decoder (optimized for Speed version) - - LZMA SDK 4.40 Copyright (c) 1999-2006 Igor Pavlov (2006-05-01) - http://www.7-zip.org/ - - LZMA SDK is licensed under two licenses: - 1) GNU Lesser General Public License (GNU LGPL) - 2) Common Public License (CPL) - It means that you can select one of these two licenses and - follow rules of that license. - - SPECIAL EXCEPTION: - Igor Pavlov, as the author of this Code, expressly permits you to - statically or dynamically link your Code (or bind by name) to the - interfaces of this file without subjecting your linked Code to the - terms of the CPL or GNU LGPL. Any modifications or additions - to this file, however, are subject to the LGPL or CPL terms. -*/ - -#include "LzmaDecode.h" - -#define kNumTopBits 24 -#define kTopValue ((UInt32)1 << kNumTopBits) - -#define kNumBitModelTotalBits 11 -#define kBitModelTotal (1 << kNumBitModelTotalBits) -#define kNumMoveBits 5 - -#define RC_READ_BYTE (*Buffer++) - -#define RC_INIT2 Code = 0; Range = 0xFFFFFFFF; \ - { int i; for(i = 0; i < 5; i++) { RC_TEST; Code = (Code << 8) | RC_READ_BYTE; }} - -#ifdef _LZMA_IN_CB - -#define RC_TEST { if (Buffer == BufferLim) \ - { SizeT size; int result = InCallback->Read(InCallback, &Buffer, &size); if (result != LZMA_RESULT_OK) return result; \ - BufferLim = Buffer + size; if (size == 0) return LZMA_RESULT_DATA_ERROR; }} - -#define RC_INIT Buffer = BufferLim = 0; RC_INIT2 - -#else - -#define RC_TEST { if (Buffer == BufferLim) return LZMA_RESULT_DATA_ERROR; } - -#define RC_INIT(buffer, bufferSize) Buffer = buffer; BufferLim = buffer + bufferSize; RC_INIT2 - -#endif - -#define RC_NORMALIZE if (Range < kTopValue) { RC_TEST; Range <<= 8; Code = (Code << 8) | RC_READ_BYTE; } - -#define IfBit0(p) RC_NORMALIZE; bound = (Range >> kNumBitModelTotalBits) * *(p); if (Code < bound) -#define UpdateBit0(p) Range = bound; *(p) += (kBitModelTotal - *(p)) >> kNumMoveBits; -#define UpdateBit1(p) Range -= bound; Code -= bound; *(p) -= (*(p)) >> kNumMoveBits; - -#define RC_GET_BIT2(p, mi, A0, A1) IfBit0(p) \ - { UpdateBit0(p); mi <<= 1; A0; } else \ - { UpdateBit1(p); mi = (mi + mi) + 1; A1; } - -#define RC_GET_BIT(p, mi) RC_GET_BIT2(p, mi, ; , ;) - -#define RangeDecoderBitTreeDecode(probs, numLevels, res) \ - { int i = numLevels; res = 1; \ - do { CProb *p = probs + res; RC_GET_BIT(p, res) } while(--i != 0); \ - res -= (1 << numLevels); } - - -#define kNumPosBitsMax 4 -#define kNumPosStatesMax (1 << kNumPosBitsMax) - -#define kLenNumLowBits 3 -#define kLenNumLowSymbols (1 << kLenNumLowBits) -#define kLenNumMidBits 3 -#define kLenNumMidSymbols (1 << kLenNumMidBits) -#define kLenNumHighBits 8 -#define kLenNumHighSymbols (1 << kLenNumHighBits) - -#define LenChoice 0 -#define LenChoice2 (LenChoice + 1) -#define LenLow (LenChoice2 + 1) -#define LenMid (LenLow + (kNumPosStatesMax << kLenNumLowBits)) -#define LenHigh (LenMid + (kNumPosStatesMax << kLenNumMidBits)) -#define kNumLenProbs (LenHigh + kLenNumHighSymbols) - - -#define kNumStates 12 -#define kNumLitStates 7 - -#define kStartPosModelIndex 4 -#define kEndPosModelIndex 14 -#define kNumFullDistances (1 << (kEndPosModelIndex >> 1)) - -#define kNumPosSlotBits 6 -#define kNumLenToPosStates 4 - -#define kNumAlignBits 4 -#define kAlignTableSize (1 << kNumAlignBits) - -#define kMatchMinLen 2 - -#define IsMatch 0 -#define IsRep (IsMatch + (kNumStates << kNumPosBitsMax)) -#define IsRepG0 (IsRep + kNumStates) -#define IsRepG1 (IsRepG0 + kNumStates) -#define IsRepG2 (IsRepG1 + kNumStates) -#define IsRep0Long (IsRepG2 + kNumStates) -#define PosSlot (IsRep0Long + (kNumStates << kNumPosBitsMax)) -#define SpecPos (PosSlot + (kNumLenToPosStates << kNumPosSlotBits)) -#define Align (SpecPos + kNumFullDistances - kEndPosModelIndex) -#define LenCoder (Align + kAlignTableSize) -#define RepLenCoder (LenCoder + kNumLenProbs) -#define Literal (RepLenCoder + kNumLenProbs) - -#if Literal != LZMA_BASE_SIZE -StopCompilingDueBUG -#endif - -int LzmaDecodeProperties(CLzmaProperties *propsRes, const unsigned char *propsData, int size) -{ - unsigned char prop0; - if (size < LZMA_PROPERTIES_SIZE) - return LZMA_RESULT_DATA_ERROR; - prop0 = propsData[0]; - if (prop0 >= (9 * 5 * 5)) - return LZMA_RESULT_DATA_ERROR; - { - for (propsRes->pb = 0; prop0 >= (9 * 5); propsRes->pb++, prop0 -= (9 * 5)) ; - for (propsRes->lp = 0; prop0 >= 9; propsRes->lp++, prop0 -= 9) ; - propsRes->lc = prop0; - /* - unsigned char remainder = (unsigned char)(prop0 / 9); - propsRes->lc = prop0 % 9; - propsRes->pb = remainder / 5; - propsRes->lp = remainder % 5; - */ - } - - #ifdef _LZMA_OUT_READ - { - int i; - propsRes->DictionarySize = 0; - for (i = 0; i < 4; i++) - propsRes->DictionarySize += (UInt32)(propsData[1 + i]) << (i * 8); - if (propsRes->DictionarySize == 0) - propsRes->DictionarySize = 1; - } - #endif - return LZMA_RESULT_OK; -} - -#define kLzmaStreamWasFinishedId (-1) - -int LzmaDecode(CLzmaDecoderState *vs, - #ifdef _LZMA_IN_CB - ILzmaInCallback *InCallback, - #else - const unsigned char *inStream, SizeT inSize, SizeT *inSizeProcessed, - #endif - unsigned char *outStream, SizeT outSize, SizeT *outSizeProcessed) -{ - CProb *p = vs->Probs; - SizeT nowPos = 0; - Byte previousByte = 0; - UInt32 posStateMask = (1 << (vs->Properties.pb)) - 1; - UInt32 literalPosMask = (1 << (vs->Properties.lp)) - 1; - int lc = vs->Properties.lc; - - #ifdef _LZMA_OUT_READ - - UInt32 Range = vs->Range; - UInt32 Code = vs->Code; - #ifdef _LZMA_IN_CB - const Byte *Buffer = vs->Buffer; - const Byte *BufferLim = vs->BufferLim; - #else - const Byte *Buffer = inStream; - const Byte *BufferLim = inStream + inSize; - #endif - int state = vs->State; - UInt32 rep0 = vs->Reps[0], rep1 = vs->Reps[1], rep2 = vs->Reps[2], rep3 = vs->Reps[3]; - int len = vs->RemainLen; - UInt32 globalPos = vs->GlobalPos; - UInt32 distanceLimit = vs->DistanceLimit; - - Byte *dictionary = vs->Dictionary; - UInt32 dictionarySize = vs->Properties.DictionarySize; - UInt32 dictionaryPos = vs->DictionaryPos; - - Byte tempDictionary[4]; - - #ifndef _LZMA_IN_CB - *inSizeProcessed = 0; - #endif - *outSizeProcessed = 0; - if (len == kLzmaStreamWasFinishedId) - return LZMA_RESULT_OK; - - if (dictionarySize == 0) - { - dictionary = tempDictionary; - dictionarySize = 1; - tempDictionary[0] = vs->TempDictionary[0]; - } - - if (len == kLzmaNeedInitId) - { - { - UInt32 numProbs = Literal + ((UInt32)LZMA_LIT_SIZE << (lc + vs->Properties.lp)); - UInt32 i; - for (i = 0; i < numProbs; i++) - p[i] = kBitModelTotal >> 1; - rep0 = rep1 = rep2 = rep3 = 1; - state = 0; - globalPos = 0; - distanceLimit = 0; - dictionaryPos = 0; - dictionary[dictionarySize - 1] = 0; - #ifdef _LZMA_IN_CB - RC_INIT; - #else - RC_INIT(inStream, inSize); - #endif - } - len = 0; - } - while(len != 0 && nowPos < outSize) - { - UInt32 pos = dictionaryPos - rep0; - if (pos >= dictionarySize) - pos += dictionarySize; - outStream[nowPos++] = dictionary[dictionaryPos] = dictionary[pos]; - if (++dictionaryPos == dictionarySize) - dictionaryPos = 0; - len--; - } - if (dictionaryPos == 0) - previousByte = dictionary[dictionarySize - 1]; - else - previousByte = dictionary[dictionaryPos - 1]; - - #else /* if !_LZMA_OUT_READ */ - - int state = 0; - UInt32 rep0 = 1, rep1 = 1, rep2 = 1, rep3 = 1; - int len = 0; - const Byte *Buffer; - const Byte *BufferLim; - UInt32 Range; - UInt32 Code; - - #ifndef _LZMA_IN_CB - *inSizeProcessed = 0; - #endif - *outSizeProcessed = 0; - - { - UInt32 i; - UInt32 numProbs = Literal + ((UInt32)LZMA_LIT_SIZE << (lc + vs->Properties.lp)); - for (i = 0; i < numProbs; i++) - p[i] = kBitModelTotal >> 1; - } - - #ifdef _LZMA_IN_CB - RC_INIT; - #else - RC_INIT(inStream, inSize); - #endif - - #endif /* _LZMA_OUT_READ */ - - while(nowPos < outSize) - { - CProb *prob; - UInt32 bound; - int posState = (int)( - (nowPos - #ifdef _LZMA_OUT_READ - + globalPos - #endif - ) - & posStateMask); - - prob = p + IsMatch + (state << kNumPosBitsMax) + posState; - IfBit0(prob) - { - int symbol = 1; - UpdateBit0(prob) - prob = p + Literal + (LZMA_LIT_SIZE * - ((( - (nowPos - #ifdef _LZMA_OUT_READ - + globalPos - #endif - ) - & literalPosMask) << lc) + (previousByte >> (8 - lc)))); - - if (state >= kNumLitStates) - { - int matchByte; - #ifdef _LZMA_OUT_READ - UInt32 pos = dictionaryPos - rep0; - if (pos >= dictionarySize) - pos += dictionarySize; - matchByte = dictionary[pos]; - #else - matchByte = outStream[nowPos - rep0]; - #endif - do - { - int bit; - CProb *probLit; - matchByte <<= 1; - bit = (matchByte & 0x100); - probLit = prob + 0x100 + bit + symbol; - RC_GET_BIT2(probLit, symbol, if (bit != 0) break, if (bit == 0) break) - } - while (symbol < 0x100); - } - while (symbol < 0x100) - { - CProb *probLit = prob + symbol; - RC_GET_BIT(probLit, symbol) - } - previousByte = (Byte)symbol; - - outStream[nowPos++] = previousByte; - #ifdef _LZMA_OUT_READ - if (distanceLimit < dictionarySize) - distanceLimit++; - - dictionary[dictionaryPos] = previousByte; - if (++dictionaryPos == dictionarySize) - dictionaryPos = 0; - #endif - if (state < 4) state = 0; - else if (state < 10) state -= 3; - else state -= 6; - } - else - { - UpdateBit1(prob); - prob = p + IsRep + state; - IfBit0(prob) - { - UpdateBit0(prob); - rep3 = rep2; - rep2 = rep1; - rep1 = rep0; - state = state < kNumLitStates ? 0 : 3; - prob = p + LenCoder; - } - else - { - UpdateBit1(prob); - prob = p + IsRepG0 + state; - IfBit0(prob) - { - UpdateBit0(prob); - prob = p + IsRep0Long + (state << kNumPosBitsMax) + posState; - IfBit0(prob) - { - #ifdef _LZMA_OUT_READ - UInt32 pos; - #endif - UpdateBit0(prob); - - #ifdef _LZMA_OUT_READ - if (distanceLimit == 0) - #else - if (nowPos == 0) - #endif - return LZMA_RESULT_DATA_ERROR; - - state = state < kNumLitStates ? 9 : 11; - #ifdef _LZMA_OUT_READ - pos = dictionaryPos - rep0; - if (pos >= dictionarySize) - pos += dictionarySize; - previousByte = dictionary[pos]; - dictionary[dictionaryPos] = previousByte; - if (++dictionaryPos == dictionarySize) - dictionaryPos = 0; - #else - previousByte = outStream[nowPos - rep0]; - #endif - outStream[nowPos++] = previousByte; - #ifdef _LZMA_OUT_READ - if (distanceLimit < dictionarySize) - distanceLimit++; - #endif - - continue; - } - else - { - UpdateBit1(prob); - } - } - else - { - UInt32 distance; - UpdateBit1(prob); - prob = p + IsRepG1 + state; - IfBit0(prob) - { - UpdateBit0(prob); - distance = rep1; - } - else - { - UpdateBit1(prob); - prob = p + IsRepG2 + state; - IfBit0(prob) - { - UpdateBit0(prob); - distance = rep2; - } - else - { - UpdateBit1(prob); - distance = rep3; - rep3 = rep2; - } - rep2 = rep1; - } - rep1 = rep0; - rep0 = distance; - } - state = state < kNumLitStates ? 8 : 11; - prob = p + RepLenCoder; - } - { - int numBits, offset; - CProb *probLen = prob + LenChoice; - IfBit0(probLen) - { - UpdateBit0(probLen); - probLen = prob + LenLow + (posState << kLenNumLowBits); - offset = 0; - numBits = kLenNumLowBits; - } - else - { - UpdateBit1(probLen); - probLen = prob + LenChoice2; - IfBit0(probLen) - { - UpdateBit0(probLen); - probLen = prob + LenMid + (posState << kLenNumMidBits); - offset = kLenNumLowSymbols; - numBits = kLenNumMidBits; - } - else - { - UpdateBit1(probLen); - probLen = prob + LenHigh; - offset = kLenNumLowSymbols + kLenNumMidSymbols; - numBits = kLenNumHighBits; - } - } - RangeDecoderBitTreeDecode(probLen, numBits, len); - len += offset; - } - - if (state < 4) - { - int posSlot; - state += kNumLitStates; - prob = p + PosSlot + - ((len < kNumLenToPosStates ? len : kNumLenToPosStates - 1) << - kNumPosSlotBits); - RangeDecoderBitTreeDecode(prob, kNumPosSlotBits, posSlot); - if (posSlot >= kStartPosModelIndex) - { - int numDirectBits = ((posSlot >> 1) - 1); - rep0 = (2 | ((UInt32)posSlot & 1)); - if (posSlot < kEndPosModelIndex) - { - rep0 <<= numDirectBits; - prob = p + SpecPos + rep0 - posSlot - 1; - } - else - { - numDirectBits -= kNumAlignBits; - do - { - RC_NORMALIZE - Range >>= 1; - rep0 <<= 1; - if (Code >= Range) - { - Code -= Range; - rep0 |= 1; - } - } - while (--numDirectBits != 0); - prob = p + Align; - rep0 <<= kNumAlignBits; - numDirectBits = kNumAlignBits; - } - { - int i = 1; - int mi = 1; - do - { - CProb *prob3 = prob + mi; - RC_GET_BIT2(prob3, mi, ; , rep0 |= i); - i <<= 1; - } - while(--numDirectBits != 0); - } - } - else - rep0 = posSlot; - if (++rep0 == (UInt32)(0)) - { - /* it's for stream version */ - len = kLzmaStreamWasFinishedId; - break; - } - } - - len += kMatchMinLen; - #ifdef _LZMA_OUT_READ - if (rep0 > distanceLimit) - #else - if (rep0 > nowPos) - #endif - return LZMA_RESULT_DATA_ERROR; - - #ifdef _LZMA_OUT_READ - if (dictionarySize - distanceLimit > (UInt32)len) - distanceLimit += len; - else - distanceLimit = dictionarySize; - #endif - - do - { - #ifdef _LZMA_OUT_READ - UInt32 pos = dictionaryPos - rep0; - if (pos >= dictionarySize) - pos += dictionarySize; - previousByte = dictionary[pos]; - dictionary[dictionaryPos] = previousByte; - if (++dictionaryPos == dictionarySize) - dictionaryPos = 0; - #else - previousByte = outStream[nowPos - rep0]; - #endif - len--; - outStream[nowPos++] = previousByte; - } - while(len != 0 && nowPos < outSize); - } - } - RC_NORMALIZE; - - #ifdef _LZMA_OUT_READ - vs->Range = Range; - vs->Code = Code; - vs->DictionaryPos = dictionaryPos; - vs->GlobalPos = globalPos + (UInt32)nowPos; - vs->DistanceLimit = distanceLimit; - vs->Reps[0] = rep0; - vs->Reps[1] = rep1; - vs->Reps[2] = rep2; - vs->Reps[3] = rep3; - vs->State = state; - vs->RemainLen = len; - vs->TempDictionary[0] = tempDictionary[0]; - #endif - - #ifdef _LZMA_IN_CB - vs->Buffer = Buffer; - vs->BufferLim = BufferLim; - #else - *inSizeProcessed = (SizeT)(Buffer - inStream); - #endif - *outSizeProcessed = nowPos; - return LZMA_RESULT_OK; -} diff --git a/dependencies/File_Extractor-0.4.3/7z_C/Compress/Lzma/LzmaDecode.h b/dependencies/File_Extractor-0.4.3/7z_C/Compress/Lzma/LzmaDecode.h deleted file mode 100644 index e3b5f043..00000000 --- a/dependencies/File_Extractor-0.4.3/7z_C/Compress/Lzma/LzmaDecode.h +++ /dev/null @@ -1,113 +0,0 @@ -/* - LzmaDecode.h - LZMA Decoder interface - - LZMA SDK 4.40 Copyright (c) 1999-2006 Igor Pavlov (2006-05-01) - http://www.7-zip.org/ - - LZMA SDK is licensed under two licenses: - 1) GNU Lesser General Public License (GNU LGPL) - 2) Common Public License (CPL) - It means that you can select one of these two licenses and - follow rules of that license. - - SPECIAL EXCEPTION: - Igor Pavlov, as the author of this code, expressly permits you to - statically or dynamically link your code (or bind by name) to the - interfaces of this file without subjecting your linked code to the - terms of the CPL or GNU LGPL. Any modifications or additions - to this file, however, are subject to the LGPL or CPL terms. -*/ - -#ifndef __LZMADECODE_H -#define __LZMADECODE_H - -#include "LzmaTypes.h" - -#define _LZMA_IN_CB -/* Use callback for input data */ - -/* #define _LZMA_OUT_READ */ -/* Use read function for output data */ - -/* #define _LZMA_PROB32 */ -/* It can increase speed on some 32-bit CPUs, - but memory usage will be doubled in that case */ - -/* #define _LZMA_LOC_OPT */ -/* Enable local speed optimizations inside code */ - -#ifdef _LZMA_PROB32 -#define CProb UInt32 -#else -#define CProb UInt16 -#endif - -#define LZMA_RESULT_OK 0 -#define LZMA_RESULT_DATA_ERROR 1 - -#ifdef _LZMA_IN_CB -typedef struct _ILzmaInCallback -{ - int (*Read)(void *object, const unsigned char **buffer, SizeT *bufferSize); -} ILzmaInCallback; -#endif - -#define LZMA_BASE_SIZE 1846 -#define LZMA_LIT_SIZE 768 - -#define LZMA_PROPERTIES_SIZE 5 - -typedef struct _CLzmaProperties -{ - int lc; - int lp; - int pb; - #ifdef _LZMA_OUT_READ - UInt32 DictionarySize; - #endif -}CLzmaProperties; - -int LzmaDecodeProperties(CLzmaProperties *propsRes, const unsigned char *propsData, int size); - -#define LzmaGetNumProbs(Properties) (LZMA_BASE_SIZE + (LZMA_LIT_SIZE << ((Properties)->lc + (Properties)->lp))) - -#define kLzmaNeedInitId (-2) - -typedef struct _CLzmaDecoderState -{ - CLzmaProperties Properties; - CProb *Probs; - - #ifdef _LZMA_IN_CB - const unsigned char *Buffer; - const unsigned char *BufferLim; - #endif - - #ifdef _LZMA_OUT_READ - unsigned char *Dictionary; - UInt32 Range; - UInt32 Code; - UInt32 DictionaryPos; - UInt32 GlobalPos; - UInt32 DistanceLimit; - UInt32 Reps[4]; - int State; - int RemainLen; - unsigned char TempDictionary[4]; - #endif -} CLzmaDecoderState; - -#ifdef _LZMA_OUT_READ -#define LzmaDecoderInit(vs) { (vs)->RemainLen = kLzmaNeedInitId; } -#endif - -int LzmaDecode(CLzmaDecoderState *vs, - #ifdef _LZMA_IN_CB - ILzmaInCallback *inCallback, - #else - const unsigned char *inStream, SizeT inSize, SizeT *inSizeProcessed, - #endif - unsigned char *outStream, SizeT outSize, SizeT *outSizeProcessed); - -#endif diff --git a/dependencies/File_Extractor-0.4.3/7z_C/Compress/Lzma/LzmaTypes.h b/dependencies/File_Extractor-0.4.3/7z_C/Compress/Lzma/LzmaTypes.h deleted file mode 100644 index 9c272907..00000000 --- a/dependencies/File_Extractor-0.4.3/7z_C/Compress/Lzma/LzmaTypes.h +++ /dev/null @@ -1,45 +0,0 @@ -/* -LzmaTypes.h - -Types for LZMA Decoder - -This file written and distributed to public domain by Igor Pavlov. -This file is part of LZMA SDK 4.40 (2006-05-01) -*/ - -#ifndef __LZMATYPES_H -#define __LZMATYPES_H - -#ifndef _7ZIP_BYTE_DEFINED -#define _7ZIP_BYTE_DEFINED -typedef unsigned char Byte; -#endif - -#ifndef _7ZIP_UINT16_DEFINED -#define _7ZIP_UINT16_DEFINED -typedef unsigned short UInt16; -#endif - -#ifndef _7ZIP_UINT32_DEFINED -#define _7ZIP_UINT32_DEFINED -#ifdef _LZMA_UINT32_IS_ULONG -typedef unsigned long UInt32; -#else -typedef unsigned int UInt32; -#endif -#endif - -/* #define _LZMA_NO_SYSTEM_SIZE_T */ -/* You can use it, if you don't want */ - -#ifndef _7ZIP_SIZET_DEFINED -#define _7ZIP_SIZET_DEFINED -#ifdef _LZMA_NO_SYSTEM_SIZE_T -typedef UInt32 SizeT; -#else -#include -typedef size_t SizeT; -#endif -#endif - -#endif diff --git a/dependencies/File_Extractor-0.4.3/7z_C/Types.h b/dependencies/File_Extractor-0.4.3/7z_C/Types.h deleted file mode 100644 index 368cc314..00000000 --- a/dependencies/File_Extractor-0.4.3/7z_C/Types.h +++ /dev/null @@ -1,100 +0,0 @@ -/* 7zTypes.h */ - -#ifndef __C_TYPES_H -#define __C_TYPES_H - -#ifndef _7ZIP_BYTE_DEFINED -#define _7ZIP_BYTE_DEFINED -typedef unsigned char Byte; -#endif - -#ifndef _7ZIP_UINT16_DEFINED -#define _7ZIP_UINT16_DEFINED -typedef unsigned short UInt16; -#endif - -#ifndef _7ZIP_UINT32_DEFINED -#define _7ZIP_UINT32_DEFINED -#ifdef _LZMA_UINT32_IS_ULONG -typedef unsigned long UInt32; -#else -typedef unsigned int UInt32; -#endif -#endif - -#ifndef _7ZIP_INT32_DEFINED -#define _7ZIP_INT32_DEFINED -#ifdef _LZMA_INT32_IS_ULONG -typedef long Int32; -#else -typedef int Int32; -#endif -#endif - -/* #define _SZ_NO_INT_64 */ -/* define it your compiler doesn't support long long int */ - -#ifndef _7ZIP_UINT64_DEFINED -#define _7ZIP_UINT64_DEFINED -#ifdef _SZ_NO_INT_64 -typedef unsigned long UInt64; -#else -#if defined(_MSC_VER) || defined(__BORLANDC__) -typedef unsigned __int64 UInt64; -#else -typedef unsigned long long int UInt64; -#endif -#endif -#endif - - -/* #define _SZ_FILE_SIZE_32 */ -/* You can define _SZ_FILE_SIZE_32, if you don't need support for files larger than 4 GB*/ - -#ifndef CFileSize -#ifdef _SZ_FILE_SIZE_32 -typedef UInt32 CFileSize; -#else -typedef UInt64 CFileSize; -#endif -#endif - -#define SZ_RESULT int - -typedef int HRes; -#define RES_OK (0) - -#define SZ_OK (0) -#define SZE_DATA_ERROR (1) -#define SZE_CRC_ERROR (3) -#define SZE_ARCHIVE_ERROR (6) - -#define SZE_OUTOFMEMORY (0x8007000EL) -#define SZE_NOTIMPL (0x80004001L) -#define SZE_FAIL (0x80004005L) -#define SZE_INVALIDARG (0x80070057L) - - -#ifndef RINOK -#define RINOK(x) { HRes __result_ = (x); if(__result_ != 0) return __result_; } -#endif - -typedef int Bool; -#define True 1 -#define False 0 - -#ifdef _MSC_VER -#define StdCall __stdcall -#else -#define StdCall -#endif - -#if _MSC_VER >= 1300 -#define MY_FAST_CALL __declspec(noinline) __fastcall -#elif defined( _MSC_VER) -#define MY_FAST_CALL __fastcall -#else -#define MY_FAST_CALL -#endif - -#endif diff --git a/dependencies/File_Extractor-0.4.3/7z_C/changes.txt b/dependencies/File_Extractor-0.4.3/7z_C/changes.txt deleted file mode 100644 index 3e5ecebf..00000000 --- a/dependencies/File_Extractor-0.4.3/7z_C/changes.txt +++ /dev/null @@ -1,19 +0,0 @@ -Changes to 7z_C source ----------------------- -I made several minor changes: - -* Enabled _LZMA_IN_CB in LzmaDecoer.h and fixed other files that depend -on this setting to properly #include this file - -* Fixed several memory free functions to not access NULL when cleaning -up after a failed allocation. - -* Made private functions static. - -* Fixed SzArchiveOpen to properly report error when header can't be -read. - -* Fixed glaring conflicts between LzmaTypes.h and 7zTypes.h. - --- -Shay Green diff --git a/dependencies/File_Extractor-0.4.3/7z_C/lzma.txt b/dependencies/File_Extractor-0.4.3/7z_C/lzma.txt deleted file mode 100644 index 74935bf4..00000000 --- a/dependencies/File_Extractor-0.4.3/7z_C/lzma.txt +++ /dev/null @@ -1,663 +0,0 @@ -LZMA SDK 4.57 -------------- - -LZMA SDK Copyright (C) 1999-2007 Igor Pavlov - -LZMA SDK provides the documentation, samples, header files, libraries, -and tools you need to develop applications that use LZMA compression. - -LZMA is default and general compression method of 7z format -in 7-Zip compression program (www.7-zip.org). LZMA provides high -compression ratio and very fast decompression. - -LZMA is an improved version of famous LZ77 compression algorithm. -It was improved in way of maximum increasing of compression ratio, -keeping high decompression speed and low memory requirements for -decompressing. - - - -LICENSE -------- - -LZMA SDK is available under any of the following licenses: - -1) GNU Lesser General Public License (GNU LGPL) -2) Common Public License (CPL) -3) Simplified license for unmodified code (read SPECIAL EXCEPTION) -4) Proprietary license - -It means that you can select one of these four options and follow rules of that license. - - -1,2) GNU LGPL and CPL licenses are pretty similar and both these -licenses are classified as - - "Free software licenses" at http://www.gnu.org/ - - "OSI-approved" at http://www.opensource.org/ - - -3) SPECIAL EXCEPTION - -Igor Pavlov, as the author of this code, expressly permits you -to statically or dynamically link your code (or bind by name) -to the files from LZMA SDK without subjecting your linked -code to the terms of the CPL or GNU LGPL. -Any modifications or additions to files from LZMA SDK, however, -are subject to the GNU LGPL or CPL terms. - -SPECIAL EXCEPTION allows you to use LZMA SDK in applications with closed code, -while you keep LZMA SDK code unmodified. - - -SPECIAL EXCEPTION #2: Igor Pavlov, as the author of this code, expressly permits -you to use this code under the same terms and conditions contained in the License -Agreement you have for any previous version of LZMA SDK developed by Igor Pavlov. - -SPECIAL EXCEPTION #2 allows owners of proprietary licenses to use latest version -of LZMA SDK as update for previous versions. - - -SPECIAL EXCEPTION #3: Igor Pavlov, as the author of this code, expressly permits -you to use code of the following files: -BranchTypes.h, LzmaTypes.h, LzmaTest.c, LzmaStateTest.c, LzmaAlone.cpp, -LzmaAlone.cs, LzmaAlone.java -as public domain code. - - -4) Proprietary license - -LZMA SDK also can be available under a proprietary license which -can include: - -1) Right to modify code without subjecting modified code to the -terms of the CPL or GNU LGPL -2) Technical support for code - -To request such proprietary license or any additional consultations, -send email message from that page: -http://www.7-zip.org/support.html - - -You should have received a copy of the GNU Lesser General Public -License along with this library; if not, write to the Free Software -Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA - -You should have received a copy of the Common Public License -along with this library. - - -LZMA SDK Contents ------------------ - -LZMA SDK includes: - - - C++ source code of LZMA compressing and decompressing - - ANSI-C compatible source code for LZMA decompressing - - C# source code for LZMA compressing and decompressing - - Java source code for LZMA compressing and decompressing - - Compiled file->file LZMA compressing/decompressing program for Windows system - -ANSI-C LZMA decompression code was ported from original C++ sources to C. -Also it was simplified and optimized for code size. -But it is fully compatible with LZMA from 7-Zip. - - -UNIX/Linux version ------------------- -To compile C++ version of file->file LZMA, go to directory -C/7zip/Compress/LZMA_Alone -and type "make" or "make clean all" to recompile all. - -In some UNIX/Linux versions you must compile LZMA with static libraries. -To compile with static libraries, change string in makefile -LIB = -lm -to string -LIB = -lm -static - - -Files ---------------------- -C - C source code -CPP - CPP source code -CS - C# source code -Java - Java source code -lzma.txt - LZMA SDK description (this file) -7zFormat.txt - 7z Format description -7zC.txt - 7z ANSI-C Decoder description (this file) -methods.txt - Compression method IDs for .7z -LGPL.txt - GNU Lesser General Public License -CPL.html - Common Public License -lzma.exe - Compiled file->file LZMA encoder/decoder for Windows -history.txt - history of the LZMA SDK - - -Source code structure ---------------------- - -C - C files - Compress - files related to compression/decompression - Lz - files related to LZ (Lempel-Ziv) compression algorithm - Lzma - ANSI-C compatible LZMA decompressor - - LzmaDecode.h - interface for LZMA decoding on ANSI-C - LzmaDecode.c - LZMA decoding on ANSI-C (new fastest version) - LzmaDecodeSize.c - LZMA decoding on ANSI-C (old size-optimized version) - LzmaTest.c - test application that decodes LZMA encoded file - LzmaTypes.h - basic types for LZMA Decoder - LzmaStateDecode.h - interface for LZMA decoding (State version) - LzmaStateDecode.c - LZMA decoding on ANSI-C (State version) - LzmaStateTest.c - test application (State version) - - Branch - Filters for x86, IA-64, ARM, ARM-Thumb, PowerPC and SPARC code - - Archive - files related to archiving - 7z_C - 7z ANSI-C Decoder - - -CPP -- CPP files - - Common - common files for C++ projects - Windows - common files for Windows related code - 7zip - files related to 7-Zip Project - - Common - common files for 7-Zip - - Compress - files related to compression/decompression - - LZ - files related to LZ (Lempel-Ziv) compression algorithm - - Copy - Copy coder - RangeCoder - Range Coder (special code of compression/decompression) - LZMA - LZMA compression/decompression on C++ - LZMA_Alone - file->file LZMA compression/decompression - - Branch - Filters for x86, IA-64, ARM, ARM-Thumb, PowerPC and SPARC code - - Archive - files related to archiving - - Common - common files for archive handling - 7z - 7z C++ Encoder/Decoder - - Bundles - Modules that are bundles of other modules - - Alone7z - 7zr.exe: Standalone version of 7z.exe that supports only 7z/LZMA/BCJ/BCJ2 - Format7zR - 7zr.dll: Reduced version of 7za.dll: extracting/compressing to 7z/LZMA/BCJ/BCJ2 - Format7zExtractR - 7zxr.dll: Reduced version of 7zxa.dll: extracting from 7z/LZMA/BCJ/BCJ2. - - UI - User Interface files - - Client7z - Test application for 7za.dll, 7zr.dll, 7zxr.dll - Common - Common UI files - Console - Code for console archiver - - - -CS - C# files - 7zip - Common - some common files for 7-Zip - Compress - files related to compression/decompression - LZ - files related to LZ (Lempel-Ziv) compression algorithm - LZMA - LZMA compression/decompression - LzmaAlone - file->file LZMA compression/decompression - RangeCoder - Range Coder (special code of compression/decompression) - -Java - Java files - SevenZip - Compression - files related to compression/decompression - LZ - files related to LZ (Lempel-Ziv) compression algorithm - LZMA - LZMA compression/decompression - RangeCoder - Range Coder (special code of compression/decompression) - -C/C++ source code of LZMA SDK is part of 7-Zip project. - -You can find ANSI-C LZMA decompressing code at folder - C/7zip/Compress/Lzma -7-Zip doesn't use that ANSI-C LZMA code and that code was developed -specially for this SDK. And files from C/7zip/Compress/Lzma do not need -files from other directories of SDK for compiling. - -7-Zip source code can be downloaded from 7-Zip's SourceForge page: - - http://sourceforge.net/projects/sevenzip/ - - -LZMA features -------------- - - Variable dictionary size (up to 1 GB) - - Estimated compressing speed: about 1 MB/s on 1 GHz CPU - - Estimated decompressing speed: - - 8-12 MB/s on 1 GHz Intel Pentium 3 or AMD Athlon - - 500-1000 KB/s on 100 MHz ARM, MIPS, PowerPC or other simple RISC - - Small memory requirements for decompressing (8-32 KB + DictionarySize) - - Small code size for decompressing: 2-8 KB (depending from - speed optimizations) - -LZMA decoder uses only integer operations and can be -implemented in any modern 32-bit CPU (or on 16-bit CPU with some conditions). - -Some critical operations that affect to speed of LZMA decompression: - 1) 32*16 bit integer multiply - 2) Misspredicted branches (penalty mostly depends from pipeline length) - 3) 32-bit shift and arithmetic operations - -Speed of LZMA decompressing mostly depends from CPU speed. -Memory speed has no big meaning. But if your CPU has small data cache, -overall weight of memory speed will slightly increase. - - -How To Use ----------- - -Using LZMA encoder/decoder executable --------------------------------------- - -Usage: LZMA inputFile outputFile [...] - - e: encode file - - d: decode file - - b: Benchmark. There are two tests: compressing and decompressing - with LZMA method. Benchmark shows rating in MIPS (million - instructions per second). Rating value is calculated from - measured speed and it is normalized with AMD Athlon 64 X2 CPU - results. Also Benchmark checks possible hardware errors (RAM - errors in most cases). Benchmark uses these settings: - (-a1, -d21, -fb32, -mfbt4). You can change only -d. Also you - can change number of iterations. Example for 30 iterations: - LZMA b 30 - Default number of iterations is 10. - - - - - -a{N}: set compression mode 0 = fast, 1 = normal - default: 1 (normal) - - d{N}: Sets Dictionary size - [0, 30], default: 23 (8MB) - The maximum value for dictionary size is 1 GB = 2^30 bytes. - Dictionary size is calculated as DictionarySize = 2^N bytes. - For decompressing file compressed by LZMA method with dictionary - size D = 2^N you need about D bytes of memory (RAM). - - -fb{N}: set number of fast bytes - [5, 273], default: 128 - Usually big number gives a little bit better compression ratio - and slower compression process. - - -lc{N}: set number of literal context bits - [0, 8], default: 3 - Sometimes lc=4 gives gain for big files. - - -lp{N}: set number of literal pos bits - [0, 4], default: 0 - lp switch is intended for periodical data when period is - equal 2^N. For example, for 32-bit (4 bytes) - periodical data you can use lp=2. Often it's better to set lc0, - if you change lp switch. - - -pb{N}: set number of pos bits - [0, 4], default: 2 - pb switch is intended for periodical data - when period is equal 2^N. - - -mf{MF_ID}: set Match Finder. Default: bt4. - Algorithms from hc* group doesn't provide good compression - ratio, but they often works pretty fast in combination with - fast mode (-a0). - - Memory requirements depend from dictionary size - (parameter "d" in table below). - - MF_ID Memory Description - - bt2 d * 9.5 + 4MB Binary Tree with 2 bytes hashing. - bt3 d * 11.5 + 4MB Binary Tree with 3 bytes hashing. - bt4 d * 11.5 + 4MB Binary Tree with 4 bytes hashing. - hc4 d * 7.5 + 4MB Hash Chain with 4 bytes hashing. - - -eos: write End Of Stream marker. By default LZMA doesn't write - eos marker, since LZMA decoder knows uncompressed size - stored in .lzma file header. - - -si: Read data from stdin (it will write End Of Stream marker). - -so: Write data to stdout - - -Examples: - -1) LZMA e file.bin file.lzma -d16 -lc0 - -compresses file.bin to file.lzma with 64 KB dictionary (2^16=64K) -and 0 literal context bits. -lc0 allows to reduce memory requirements -for decompression. - - -2) LZMA e file.bin file.lzma -lc0 -lp2 - -compresses file.bin to file.lzma with settings suitable -for 32-bit periodical data (for example, ARM or MIPS code). - -3) LZMA d file.lzma file.bin - -decompresses file.lzma to file.bin. - - -Compression ratio hints ------------------------ - -Recommendations ---------------- - -To increase compression ratio for LZMA compressing it's desirable -to have aligned data (if it's possible) and also it's desirable to locate -data in such order, where code is grouped in one place and data is -grouped in other place (it's better than such mixing: code, data, code, -data, ...). - - -Using Filters -------------- -You can increase compression ratio for some data types, using -special filters before compressing. For example, it's possible to -increase compression ratio on 5-10% for code for those CPU ISAs: -x86, IA-64, ARM, ARM-Thumb, PowerPC, SPARC. - -You can find C/C++ source code of such filters in folder "7zip/Compress/Branch" - -You can check compression ratio gain of these filters with such -7-Zip commands (example for ARM code): -No filter: - 7z a a1.7z a.bin -m0=lzma - -With filter for little-endian ARM code: - 7z a a2.7z a.bin -m0=bc_arm -m1=lzma - -With filter for big-endian ARM code (using additional Swap4 filter): - 7z a a3.7z a.bin -m0=swap4 -m1=bc_arm -m2=lzma - -It works in such manner: -Compressing = Filter_encoding + LZMA_encoding -Decompressing = LZMA_decoding + Filter_decoding - -Compressing and decompressing speed of such filters is very high, -so it will not increase decompressing time too much. -Moreover, it reduces decompression time for LZMA_decoding, -since compression ratio with filtering is higher. - -These filters convert CALL (calling procedure) instructions -from relative offsets to absolute addresses, so such data becomes more -compressible. Source code of these CALL filters is pretty simple -(about 20 lines of C++), so you can convert it from C++ version yourself. - -For some ISAs (for example, for MIPS) it's impossible to get gain from such filter. - - -LZMA compressed file format ---------------------------- -Offset Size Description - 0 1 Special LZMA properties for compressed data - 1 4 Dictionary size (little endian) - 5 8 Uncompressed size (little endian). -1 means unknown size - 13 Compressed data - - -ANSI-C LZMA Decoder -~~~~~~~~~~~~~~~~~~~ - -To compile ANSI-C LZMA Decoder you can use one of the following files sets: -1) LzmaDecode.h + LzmaDecode.c + LzmaTest.c (fastest version) -2) LzmaDecode.h + LzmaDecodeSize.c + LzmaTest.c (old size-optimized version) -3) LzmaStateDecode.h + LzmaStateDecode.c + LzmaStateTest.c (zlib-like interface) - - -Memory requirements for LZMA decoding -------------------------------------- - -LZMA decoder doesn't allocate memory itself, so you must -allocate memory and send it to LZMA. - -Stack usage of LZMA decoding function for local variables is not -larger than 200 bytes. - -How To decompress data ----------------------- - -LZMA Decoder (ANSI-C version) now supports 5 interfaces: -1) Single-call Decompressing -2) Single-call Decompressing with input stream callback -3) Multi-call Decompressing with output buffer -4) Multi-call Decompressing with input callback and output buffer -5) Multi-call State Decompressing (zlib-like interface) - -Variant-5 is similar to Variant-4, but Variant-5 doesn't use callback functions. - -Decompressing steps -------------------- - -1) read LZMA properties (5 bytes): - unsigned char properties[LZMA_PROPERTIES_SIZE]; - -2) read uncompressed size (8 bytes, little-endian) - -3) Decode properties: - - CLzmaDecoderState state; /* it's 24-140 bytes structure, if int is 32-bit */ - - if (LzmaDecodeProperties(&state.Properties, properties, LZMA_PROPERTIES_SIZE) != LZMA_RESULT_OK) - return PrintError(rs, "Incorrect stream properties"); - -4) Allocate memory block for internal Structures: - - state.Probs = (CProb *)malloc(LzmaGetNumProbs(&state.Properties) * sizeof(CProb)); - if (state.Probs == 0) - return PrintError(rs, kCantAllocateMessage); - - LZMA decoder uses array of CProb variables as internal structure. - By default, CProb is unsigned_short. But you can define _LZMA_PROB32 to make - it unsigned_int. It can increase speed on some 32-bit CPUs, but memory - usage will be doubled in that case. - - -5) Main Decompressing - -You must use one of the following interfaces: - -5.1 Single-call Decompressing ------------------------------ -When to use: RAM->RAM decompressing -Compile files: LzmaDecode.h, LzmaDecode.c -Compile defines: no defines -Memory Requirements: - - Input buffer: compressed size - - Output buffer: uncompressed size - - LZMA Internal Structures (~16 KB for default settings) - -Interface: - int res = LzmaDecode(&state, - inStream, compressedSize, &inProcessed, - outStream, outSize, &outProcessed); - - -5.2 Single-call Decompressing with input stream callback --------------------------------------------------------- -When to use: File->RAM or Flash->RAM decompressing. -Compile files: LzmaDecode.h, LzmaDecode.c -Compile defines: _LZMA_IN_CB -Memory Requirements: - - Buffer for input stream: any size (for example, 16 KB) - - Output buffer: uncompressed size - - LZMA Internal Structures (~16 KB for default settings) - -Interface: - typedef struct _CBuffer - { - ILzmaInCallback InCallback; - FILE *File; - unsigned char Buffer[kInBufferSize]; - } CBuffer; - - int LzmaReadCompressed(void *object, const unsigned char **buffer, SizeT *size) - { - CBuffer *bo = (CBuffer *)object; - *buffer = bo->Buffer; - *size = MyReadFile(bo->File, bo->Buffer, kInBufferSize); - return LZMA_RESULT_OK; - } - - CBuffer g_InBuffer; - - g_InBuffer.File = inFile; - g_InBuffer.InCallback.Read = LzmaReadCompressed; - int res = LzmaDecode(&state, - &g_InBuffer.InCallback, - outStream, outSize, &outProcessed); - - -5.3 Multi-call decompressing with output buffer ------------------------------------------------ -When to use: RAM->File decompressing -Compile files: LzmaDecode.h, LzmaDecode.c -Compile defines: _LZMA_OUT_READ -Memory Requirements: - - Input buffer: compressed size - - Buffer for output stream: any size (for example, 16 KB) - - LZMA Internal Structures (~16 KB for default settings) - - LZMA dictionary (dictionary size is encoded in stream properties) - -Interface: - - state.Dictionary = (unsigned char *)malloc(state.Properties.DictionarySize); - - LzmaDecoderInit(&state); - do - { - LzmaDecode(&state, - inBuffer, inAvail, &inProcessed, - g_OutBuffer, outAvail, &outProcessed); - inAvail -= inProcessed; - inBuffer += inProcessed; - } - while you need more bytes - - see LzmaTest.c for more details. - - -5.4 Multi-call decompressing with input callback and output buffer ------------------------------------------------------------------- -When to use: File->File decompressing -Compile files: LzmaDecode.h, LzmaDecode.c -Compile defines: _LZMA_IN_CB, _LZMA_OUT_READ -Memory Requirements: - - Buffer for input stream: any size (for example, 16 KB) - - Buffer for output stream: any size (for example, 16 KB) - - LZMA Internal Structures (~16 KB for default settings) - - LZMA dictionary (dictionary size is encoded in stream properties) - -Interface: - - state.Dictionary = (unsigned char *)malloc(state.Properties.DictionarySize); - - LzmaDecoderInit(&state); - do - { - LzmaDecode(&state, - &bo.InCallback, - g_OutBuffer, outAvail, &outProcessed); - } - while you need more bytes - - see LzmaTest.c for more details: - - -5.5 Multi-call State Decompressing (zlib-like interface) ------------------------------------------------------------------- -When to use: file->file decompressing -Compile files: LzmaStateDecode.h, LzmaStateDecode.c -Compile defines: -Memory Requirements: - - Buffer for input stream: any size (for example, 16 KB) - - Buffer for output stream: any size (for example, 16 KB) - - LZMA Internal Structures (~16 KB for default settings) - - LZMA dictionary (dictionary size is encoded in stream properties) - -Interface: - - state.Dictionary = (unsigned char *)malloc(state.Properties.DictionarySize); - - - LzmaDecoderInit(&state); - do - { - res = LzmaDecode(&state, - inBuffer, inAvail, &inProcessed, - g_OutBuffer, outAvail, &outProcessed, - finishDecoding); - inAvail -= inProcessed; - inBuffer += inProcessed; - } - while you need more bytes - - see LzmaStateTest.c for more details: - - -6) Free all allocated blocks - - -Note ----- -LzmaDecodeSize.c is size-optimized version of LzmaDecode.c. -But compiled code of LzmaDecodeSize.c can be larger than -compiled code of LzmaDecode.c. So it's better to use -LzmaDecode.c in most cases. - - -EXIT codes ------------ - -LZMA decoder can return one of the following codes: - -#define LZMA_RESULT_OK 0 -#define LZMA_RESULT_DATA_ERROR 1 - -If you use callback function for input data and you return some -error code, LZMA Decoder also returns that code. - - - -LZMA Defines ------------- - -_LZMA_IN_CB - Use callback for input data - -_LZMA_OUT_READ - Use read function for output data - -_LZMA_LOC_OPT - Enable local speed optimizations inside code. - _LZMA_LOC_OPT is only for LzmaDecodeSize.c (size-optimized version). - _LZMA_LOC_OPT doesn't affect LzmaDecode.c (speed-optimized version) - and LzmaStateDecode.c - -_LZMA_PROB32 - It can increase speed on some 32-bit CPUs, - but memory usage will be doubled in that case - -_LZMA_UINT32_IS_ULONG - Define it if int is 16-bit on your compiler - and long is 32-bit. - -_LZMA_SYSTEM_SIZE_T - Define it if you want to use system's size_t. - You can use it to enable 64-bit sizes supporting - - - -C++ LZMA Encoder/Decoder -~~~~~~~~~~~~~~~~~~~~~~~~ -C++ LZMA code use COM-like interfaces. So if you want to use it, -you can study basics of COM/OLE. - -By default, LZMA Encoder contains all Match Finders. -But for compressing it's enough to have just one of them. -So for reducing size of compressing code you can define: - #define COMPRESS_MF_BT - #define COMPRESS_MF_BT4 -and it will use only bt4 match finder. - - ---- - -http://www.7-zip.org -http://www.7-zip.org/support.html diff --git a/dependencies/File_Extractor-0.4.3/File_Extractor.sln b/dependencies/File_Extractor-0.4.3/File_Extractor.sln deleted file mode 100644 index b1db8384..00000000 --- a/dependencies/File_Extractor-0.4.3/File_Extractor.sln +++ /dev/null @@ -1,26 +0,0 @@ - -Microsoft Visual Studio Solution File, Format Version 9.00 -# Visual Studio 2005 -Project("{8BC9CEB8-8B4A-11D0-8D11-00A0C91BC942}") = "File_Extractor", "File_Extractor.vcproj", "{7AEC599C-7C82-4F00-AA60-411E0A359CB0}" -EndProject -Global - GlobalSection(SolutionConfigurationPlatforms) = preSolution - Debug|Win32 = Debug|Win32 - Debug|x64 = Debug|x64 - Release|Win32 = Release|Win32 - Release|x64 = Release|x64 - EndGlobalSection - GlobalSection(ProjectConfigurationPlatforms) = postSolution - {7AEC599C-7C82-4F00-AA60-411E0A359CB0}.Debug|Win32.ActiveCfg = Debug|Win32 - {7AEC599C-7C82-4F00-AA60-411E0A359CB0}.Debug|Win32.Build.0 = Debug|Win32 - {7AEC599C-7C82-4F00-AA60-411E0A359CB0}.Debug|x64.ActiveCfg = Debug|x64 - {7AEC599C-7C82-4F00-AA60-411E0A359CB0}.Debug|x64.Build.0 = Debug|x64 - {7AEC599C-7C82-4F00-AA60-411E0A359CB0}.Release|Win32.ActiveCfg = Release|Win32 - {7AEC599C-7C82-4F00-AA60-411E0A359CB0}.Release|Win32.Build.0 = Release|Win32 - {7AEC599C-7C82-4F00-AA60-411E0A359CB0}.Release|x64.ActiveCfg = Release|x64 - {7AEC599C-7C82-4F00-AA60-411E0A359CB0}.Release|x64.Build.0 = Release|x64 - EndGlobalSection - GlobalSection(SolutionProperties) = preSolution - HideSolutionNode = FALSE - EndGlobalSection -EndGlobal diff --git a/dependencies/File_Extractor-0.4.3/File_Extractor.vcproj b/dependencies/File_Extractor-0.4.3/File_Extractor.vcproj deleted file mode 100644 index 5c81ac60..00000000 --- a/dependencies/File_Extractor-0.4.3/File_Extractor.vcproj +++ /dev/null @@ -1,537 +0,0 @@ - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - diff --git a/dependencies/File_Extractor-0.4.3/File_Extractor2008.vcproj b/dependencies/File_Extractor-0.4.3/File_Extractor2008.vcproj deleted file mode 100644 index 82f7e131..00000000 --- a/dependencies/File_Extractor-0.4.3/File_Extractor2008.vcproj +++ /dev/null @@ -1,387 +0,0 @@ - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - diff --git a/dependencies/File_Extractor-0.4.3/File_Extractor2008.vcproj.GOLIATH.Shawn.user b/dependencies/File_Extractor-0.4.3/File_Extractor2008.vcproj.GOLIATH.Shawn.user deleted file mode 100644 index 3737b836..00000000 --- a/dependencies/File_Extractor-0.4.3/File_Extractor2008.vcproj.GOLIATH.Shawn.user +++ /dev/null @@ -1,65 +0,0 @@ - - - - - - - - - - - diff --git a/dependencies/File_Extractor-0.4.3/File_Extractor2010.sln b/dependencies/File_Extractor-0.4.3/File_Extractor2010.sln deleted file mode 100644 index 68da2eaf..00000000 --- a/dependencies/File_Extractor-0.4.3/File_Extractor2010.sln +++ /dev/null @@ -1,20 +0,0 @@ - -Microsoft Visual Studio Solution File, Format Version 11.00 -# Visual Studio 2010 -Project("{8BC9CEB8-8B4A-11D0-8D11-00A0C91BC942}") = "File_Extractor", "File_Extractor2010.vcxproj", "{7AEC599C-7C82-4F00-AA60-411E0A359CB0}" -EndProject -Global - GlobalSection(SolutionConfigurationPlatforms) = preSolution - Debug|Win32 = Debug|Win32 - Release|Win32 = Release|Win32 - EndGlobalSection - GlobalSection(ProjectConfigurationPlatforms) = postSolution - {7AEC599C-7C82-4F00-AA60-411E0A359CB0}.Debug|Win32.ActiveCfg = Debug|Win32 - {7AEC599C-7C82-4F00-AA60-411E0A359CB0}.Debug|Win32.Build.0 = Debug|Win32 - {7AEC599C-7C82-4F00-AA60-411E0A359CB0}.Release|Win32.ActiveCfg = Release|Win32 - {7AEC599C-7C82-4F00-AA60-411E0A359CB0}.Release|Win32.Build.0 = Release|Win32 - EndGlobalSection - GlobalSection(SolutionProperties) = preSolution - HideSolutionNode = FALSE - EndGlobalSection -EndGlobal diff --git a/dependencies/File_Extractor-0.4.3/File_Extractor2010.suo b/dependencies/File_Extractor-0.4.3/File_Extractor2010.suo deleted file mode 100644 index c6520832..00000000 Binary files a/dependencies/File_Extractor-0.4.3/File_Extractor2010.suo and /dev/null differ diff --git a/dependencies/File_Extractor-0.4.3/File_Extractor2010.vcxproj b/dependencies/File_Extractor-0.4.3/File_Extractor2010.vcxproj deleted file mode 100644 index 209e50c4..00000000 --- a/dependencies/File_Extractor-0.4.3/File_Extractor2010.vcxproj +++ /dev/null @@ -1,147 +0,0 @@ - - - - - Debug - Win32 - - - Release - Win32 - - - - File_Extractor - {7AEC599C-7C82-4F00-AA60-411E0A359CB0} - File_Extractor - - - - StaticLibrary - NotSet - true - $(IntDir)$(ProjectName)_BuildLog.htm - - - StaticLibrary - NotSet - $(IntDir)$(ProjectName)_BuildLog.htm - - - - - - - - - - - - - <_ProjectFileVersion>10.0.21006.1 - $(ProjectDir)$(Platform)\$(Configuration)\ - $(ProjectDir)$(Platform)\$(Configuration)_temp\ - $(ProjectDir)$(Platform)\$(Configuration)\ - $(ProjectDir)$(Platform)\$(Configuration)_temp\ - AllRules.ruleset - - - AllRules.ruleset - - - $(VCInstallDir)bin;$(WindowsSdkDir)bin\NETFX 4.0 Tools;$(WindowsSdkDir)bin;$(VSInstallDir)Common7\Tools\bin;$(VSInstallDir)Common7\tools;$(VSInstallDir)Common7\ide;$(ProgramFiles)\HTML Help Workshop;$(FrameworkSDKDir)\bin;$(MSBuildToolsPath32);$(VSInstallDir);$(SystemRoot)\SysWow64;$(FxCopDir);$(PATH);d:\Projects\Dev-Cpp\bin\; - $(VCInstallDir)bin;$(WindowsSdkDir)bin\NETFX 4.0 Tools;$(WindowsSdkDir)bin;$(VSInstallDir)Common7\Tools\bin;$(VSInstallDir)Common7\tools;$(VSInstallDir)Common7\ide;$(ProgramFiles)\HTML Help Workshop;$(FrameworkSDKDir)\bin;$(MSBuildToolsPath32);$(VSInstallDir);$(SystemRoot)\SysWow64;$(FxCopDir);$(PATH);d:\Projects\Dev-Cpp\bin\; - $(VCInstallDir)include;$(VCInstallDir)atlmfc\include;$(WindowsSdkDir)include;$(FrameworkSDKDir)\include;d:\Projects\dependencies\zlib\;c:\Program Files (x86)\Microsoft DirectX SDK (August 2009)\Include\;d:\Projects\dependencies\libpng\;c:\Program Files (x86)\OpenAL 1.1 SDK\include\; - $(VCInstallDir)include;$(VCInstallDir)atlmfc\include;$(WindowsSdkDir)include;$(FrameworkSDKDir)\include;d:\Projects\dependencies\zlib\;c:\Program Files (x86)\Microsoft DirectX SDK (August 2009)\Include\;d:\Projects\dependencies\libpng\;c:\Program Files (x86)\OpenAL 1.1 SDK\include\; - $(VCInstallDir)lib;$(VCInstallDir)atlmfc\lib;$(WindowsSdkDir)lib;$(FrameworkSDKDir)\lib;c:\Program Files (x86)\Microsoft DirectX SDK (August 2009)\Lib\x86\;c:\Program Files (x86)\OpenAL 1.1 SDK\libs\;d:\Projects\dependencies\libs\; - $(VCInstallDir)lib;$(VCInstallDir)atlmfc\lib;$(WindowsSdkDir)lib;$(FrameworkSDKDir)\lib;c:\Program Files (x86)\Microsoft DirectX SDK (August 2009)\Lib\x86\;c:\Program Files (x86)\OpenAL 1.1 SDK\libs\;d:\Projects\dependencies\libs\; - - - - Disabled - %(AdditionalIncludeDirectories) - FEX_ENABLE_RAR;_CRT_SECURE_NO_WARNINGS;%(PreprocessorDefinitions) - true - EnableFastChecks - MultiThreadedDebug - $(IntDir)$(ProjectName).pdb - EditAndContinue - - - - - %(AdditionalIncludeDirectories) - FEX_ENABLE_RAR;_CRT_SECURE_NO_WARNINGS;%(PreprocessorDefinitions) - MultiThreaded - $(IntDir)$(ProjectName).pdb - ProgramDatabase - Full - Speed - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - \ No newline at end of file diff --git a/dependencies/File_Extractor-0.4.3/File_Extractor2010.vcxproj.filters b/dependencies/File_Extractor-0.4.3/File_Extractor2010.vcxproj.filters deleted file mode 100644 index 3295dffb..00000000 --- a/dependencies/File_Extractor-0.4.3/File_Extractor2010.vcxproj.filters +++ /dev/null @@ -1,191 +0,0 @@ - - - - - {389faf79-0326-47e9-957c-9a482f94e2e2} - - - {9e671547-6550-414c-8170-a013093aafe7} - - - {9a0c91a6-c1ce-4a79-94d6-2459b4171bff} - - - {e99e7ce7-b7cb-42d2-8e89-e2005d013c0e} - - - - - 7z - - - 7z - - - 7z\Archive - - - 7z\Archive - - - 7z\Archive - - - 7z\Archive - - - 7z\Archive - - - 7z\Archive - - - 7z\Archive - - - 7z\Archive - - - 7z\Compress - - - 7z\Compress - - - 7z\Compress - - - fex - - - fex - - - fex - - - fex - - - fex - - - fex - - - fex - - - fex - - - fex - - - fex - - - - - 7z - - - 7z - - - 7z\Archive - - - 7z\Archive - - - 7z\Archive - - - 7z\Archive - - - 7z\Archive - - - 7z\Archive - - - 7z\Archive - - - 7z\Archive - - - 7z\Compress - - - 7z\Compress - - - 7z\Compress - - - 7z\Compress - - - 7z\Compress - - - 7z - - - fex - - - fex - - - fex - - - fex - - - fex - - - fex - - - fex - - - fex - - - fex - - - fex - - - fex - - - fex - - - fex - - - fex - - - - - 7z - - - 7z - - - 7z - - - \ No newline at end of file diff --git a/dependencies/File_Extractor-0.4.3/demo.c b/dependencies/File_Extractor-0.4.3/demo.c deleted file mode 100644 index e2985d36..00000000 --- a/dependencies/File_Extractor-0.4.3/demo.c +++ /dev/null @@ -1,53 +0,0 @@ -/* C example that opens an archive, lists its contents, and -extracts the first several characters of each file. */ - -#include "fex/fex.h" - -#include -#include - -/* If error is not NULL, prints it and exits program */ -static void error( const char* error ); - -int main( int argc, char* argv [] ) -{ - /* Path to archive */ - const char* path = (argc > 1 ? argv [argc - 1] : "test.zip"); - - /* Open archive */ - fex_err_t err; - File_Extractor* fex = fex_open( path, &err ); - error( err ); - - /* Iterate over each file in archive */ - while ( !fex_done( fex ) ) - { - char buf [50] = ""; - - /* Print size and name */ - const char* name = fex_name( fex ); - long size = fex_size( fex ); - printf( "## %3ld K %s\n", size / 1024, name ); - - /* Print first several characters of data */ - error( fex_read( fex, buf, (size < 49 ? size : 49) ) ); - printf( "%s\n", buf ); - - /* Go to next file in archive */ - error( fex_next( fex ) ); - } - - /* Cleanup */ - fex_close( fex ); - - return 0; -} - -void error( const char* error ) -{ - if ( error ) - { - fprintf( stderr, "Error: %s\n", error ); - exit( EXIT_FAILURE ); - } -} diff --git a/dependencies/File_Extractor-0.4.3/fex.txt b/dependencies/File_Extractor-0.4.3/fex.txt deleted file mode 100644 index c6399419..00000000 --- a/dependencies/File_Extractor-0.4.3/fex.txt +++ /dev/null @@ -1,209 +0,0 @@ -File_Extractor 0.4.3 --------------------- -Author : Shay Green -Website : http://www.slack.net/~ant/ -License : GNU Lesser General Public License (LGPL) for all except unrar -Language: C or C++ - - -Contents --------- -* Overview -* Limitations -* C and C++ interfaces -* Extracting file data -* Alternate interfaces: unzip.h and unrarlib.h -* Minimal version: fex_mini.cpp -* Library compilation -* Error handling -* Solving problems -* Thanks - - -Overview --------- -This library contains several modules that support different archive -formats. They have a common interface allowing an archive to be opened, -scanned, and extracted from. To use an archive, do the following: - -* Open file using appropriate extractor. -* See if at end of archive. -* Get info for current file and/or extract data from it. -* Go to next file and check if at end of archive and repeat above. -* If desired at any point, rewind and scan the archive again. -* When done, close archive. - -If support for one or more archive types is not needed, many of the -library sources can be eliminated. Refer to the files list in readme.txt -to find what can be removed. - - -Details -------- -All archives: -* A file's checksum is verified only if all the file's data is read from -the archive. -* Encryption, segmentation, 2GB and larger files, and other extra -features are not supported. - -GZ archives: -* Only gzip archives of a single file are supported. If it has multiple -files, the reported size will be wrong. Multi-file gzip files are rare. - -ZIP archives: -* Supports files compressed using deflation or no compression. Other -compression schemes are not supported. -* Archive must have a valid directory structure at the end. -* Optimized file access reduces reads and keeps them aligned - -RAR archives: -* Support for really old 1.x archives might not work. Send me some test -archives as I couldn't find any. - -7-zip: -* Solid archives currently can use lots of memory. -* Modification date isn't supported. - - -C and C++ interfaces --------------------- -This library includes a C interface in fex.h, which can be used from C -and C++. If this is being compiled as a shared library (rather than -linking statically), only the C interface in fex.h should be used since -it will change less in future versions. - -The native C++ interface is in File_Extractor.h and supports more ways -of reading data and accessing files. Both interfaces can be used -together in C++ code without problems. The interfaces correspond in a -consistent way: - - C interface C++ interface - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - File_Extractor* fex; File_Extractor* fex; - - fex_open( path, &fex ); fex_open( path, &fex ); - - fex_done( fex ); fex->done(); - - fex_read( fex, out, count ); fex->read( out, count ); - - fex_close( fex ); delete fex; - -The archive extractor classes are derived from File_Extractor, which -allows a File_Extractor* to point to any type of extractor. There is no -need to use concrete types directly (Zip_Extractor, etc.). - - -Extracting file data --------------------- -Data for a file in an archive can be accessed in three ways: - -* Make one or more calls to read(). -* Get a pointer to the file's data in memory. -* Have extractor write data to Data_Writer you provide (C++ only). - -Each archive type has an optimal access method that you might use if you -were using only one archive type and wanted to avoid extra memory -allocation or copying. Single_File_Extractor and Zip_Extractor favor -read(), Zip7_Extractor favors getting a pointer to data in memory, and -Rar_Extractor favors writing the data to a Data_Writer. - -You should generally use whatever method is most convenient in your -program. In most cases you will be keeping a copy of the data in memory -after closing the archive, so you'll want to use read(). As long as you -read the ENTIRE file's contents in one call to read(), your code will be -most efficient and won't involve any extra memory allocation. If you -only need the first portion of the file and will not be reading the rest -(for example, if scanning headers only), you can use the optimized -read_once() function instead of the normal read(). - - -Alternate interfaces: unzip.h and unrarlib.h --------------------------------------------- -If your code already uses the unzip.h or unrarlib.h library, you can -begin using fex with minimal/no changes to your code by using the -included wrappers. Most unrarlib.h functions are supported, and the main -unzip.h functions are supported. Only basic file information is returned -by each; things like dates and directories are not supported. These -header files should NOT be used if you're writing new code, since they -are inferior to the fex.h interface. - -Both of these header files define FEX_WRAPPER to 1, so your code can -check for that macro and if defined, support additional archive formats -rather than just .rar or .zip. - - -Minimal version: fex_mini.cpp ------------------------------ -You can use fex_mini.cpp and fex.h as an absolute minimum version. If -you have zlib installed and HAVE_ZLIB_H defined, gzipped files are -supported, otherwise only uncompressed files are supported. No other -source files are required for this version. No changes to your source -are necessary as long as you use only fex.h functionality. - - -Library compilation -------------------- -While this library is written in C++, it should easily link in a C -program WITHOUT needing the standard C++ library. It doesn't use -exception handling or run-time type information (RTTI), so you can -disable these in your C++ compiler to increase efficiency. - -If you're building a shared library (DLL), I HIGHLY recommend only -exporting the C interface from fex.h, as the C++ interface exposes -implementation details that will surely break link compatibility across -versions. If you aren't familiar with symbol exporting, just be sure you -only use fex.h to access the shared library. - -If you're using C and compiling with GCC, I recommend the following -command-line options when compiling the library source, otherwise GCC -will insert calls to the standard C++ library and require that it be -linked in: - - -fno-rtti -fno-exceptions - - -Error handling --------------- -Functions that can fail have a return type of fex_err_t (blargg_err_t in -the C++ interfaces), which is a pointer to an error string, const char*. -If a function is successful it returns NULL. Logic errors that can be -easily avoided are checked with debug-only assertions; error return -values are only used for genuine run-time errors that can't be easily -prevented in advance (out of memory, I/O errors, incompatible file -data). All return values should be checked after calling library -functions. - -To improve usability for C programmers, C++ programmers unfamiliar with -exceptions, and compatibility with older C++ compilers, the library does -NOT throw any C++ exceptions, and uses malloc() instead of the standard -operator new. This means that in C++ you MUST check for NULL when -creating a library object with the new operator. - - -Solving problems ----------------- -If you're having problems, try the following: - -* Enable debugging support in your environment. This enables assertions -and other run-time checks. In particular, be sure NDEBUG isn't defined. - -* Turn the compiler's optimizer is off. Sometimes an optimizer generates -bad code. - -* If multiple threads are being used, ensure that only one at a time is -accessing a given set of objects from the library. This library is not -in general thread-safe, though independent objects can be used in -separate threads. - -* If all else fails, see if the demo works. - - -Thanks ------- -Thanks to Richard Bannister, Kode54, and DJRobX for testing and giving -feedback for the library. Thanks to the authors of zlib, unrar, and -7-zip. - --- -Shay Green diff --git a/dependencies/File_Extractor-0.4.3/fex/Data_Reader.cpp b/dependencies/File_Extractor-0.4.3/fex/Data_Reader.cpp deleted file mode 100644 index db1fe929..00000000 --- a/dependencies/File_Extractor-0.4.3/fex/Data_Reader.cpp +++ /dev/null @@ -1,323 +0,0 @@ -// File_Extractor 0.4.3. http://www.slack.net/~ant/ - -#include "Data_Reader.h" - -#include "blargg_endian.h" -#include -#include -#include - -/* Copyright (C) 2005-2006 Shay Green. This module is free software; you -can redistribute it and/or modify it under the terms of the GNU Lesser -General Public License as published by the Free Software Foundation; either -version 2.1 of the License, or (at your option) any later version. This -module is distributed in the hope that it will be useful, but WITHOUT ANY -WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS -FOR A PARTICULAR PURPOSE. See the GNU Lesser General Public License for more -details. You should have received a copy of the GNU Lesser General Public -License along with this module; if not, write to the Free Software Foundation, -Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA */ - -#include "blargg_source.h" - -const char Data_Reader::eof_error [] = "Unexpected end of file"; - -blargg_err_t Data_Reader::read( void* p, long s ) -{ - long result = read_avail( p, s ); - if ( result == s ) - return 0; - - if ( result < 0 ) - return "Read error"; - - return eof_error; -} - -blargg_err_t Data_Reader::skip( long count ) -{ - char buf [512]; - while ( count ) - { - long n = sizeof buf; - if ( n > count ) - n = count; - count -= n; - RETURN_ERR( read( buf, n ) ); - } - return 0; -} - -long File_Reader::remain() const { return size() - tell(); } - -blargg_err_t File_Reader::skip( long n ) -{ - assert( n >= 0 ); - if ( !n ) - return 0; - return seek( tell() + n ); -} - -// Subset_Reader - -Subset_Reader::Subset_Reader( Data_Reader* dr, long size ) -{ - in = dr; - remain_ = dr->remain(); - if ( remain_ > size ) - remain_ = size; -} - -long Subset_Reader::remain() const { return remain_; } - -long Subset_Reader::read_avail( void* p, long s ) -{ - if ( s > remain_ ) - s = remain_; - remain_ -= s; - return in->read_avail( p, s ); -} - -// Remaining_Reader - -Remaining_Reader::Remaining_Reader( void const* h, long size, Data_Reader* r ) -{ - header = (char const*) h; - header_end = header + size; - in = r; -} - -long Remaining_Reader::remain() const { return header_end - header + in->remain(); } - -long Remaining_Reader::read_first( void* out, long count ) -{ - long first = header_end - header; - if ( first ) - { - if ( first > count ) - first = count; - void const* old = header; - header += first; - memcpy( out, old, first ); - } - return first; -} - -long Remaining_Reader::read_avail( void* out, long count ) -{ - long first = read_first( out, count ); - long second = count - first; - if ( second ) - { - second = in->read_avail( (char*) out + first, second ); - if ( second <= 0 ) - return second; - } - return first + second; -} - -blargg_err_t Remaining_Reader::read( void* out, long count ) -{ - long first = read_first( out, count ); - long second = count - first; - if ( !second ) - return 0; - return in->read( (char*) out + first, second ); -} - -// Mem_File_Reader - -Mem_File_Reader::Mem_File_Reader( const void* p, long s ) : - begin( (const char*) p ), - size_( s ) -{ - pos = 0; -} - -long Mem_File_Reader::size() const { return size_; } - -long Mem_File_Reader::read_avail( void* p, long s ) -{ - long r = remain(); - if ( s > r ) - s = r; - memcpy( p, begin + pos, s ); - pos += s; - return s; -} - -long Mem_File_Reader::tell() const { return pos; } - -blargg_err_t Mem_File_Reader::seek( long n ) -{ - if ( n > size_ ) - return eof_error; - pos = n; - return 0; -} - -// Callback_Reader - -Callback_Reader::Callback_Reader( callback_t c, long size, void* d ) : - callback( c ), - data( d ) -{ - remain_ = size; -} - -long Callback_Reader::remain() const { return remain_; } - -long Callback_Reader::read_avail( void* out, long count ) -{ - if ( count > remain_ ) - count = remain_; - - if ( Callback_Reader::read( out, count ) ) - return -1; - - return 0; -} - -blargg_err_t Callback_Reader::read( void* out, long count ) -{ - if ( count > remain_ ) - return eof_error; - return callback( data, out, count ); -} - -// Std_File_Reader - -Std_File_Reader::Std_File_Reader() : file_( 0 ) { } - -Std_File_Reader::~Std_File_Reader() { close(); } - -blargg_err_t Std_File_Reader::open( const char* path ) -{ - file_ = fopen( path, "rb" ); - if ( !file_ ) - return "Couldn't open file"; - return 0; -} - -void Std_File_Reader::make_unbuffered() -{ - if ( setvbuf( (FILE*) file_, 0, _IONBF, 0 ) ) - check( false ); // shouldn't fail, but OK if it does -} - -long Std_File_Reader::size() const -{ - long pos = tell(); - fseek( (FILE*) file_, 0, SEEK_END ); - long result = tell(); - fseek( (FILE*) file_, pos, SEEK_SET ); - return result; -} - -long Std_File_Reader::read_avail( void* p, long s ) -{ - return fread( p, 1, s, (FILE*) file_ ); -} - -blargg_err_t Std_File_Reader::read( void* p, long s ) -{ - if ( s == (long) fread( p, 1, s, (FILE*) file_ ) ) - return 0; - if ( feof( (FILE*) file_ ) ) - return eof_error; - return "Couldn't read from file"; -} - -long Std_File_Reader::tell() const { return ftell( (FILE*) file_ ); } - -blargg_err_t Std_File_Reader::seek( long n ) -{ - if ( !fseek( (FILE*) file_, n, SEEK_SET ) ) - return 0; - if ( n > size() ) - return eof_error; - return "Error seeking in file"; -} - -void Std_File_Reader::close() -{ - if ( file_ ) - { - fclose( (FILE*) file_ ); - file_ = 0; - } -} - -// Gzip_File_Reader - -#ifdef HAVE_ZLIB_H - -#include "zlib.h" - -static const char* get_gzip_eof( const char* path, long* eof ) -{ - FILE* file = fopen( path, "rb" ); - if ( !file ) - return "Couldn't open file"; - - unsigned char buf [4]; - if ( fread( buf, 2, 1, file ) > 0 && buf [0] == 0x1F && buf [1] == 0x8B ) - { - fseek( file, -4, SEEK_END ); - fread( buf, 4, 1, file ); - *eof = get_le32( buf ); - } - else - { - fseek( file, 0, SEEK_END ); - *eof = ftell( file ); - } - const char* err = (ferror( file ) || feof( file )) ? "Couldn't get file size" : 0; - fclose( file ); - return err; -} - -Gzip_File_Reader::Gzip_File_Reader() : file_( 0 ) { } - -Gzip_File_Reader::~Gzip_File_Reader() { close(); } - -blargg_err_t Gzip_File_Reader::open( const char* path ) -{ - close(); - - RETURN_ERR( get_gzip_eof( path, &size_ ) ); - - file_ = gzopen( path, "rb" ); - if ( !file_ ) - return "Couldn't open file"; - - return 0; -} - -long Gzip_File_Reader::size() const { return size_; } - -long Gzip_File_Reader::read_avail( void* p, long s ) { return gzread( file_, p, s ); } - -long Gzip_File_Reader::tell() const { return gztell( file_ ); } - -blargg_err_t Gzip_File_Reader::seek( long n ) -{ - if ( gzseek( file_, n, SEEK_SET ) >= 0 ) - return 0; - - if ( n > size_ ) - return eof_error; - - return "Error seeking in file"; -} - -void Gzip_File_Reader::close() -{ - if ( file_ ) - { - gzclose( file_ ); - file_ = 0; - } -} - -#endif diff --git a/dependencies/File_Extractor-0.4.3/fex/Data_Reader.h b/dependencies/File_Extractor-0.4.3/fex/Data_Reader.h deleted file mode 100644 index d49856ae..00000000 --- a/dependencies/File_Extractor-0.4.3/fex/Data_Reader.h +++ /dev/null @@ -1,161 +0,0 @@ -// Lightweight interface for reading data - -// File_Extractor 0.4.3 -#ifndef DATA_READER_H -#define DATA_READER_H - -#include "blargg_common.h" - -// Supports reading and finding out how many bytes are remaining -class Data_Reader { -public: - virtual ~Data_Reader() { } - - static const char eof_error []; // returned by read() when request goes beyond end - - // Reads at most n bytes and returns number actually read, or negative if error. - // Trying to read past end of file is NOT considered an error. - virtual long read_avail( void*, long n ) BLARGG_PURE( { (void) n; return 0; } ) - - // Read exactly n bytes and returns error if they couldn't ALL be read. - // Reading past end of file results in eof_error. - virtual blargg_err_t read( void*, long n ); - - // Number of bytes remaining until end of file - virtual long remain() const BLARGG_PURE( { return 0; } ) - - // Reads and discards n bytes. Skipping past end of file results in eof_error. - virtual blargg_err_t skip( long n ); - -public: - Data_Reader() { } - typedef blargg_err_t error_t; // deprecated - BLARGG_DISABLE_NOTHROW -private: - // noncopyable - Data_Reader( const Data_Reader& ); - Data_Reader& operator = ( const Data_Reader& ); -}; - -// Supports seeking in addition to Data_Reader operations -class File_Reader : public Data_Reader { -public: - // Size of file - virtual long size() const BLARGG_PURE( { return 0; } ) - - // Current position in file - virtual long tell() const BLARGG_PURE( { return 0; } ) - - // Goes to new position - virtual blargg_err_t seek( long ) BLARGG_PURE( { return 0; } ) - - long remain() const; - blargg_err_t skip( long n ); -}; - -// Disk file reader -class Std_File_Reader : public File_Reader { -public: - blargg_err_t open( const char* path ); - void close(); - - // Switches to unbuffered mode. Useful if you are doing your - // own buffering already. - void make_unbuffered(); - -public: - Std_File_Reader(); - ~Std_File_Reader(); - long size() const; - blargg_err_t read( void*, long ); - long read_avail( void*, long ); - long tell() const; - blargg_err_t seek( long ); -private: - void* file_; -}; - -// Treats range of memory as a file -class Mem_File_Reader : public File_Reader { -public: - Mem_File_Reader( const void* begin, long size ); - -public: - long size() const; - long read_avail( void*, long ); - long tell() const; - blargg_err_t seek( long ); -private: - const char* const begin; - const long size_; - long pos; -}; - -// Makes it look like there are only count bytes remaining -class Subset_Reader : public Data_Reader { -public: - Subset_Reader( Data_Reader*, long count ); - -public: - long remain() const; - long read_avail( void*, long ); -private: - Data_Reader* in; - long remain_; -}; - -// Joins already-read header and remaining data into original file. -// Meant for cases where you've already read header and don't want -// to seek and re-read data (for efficiency). -class Remaining_Reader : public Data_Reader { -public: - Remaining_Reader( void const* header, long header_size, Data_Reader* ); - -public: - long remain() const; - long read_avail( void*, long ); - blargg_err_t read( void*, long ); -private: - char const* header; - char const* header_end; - Data_Reader* in; - long read_first( void* out, long count ); -}; - -// Invokes callback function to read data. Size of data must be specified in advance. -// Passes user_data unchanged to your callback. -class Callback_Reader : public Data_Reader { -public: - typedef const char* (*callback_t)( void* user_data, void* out, long count ); - Callback_Reader( callback_t, long size, void* user_data = 0 ); -public: - long read_avail( void*, long ); - blargg_err_t read( void*, long ); - long remain() const; -private: - callback_t const callback; - void* const data; - long remain_; -}; - -#ifdef HAVE_ZLIB_H -// Gzip compressed file reader -class Gzip_File_Reader : public File_Reader { -public: - blargg_err_t open( const char* path ); - void close(); - -public: - Gzip_File_Reader(); - ~Gzip_File_Reader(); - long size() const; - long read_avail( void*, long ); - long tell() const; - blargg_err_t seek( long ); -private: - void* file_; - long size_; -}; -#endif - -#endif diff --git a/dependencies/File_Extractor-0.4.3/fex/File_Extractor.cpp b/dependencies/File_Extractor-0.4.3/fex/File_Extractor.cpp deleted file mode 100644 index 7563809a..00000000 --- a/dependencies/File_Extractor-0.4.3/fex/File_Extractor.cpp +++ /dev/null @@ -1,247 +0,0 @@ -// File_Extractor 0.4.3. http://www.slack.net/~ant/ - -#include "File_Extractor.h" - -#include -#include -#include - -/* Copyright (C) 2005-2007 Shay Green. This module is free software; you -can redistribute it and/or modify it under the terms of the GNU Lesser -General Public License as published by the Free Software Foundation; either -version 2.1 of the License, or (at your option) any later version. This -module is distributed in the hope that it will be useful, but WITHOUT ANY -WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS -FOR A PARTICULAR PURPOSE. See the GNU Lesser General Public License for more -details. You should have received a copy of the GNU Lesser General Public -License along with this module; if not, write to the Free Software Foundation, -Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA */ - -#include "blargg_source.h" - -const char fex_wrong_file_type [] = "Archive format not supported"; - -File_Extractor::File_Extractor( fex_type_t t ) : - type_( t ) -{ - user_data_ = 0; - user_cleanup_ = 0; - init_state(); -} - -// Open - -void File_Extractor::open_filter_( const char*, Std_File_Reader* ) { } - -blargg_err_t File_Extractor::open( const char* path ) -{ - Std_File_Reader* in = BLARGG_NEW Std_File_Reader; - CHECK_ALLOC( in ); - - blargg_err_t err = in->open( path ); - if ( !err ) - { - open_filter_( path, in ); - err = this->open( in ); - } - - if ( err ) - { - delete in; - return err; - } - - own_file(); - return 0; -} - -blargg_err_t File_Extractor::open( File_Reader* input ) -{ - require( input->tell() == 0 ); // needs to be at beginning - close(); - reader_ = input; - blargg_err_t err = open_(); - if ( !err ) - done_ = false; - else - close(); - return err; -} - -// Close - -void File_Extractor::init_state() -{ - done_ = true; - scan_only_ = false; - reader_ = 0; - own_file_ = false; - own_data_ = 0; - clear_file(); -} - -void File_Extractor::close() -{ - close_(); - if ( own_file_ && reader_ ) - delete reader_; - clear_file(); - init_state(); -} - -File_Extractor::~File_Extractor() -{ - // fails if derived class didn't call close() in its destructor - check( !own_file_ && !reader_ ); - if ( user_cleanup_ ) - user_cleanup_( user_data_ ); -} - -// Scanning - -void File_Extractor::free_data() -{ - data_ptr_ = 0; - free( own_data_ ); - own_data_ = 0; -} - -void File_Extractor::clear_file() -{ - set_info( 0, 0 ); - data_pos_ = 0; - free_data(); - clear_file_(); -} - -void File_Extractor::set_info( long size, const char* name, unsigned long date ) -{ - size_ = size; - name_ = name; - date_ = (date != 0xFFFFFFFF ? date : 0); -} - -blargg_err_t File_Extractor::next() -{ - if ( done() ) - return "End of archive"; - - clear_file(); - blargg_err_t err = next_(); - if ( err ) - done_ = true; - if ( done_ ) - clear_file(); - return err; -} - -blargg_err_t File_Extractor::rewind() -{ - if ( !reader_ ) - return "No open archive"; - - done_ = false; - scan_only_ = false; - clear_file(); - - blargg_err_t err = rewind_(); - if ( err ) - { - done_ = true; - clear_file(); - } - return err; -} - -// Full extraction - -blargg_err_t File_Extractor::data_( byte const*& out ) -{ - if ( !own_data_ ) - CHECK_ALLOC( own_data_ = (byte*) malloc( size_ ? size_ : 1 ) ); - - out = own_data_; - return read_once( own_data_, size_ ); -} - -unsigned char const* File_Extractor::data( blargg_err_t* error_out ) -{ - const char* error = 0; - if ( !reader_ ) - { - error = eof_error; - } - else if ( !data_ptr_ ) - { - error = data_( data_ptr_ ); - if ( error ) - free_data(); - } - - if ( error_out ) - *error_out = error; - - return data_ptr_; -} - -blargg_err_t File_Extractor::extract( Data_Writer& out ) -{ - blargg_err_t error; - byte const* p = data( &error ); - RETURN_ERR( error ); - - return out.write( p, size_ ); -} - -blargg_err_t File_Extractor::read_once( void* out, long count ) -{ - Mem_Writer mem( out, count, 1 ); - return extract( mem ); -} - -// Data_Reader functions - -long File_Extractor::remain() const { return size_ - data_pos_; } - -long File_Extractor::read_avail( void* out, long count ) -{ - if ( count ) - { - long r = remain(); - if ( count > r ) - count = r; - - if ( read( out, count ) ) - count = -1; - } - return count; -} - -blargg_err_t File_Extractor::read( void* out, long count ) -{ - if ( count > remain() ) - return "End of file"; - - if ( count == size_ && !data_ptr_ ) - { - // avoid temporary buffer when reading entire file in one call - assert( data_pos_ == 0 ); - RETURN_ERR( read_once( out, count ) ); - } - else - { - if ( count && !data_ptr_ ) - { - blargg_err_t err; - data( &err ); // sets data_ptr_ - RETURN_ERR( err ); - } - - memcpy( out, data_ptr_ + data_pos_, count ); - } - data_pos_ += count; - if ( data_pos_ == size_ ) - free_data(); - - return 0; -} diff --git a/dependencies/File_Extractor-0.4.3/fex/File_Extractor.h b/dependencies/File_Extractor-0.4.3/fex/File_Extractor.h deleted file mode 100644 index f562a95f..00000000 --- a/dependencies/File_Extractor-0.4.3/fex/File_Extractor.h +++ /dev/null @@ -1,153 +0,0 @@ -// Compressed file archive interface (C++) - -// File_Extractor 0.4.3 -#ifndef FILE_EXTRACTOR_H -#define FILE_EXTRACTOR_H - -#include "fex.h" -#include "blargg_common.h" -#include "abstract_file.h" - -struct File_Extractor : private Data_Reader { -public: -// Open/close - - // Opens archive - blargg_err_t open( const char* path ); - - // Opens archive from custom data source. Keeps pointer to input - // until close(), but does not delete reader at close() unless you - // call own_file() before then. - blargg_err_t open( File_Reader* input ); - - // Transfers ownership of current input file passed to open() so that - // it will be deleted on close() - void own_file() { own_file_ = true; } - - // Closes archive and frees memory - void close(); - -// Scanning - - // True if end of archive has been reached - bool done() const { return done_; } - - // Path of current file in archive, using '/' as directory separator - const char* name() const { return name_; } - - // Size of current file, in bytes - long size() const { return size_; } - - // Modification date of file, in MS-DOS format (0 if unavailable). - unsigned long dos_date() const { return date_; } - - // Goes to next file (skips directories) - blargg_err_t next(); - - // Goes back to first file in archive - blargg_err_t rewind(); - -// Data extraction - - // Read exactly n bytes and returns error if they couldn't ALL be read. - // Reading past end of file results in eof_error. - blargg_err_t read( void* out, long n ); - - // Reads at most n bytes and returns number actually read, or negative if error. - // Trying to read past end of file is NOT considered an error. - long read_avail( void* out, long n ); - - // Number of bytes remaining until end of current file - long remain() const; - - // Reads and discards n bytes. Skipping past end of file results in eof_error. - blargg_err_t skip( long n ) { return Data_Reader::skip( n ); } - - // Data_Reader to current file's data, so you can use standard Data_Reader - // interface and not have to treat archives specially. - Data_Reader& reader() { return *this; } - - // Alternate ways of extracting file. Only one method may be used - // once before calling next() or rewind(). - - // Extracts first n bytes and ignores rest. Faster than a normal read since it - // doesn't have to be prepared to read/decompress more data. - virtual blargg_err_t read_once( void* out, long n ); - - // Extracts all data and writes it to out - virtual blargg_err_t extract( Data_Writer& out ); - - // Gets pointer to file's data. Returned pointer is valid until next call to - // next(), rewind(), close(), or open(). Sets *error_out to error. OK to call - // more than once in a row; returns same pointer in that case. - typedef unsigned char byte; - byte const* data( blargg_err_t* error_out ); - -// Other features - - // Type of this extractor (fex_zip_type, etc.) - fex_type_t type() const { return type_; } - - // Hints that archive will either be only scanned (true), or might be extracted - // from (false), improving performance on solid archives. Calling rewind() - // resets this to the best default. - void scan_only( bool b = true ) { scan_only_ = b; } - - // Sets/gets pointer to data you want to associate with this object. - // You can use this for whatever you want. - void set_user_data( void* p ) { user_data_ = p; } - void* user_data() const { return user_data_; } - - // Registers cleanup function to be called when deleting this object. Passes - // user_data to cleanup function. Pass NULL to clear any cleanup function. - void set_user_cleanup( fex_user_cleanup_t func ) { user_cleanup_ = func; } - - virtual ~File_Extractor(); - -public: - BLARGG_DISABLE_NOTHROW - File_Extractor( fex_type_t ); - Data_Reader::eof_error; -protected: - // Services for extractors - File_Reader& file() const { return *reader_; } - void set_done() { done_ = true; } - void set_info( long size, const char* name, unsigned long date = 0 ); - bool is_scan_only() const { return scan_only_; } - - // Overridden by extractors - virtual void open_filter_( const char* path, Std_File_Reader* ); - virtual blargg_err_t open_() BLARGG_PURE( { return 0; } ) - virtual blargg_err_t next_() BLARGG_PURE( { return 0; } ) - virtual blargg_err_t rewind_() BLARGG_PURE( { return 0; } ) - virtual void close_() BLARGG_PURE( { } ) - virtual void clear_file_() { } - virtual blargg_err_t data_( byte const*& out ); -private: - fex_type_t const type_; - File_Reader* reader_; - bool own_file_; - bool scan_only_; - bool done_; - - const char* name_; - unsigned long date_; - long size_; - long data_pos_; // current position in data - byte const* data_ptr_; - byte* own_data_; // memory we allocated for data - - void* user_data_; - fex_user_cleanup_t user_cleanup_; - - void init_state(); - void clear_file(); - void free_data(); -}; - -// Default to Std_File_Reader for archive access -#ifndef FEX_FILE_READER - #define FEX_FILE_READER Std_File_Reader -#endif - -#endif diff --git a/dependencies/File_Extractor-0.4.3/fex/Gzip_Reader.cpp b/dependencies/File_Extractor-0.4.3/fex/Gzip_Reader.cpp deleted file mode 100644 index a7862bc8..00000000 --- a/dependencies/File_Extractor-0.4.3/fex/Gzip_Reader.cpp +++ /dev/null @@ -1,109 +0,0 @@ -// File_Extractor 0.4.3. http://www.slack.net/~ant/ - -#include "Gzip_Reader.h" - -#include "blargg_endian.h" - -/* Copyright (C) 2006-2007 Shay Green. This module is free software; you -can redistribute it and/or modify it under the terms of the GNU Lesser -General Public License as published by the Free Software Foundation; either -version 2.1 of the License, or (at your option) any later version. This -module is distributed in the hope that it will be useful, but WITHOUT ANY -WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS -FOR A PARTICULAR PURPOSE. See the GNU Lesser General Public License for more -details. You should have received a copy of the GNU Lesser General Public -License along with this module; if not, write to the Free Software Foundation, -Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA */ - -#include "blargg_source.h" - -void Gzip_Reader::close() -{ - in = 0; - tell_ = 0; - size_ = 0; - inflater.end(); -} - -Gzip_Reader::Gzip_Reader() { close(); } - -Gzip_Reader::~Gzip_Reader() { } - -static blargg_err_t gzip_reader_read( void* file, void* out, long* count ) -{ - *count = ((File_Reader*) file)->read_avail( out, *count ); - return (*count < 0 ? "Read error" : 0); -} - -blargg_err_t Gzip_Reader::open( File_Reader* new_in ) -{ - close(); - - RETURN_ERR( inflater.begin( gzip_reader_read, new_in ) ); - RETURN_ERR( inflater.set_mode( inflater.mode_auto ) ); - - size_ = -1; // defer seeking to end of file until size is actually needed - in = new_in; - return 0; -} - -blargg_err_t Gzip_Reader::calc_size() -{ - long size = in->size(); - if ( inflater.deflated() ) - { - byte trailer [4]; - long pos = in->tell(); - RETURN_ERR( in->seek( size - sizeof trailer ) ); - RETURN_ERR( in->read( trailer, sizeof trailer ) ); - RETURN_ERR( in->seek( pos ) ); - size = get_le32( trailer ); - } - size_ = size; - return 0; -} - -long Gzip_Reader::remain() const -{ - if ( size_ < 0 ) - { - if ( !in ) - return 0; - - // need to cast away constness to change cached value - if ( ((Gzip_Reader*) this)->calc_size() ) - return -1; - } - return size_ - tell_; -} - -blargg_err_t Gzip_Reader::read_( void* out, long* count ) -{ - blargg_err_t err = inflater.read( out, count ); - tell_ += *count; - if ( size_ >= 0 && tell_ > size_ ) - { - tell_ = size_; - return inflater.corrupt_error; - } - return err; -} - -blargg_err_t Gzip_Reader::read( void* out, long count ) -{ - if ( in ) - { - long actual = count; - RETURN_ERR( read_( out, &actual ) ); - if ( actual == count ) - return 0; - } - return eof_error; -} - -long Gzip_Reader::read_avail( void* out, long count ) -{ - if ( !in || read_( out, &count ) ) - count = -1; - return count; -} diff --git a/dependencies/File_Extractor-0.4.3/fex/Gzip_Reader.h b/dependencies/File_Extractor-0.4.3/fex/Gzip_Reader.h deleted file mode 100644 index 42059c79..00000000 --- a/dependencies/File_Extractor-0.4.3/fex/Gzip_Reader.h +++ /dev/null @@ -1,35 +0,0 @@ -// Transparently decompresses gzip files, as well as uncompressed - -// File_Extractor 0.4.3 -#ifndef GZIP_READER_H -#define GZIP_READER_H - -#include "Data_Reader.h" -#include "Zlib_Inflater.h" - -class Gzip_Reader : public Data_Reader { -public: - error_t open( File_Reader* ); - void close(); - long tell() const { return tell_; } - - // True if file is compressed - bool deflated() const { return inflater.deflated(); } - -public: - Gzip_Reader(); - ~Gzip_Reader(); - long remain() const; - error_t read( void*, long ); - long read_avail( void*, long ); -private: - File_Reader* in; - long tell_; - long size_; - Zlib_Inflater inflater; - - error_t calc_size(); - blargg_err_t read_( void* out, long* count ); -}; - -#endif diff --git a/dependencies/File_Extractor-0.4.3/fex/Single_File_Extractor.cpp b/dependencies/File_Extractor-0.4.3/fex/Single_File_Extractor.cpp deleted file mode 100644 index b587d334..00000000 --- a/dependencies/File_Extractor-0.4.3/fex/Single_File_Extractor.cpp +++ /dev/null @@ -1,88 +0,0 @@ -// File_Extractor 0.4.3. http://www.slack.net/~ant/ - -#include "Single_File_Extractor.h" - -#include - -/* Copyright (C) 2005-2007 Shay Green. This module is free software; you -can redistribute it and/or modify it under the terms of the GNU Lesser -General Public License as published by the Free Software Foundation; either -version 2.1 of the License, or (at your option) any later version. This -module is distributed in the hope that it will be useful, but WITHOUT ANY -WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS -FOR A PARTICULAR PURPOSE. See the GNU Lesser General Public License for more -details. You should have received a copy of the GNU Lesser General Public -License along with this module; if not, write to the Free Software Foundation, -Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA */ - -#include "blargg_source.h" - -Single_File_Extractor::Single_File_Extractor() : File_Extractor( fex_bin_type ) -{ - size_ = 0; -} - -extern "C" { - static File_Extractor* new_single_file() { return BLARGG_NEW Single_File_Extractor; } -} - -fex_type_t_ const fex_gz_type [1] = {{ "GZ", &new_single_file }}; -fex_type_t_ const fex_bin_type [1] = {{ "" , &new_single_file }}; - -Single_File_Extractor::~Single_File_Extractor() { close(); } - -void Single_File_Extractor::close_() { gr.close(); } - -void Single_File_Extractor::set_name( const char* n ) -{ - name [sizeof name-1] = 0; - strncpy( name, n, sizeof name-1 ); -} - -void Single_File_Extractor::open_filter_( const char* path, Std_File_Reader* file ) -{ - file->make_unbuffered(); // faster since Gzip_Reader already buffers data - - const char* name = strrchr( path, '\\' ); // DOS - if ( !name ) - name = strrchr( path, '/' ); // UNIX - if ( !name ) - name = strrchr( path, ':' ); // Mac - if ( !name ) - name = path; - set_name( name ); -} - -blargg_err_t Single_File_Extractor::open_() -{ - RETURN_ERR( gr.open( &file() ) ); - - size_ = gr.remain(); - if ( size_ < 0 ) - return "Read error"; - - set_info( size_, name ); - return 0; -} - -blargg_err_t Single_File_Extractor::rewind_() -{ - if ( gr.tell() ) - { - RETURN_ERR( file().seek( 0 ) ); - RETURN_ERR( gr.open( &file() ) ); - } - set_info( size_, name ); - return 0; -} - -blargg_err_t Single_File_Extractor::next_() -{ - set_done(); - return 0; -} - -long Single_File_Extractor::remain () const { return size_ - gr.tell(); } -long Single_File_Extractor::read_avail( void* p, long n ) { return gr.read_avail( p, n ); } -blargg_err_t Single_File_Extractor::read ( void* p, long n ) { return gr.read( p, n ); } -blargg_err_t Single_File_Extractor::read_once ( void* p, long n ) { return read( p, n ); } diff --git a/dependencies/File_Extractor-0.4.3/fex/Single_File_Extractor.h b/dependencies/File_Extractor-0.4.3/fex/Single_File_Extractor.h deleted file mode 100644 index 4ef912a5..00000000 --- a/dependencies/File_Extractor-0.4.3/fex/Single_File_Extractor.h +++ /dev/null @@ -1,36 +0,0 @@ -// Presents a single file as an "archive" of just that file. -// Also handles gzipped file. - -// File_Extractor 0.4.3 -#ifndef SINGLE_FILE_EXTRACTOR_H -#define SINGLE_FILE_EXTRACTOR_H - -#include "File_Extractor.h" -#include "Gzip_Reader.h" - -class Single_File_Extractor : public File_Extractor { -public: - // Set reported name of file - void set_name( const char* ); - -public: - Single_File_Extractor(); - ~Single_File_Extractor(); - File_Extractor::open; - long read_avail( void*, long ); - blargg_err_t read( void*, long ); - long remain() const; - blargg_err_t read_once( void*, long ); -protected: - void open_filter_( const char*, Std_File_Reader* ); - blargg_err_t open_(); - blargg_err_t next_(); - blargg_err_t rewind_(); - void close_(); -private: - Gzip_Reader gr; - long size_; - char name [1024]; -}; - -#endif diff --git a/dependencies/File_Extractor-0.4.3/fex/Zip7_Extractor.cpp b/dependencies/File_Extractor-0.4.3/fex/Zip7_Extractor.cpp deleted file mode 100644 index 3bf8d528..00000000 --- a/dependencies/File_Extractor-0.4.3/fex/Zip7_Extractor.cpp +++ /dev/null @@ -1,180 +0,0 @@ -// File_Extractor 0.4.3. http://www.slack.net/~ant/ - -#include "Zip7_Extractor.h" - -#include -#include -#include -#include - -extern "C" { - #include "../7z_C/Archive/7z/7zExtract.h" - #include "../7z_C/7zCrc.h" -} - -/* Copyright (C) 2005-2008 Shay Green. This module is free software; you -can redistribute it and/or modify it under the terms of the GNU Lesser -General Public License as published by the Free Software Foundation; either -version 2.1 of the License, or (at your option) any later version. This -module is distributed in the hope that it will be useful, but WITHOUT ANY -WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS -FOR A PARTICULAR PURPOSE. See the GNU Lesser General Public License for more -details. You should have received a copy of the GNU Lesser General Public -License along with this module; if not, write to the Free Software Foundation, -Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA */ - -#include "blargg_source.h" - -static ISzAlloc alloc = { SzAlloc, SzFree }; -static ISzAlloc alloc_temp = { SzAllocTemp, SzFreeTemp }; - -struct Zip7_Extractor_Impl -{ - ISzInStream stream; // must be first - CArchiveDatabaseEx db; - - // SzExtract state - UInt32 block_index; - Byte* buf; - size_t buf_size; - - File_Reader* in; - -#ifdef _LZMA_IN_CB - enum { read_buf_size = 32 * 1024L }; - char read_buf [read_buf_size]; -#endif -}; - -extern "C" -{ -#ifdef _LZMA_IN_CB - static SZ_RESULT zip7_read_( void* data, void** out, size_t size, size_t* size_out ) - { - assert( out && size_out ); - Zip7_Extractor_Impl* impl = (Zip7_Extractor_Impl*) data; - if ( size > impl->read_buf_size ) - size = impl->read_buf_size; - *out = impl->read_buf; - *size_out = impl->in->read_avail( impl->read_buf, size ); - return SZ_OK; - } -#else - static SZ_RESULT zip7_read_( void* data, void* out, size_t size, size_t* size_out ) - { - assert( out && size_out ); - Zip7_Extractor_Impl* impl = (Zip7_Extractor_Impl*) data; - *size_out = impl->in->read_avail( out, size ); - return SZ_OK; - } -#endif - - static SZ_RESULT zip7_seek_( void* data, CFileSize offset ) - { - Zip7_Extractor_Impl* impl = (Zip7_Extractor_Impl*) data; - if ( impl->in->seek( offset ) ) - return SZE_FAIL; - return SZ_OK; - } -} - -Zip7_Extractor::Zip7_Extractor() : File_Extractor( fex_7z_type ) -{ - impl = 0; -} - -extern "C" { - static File_Extractor* new_7z() { return BLARGG_NEW Zip7_Extractor; } -} - -fex_type_t_ const fex_7z_type [1] = {{ "7Z", &new_7z }}; - -Zip7_Extractor::~Zip7_Extractor() { close(); } - -static const char* zip7_err( int err ) -{ - switch ( err ) - { - case SZ_OK: return 0; - case SZE_OUTOFMEMORY: return "Out of memory"; - case SZE_CRC_ERROR: return "Corrupt 7-zip file"; - case SZE_NOTIMPL: return "Unsupported 7-zip feature"; - //case SZE_FAIL: - //case SZE_DATA_ERROR: - //case SZE_ARCHIVE_ERROR: - } - return "7-zip error"; -} - -blargg_err_t Zip7_Extractor::open_() -{ - if ( !impl ) - CHECK_ALLOC( impl = (Zip7_Extractor_Impl*) malloc( sizeof *impl ) ); - impl->stream.Read = zip7_read_; - impl->stream.Seek = zip7_seek_; - impl->in = &file(); - impl->block_index = (unsigned) -1; - impl->buf = 0; - impl->buf_size = 0; - - CrcGenerateTable(); - SzArDbExInit( &impl->db ); - int code = SzArchiveOpen( &impl->stream, &impl->db, &alloc, &alloc_temp ); - RETURN_ERR( (code == SZE_ARCHIVE_ERROR ? fex_wrong_file_type : zip7_err( code )) ); - return rewind(); -} - -blargg_err_t Zip7_Extractor::rewind_() -{ - index = -1; - return next(); -} - -void Zip7_Extractor::close_() -{ - if ( impl ) - { - if ( impl->in ) - { - impl->in = 0; - SzArDbExFree( &impl->db, alloc.Free ); - } - alloc.Free( impl->buf ); - free( impl ); - impl = 0; - } -} - -blargg_err_t Zip7_Extractor::next_() -{ - while ( ++index < (int) impl->db.Database.NumFiles ) - { - CFileItem const& item = impl->db.Database.Files [index]; - if ( !item.IsDirectory ) - { - // TODO: support date - // stored as 64-bit value, divide by 10000000 (ten million) to get seconds - //item.LastWriteTime.Low + (.High << 32) - - set_info( item.Size, item.Name ); - return 0; - } - } - set_done(); - return 0; -} - -blargg_err_t Zip7_Extractor::data_( byte const*& out ) -{ - if ( !impl ) - return "Archive not open"; - - size_t offset = 0; - size_t size = 0; - RETURN_ERR( zip7_err( SzExtract( &impl->stream, &impl->db, index, - &impl->block_index, &impl->buf, &impl->buf_size, - &offset, &size, &alloc, &alloc_temp ) ) ); - assert( size == (size_t) this->size() ); - out = impl->buf + offset; - return 0; -} diff --git a/dependencies/File_Extractor-0.4.3/fex/Zip7_Extractor.h b/dependencies/File_Extractor-0.4.3/fex/Zip7_Extractor.h deleted file mode 100644 index 4e968e21..00000000 --- a/dependencies/File_Extractor-0.4.3/fex/Zip7_Extractor.h +++ /dev/null @@ -1,28 +0,0 @@ -// 7-zip archive extractor - -// File_Extractor 0.4.3 -#ifndef ZIP7_EXTRACTOR_H -#define ZIP7_EXTRACTOR_H - -#include "File_Extractor.h" - -struct Zip7_Extractor_Impl; - -class Zip7_Extractor : public File_Extractor { -public: - Zip7_Extractor(); - ~Zip7_Extractor(); -protected: - blargg_err_t open_(); - blargg_err_t next_(); - blargg_err_t rewind_(); - void close_(); - blargg_err_t data_( byte const*& out ); -private: - Zip7_Extractor_Impl* impl; - int index; - - blargg_err_t extract_(); -}; - -#endif diff --git a/dependencies/File_Extractor-0.4.3/fex/Zip_Extractor.cpp b/dependencies/File_Extractor-0.4.3/fex/Zip_Extractor.cpp deleted file mode 100644 index 3939ba70..00000000 --- a/dependencies/File_Extractor-0.4.3/fex/Zip_Extractor.cpp +++ /dev/null @@ -1,346 +0,0 @@ -// File_Extractor 0.4.3. http://www.slack.net/~ant/ - -#include "Zip_Extractor.h" - -#include "blargg_endian.h" -#include -#include -#include - -/* Copyright (C) 2005-2007 Shay Green. This module is free software; you -can redistribute it and/or modify it under the terms of the GNU Lesser -General Public License as published by the Free Software Foundation; either -version 2.1 of the License, or (at your option) any later version. This -module is distributed in the hope that it will be useful, but WITHOUT ANY -WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS -FOR A PARTICULAR PURPOSE. See the GNU Lesser General Public License for more -details. You should have received a copy of the GNU Lesser General Public -License along with this module; if not, write to the Free Software Foundation, -Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA */ - -// To avoid copying filename string from catalog, I terminate it by modifying -// catalog data. This potentially requires moving the first byte of the type -// of the next entry elsewhere; I move it to the first byte of made_by. Kind -// of hacky, but I'd rather not have to allocate memory for a copy of it. - -#include "blargg_source.h" - -// Reads this much from end of file when first opening. Only this much is -// searched for the end catalog entry. If whole catalog is within this data, -// nothing more needs to be read on open. -int const end_read_size = 8 * 1024L; - -// Reads are aligned to this size, increasing performance -int const disk_block_size = 4 * 1024L; - -// Read buffer used for extracting file data -int const read_buf_size = 16 * 1024L; - -struct header_t -{ - char type [4]; - byte vers [2]; - byte flags [2]; - byte method [2]; - byte date [4]; - byte crc [4]; - byte raw_size [4]; - byte size [4]; - byte filename_len [2]; - byte extra_len [2]; - char filename [2]; // [filename_len] - //char extra [extra_len]; -}; -int const header_size = 30; - -struct entry_t -{ - char type [4]; - byte made_by [2]; - byte vers [2]; - byte flags [2]; - byte method [2]; - byte date [4]; - byte crc [4]; - byte raw_size [4]; - byte size [4]; - byte filename_len [2]; - byte extra_len [2]; - byte comment_len [2]; - byte disk [2]; - byte int_attrib [2]; - byte ext_attrib [4]; - byte file_offset [4]; - char filename [2]; // [filename_len] - //char extra [extra_len]; - //char comment [comment_len]; -}; -int const entry_size = 46; - -struct end_entry_t -{ - char type [4]; - byte disk [2]; - byte first_disk [2]; - byte disk_entry_count [2]; - byte entry_count [2]; - byte dir_size [4]; - byte dir_offset [4]; - byte comment_len [2]; - char comment [2]; // [comment_len] -}; -int const end_entry_size = 22; - -Zip_Extractor::Zip_Extractor() : File_Extractor( fex_zip_type ) -{ - Zip_Extractor::clear_file_(); - assert( offsetof (header_t,filename) == header_size ); - assert( offsetof (entry_t,filename) == entry_size ); - assert( offsetof (end_entry_t,comment) == end_entry_size ); -} - -extern "C" { - static File_Extractor* new_zip() { return BLARGG_NEW Zip_Extractor; } -} - -fex_type_t_ const fex_zip_type [1] = {{ "ZIP", &new_zip }}; - -void Zip_Extractor::close_() { catalog.clear(); } - -Zip_Extractor::~Zip_Extractor() { close(); } - -void Zip_Extractor::open_filter_( const char*, Std_File_Reader* file ) -{ - file->make_unbuffered(); // faster since Zlib_Inflater already buffers data -} - -blargg_err_t Zip_Extractor::open_() -{ - file_size = file().size(); - if ( file_size < end_entry_size ) - return fex_wrong_file_type; - - // Read end of file - long buf_offset = file_size - end_read_size; - if ( buf_offset < 0 ) - buf_offset = 0; - buf_offset &= ~(disk_block_size - 1); // align beginning of read - RETURN_ERR( catalog.resize( file_size - buf_offset ) ); - RETURN_ERR( file().seek( buf_offset ) ); - RETURN_ERR( file().read( catalog.begin(), catalog.size() ) ); - - // Find end entry - int offset = catalog.size() - end_entry_size; - while ( memcmp( &catalog [offset], "PK\5\6", 4 ) ) - { - if ( --offset < 0 ) - return fex_wrong_file_type; - } - long end_offset = buf_offset + offset; - end_entry_t const& entry = (end_entry_t&) catalog [offset]; - - // some idiotic zip compressors add data to end of zip without setting comment len - check( file_size == end_offset + end_entry_size + get_le16( entry.comment_len ) ); - - // Find catalog offset - catalog_begin = get_le32( entry.dir_offset ); - long catalog_size = end_offset - catalog_begin; - if ( catalog_size < 0 ) - return buf.corrupt_error; - catalog_size += end_entry_size; - - // Catalog might already be completely read - long begin_offset = catalog_begin - buf_offset; - if ( begin_offset >= 0 ) // all catalog data already in memory - memmove( catalog.begin(), &catalog [begin_offset], catalog_size ); - - RETURN_ERR( catalog.resize( catalog_size ) ); - if ( begin_offset < 0 ) - { - // Need to read catalog - RETURN_ERR( file().seek( catalog_begin ) ); - RETURN_ERR( file().read( catalog.begin(), catalog.size() ) ); - } - - // first entry in catalog should be a file or end of archive - if ( memcmp( catalog.begin(), "PK\1\2", 4 ) && memcmp( catalog.begin(), "PK\5\6", 4 ) ) - return fex_wrong_file_type; - - // move first byte - catalog [4] = catalog [0]; - catalog [0] = 0; - - return rewind(); -} - -// Scanning - -blargg_err_t Zip_Extractor::update_info( bool advance_first ) -{ - while ( 1 ) - { - entry_t& e = (entry_t&) catalog [catalog_pos]; - - if ( memcmp( e.type, "\0K\1\2P", 5 ) ) - { - check( !memcmp( e.type, "\0K\5\6P", 5 ) ); - set_done(); - break; - } - - unsigned len = get_le16( e.filename_len ); - long next_offset = catalog_pos + entry_size + len + get_le16( e.extra_len ) + - get_le16( e.comment_len ); - if ( (unsigned long) next_offset > catalog.size() - end_entry_size ) - return buf.corrupt_error; - - if ( catalog [next_offset] == 'P' ) - { - // move first byte of type - catalog [next_offset] = 0; - catalog [next_offset + 4] = 'P'; - } - - if ( !advance_first ) - { - e.filename [len] = 0; // terminate name - - // Stop if not directory - long size = get_le32( e.size ); - if ( size || (e.filename [len - 1] != '/' && e.filename [len - 1] != '\\') ) - { - remain_ = size; - set_info( size, e.filename, get_le32( e.date ) ); - break; - } - } - - catalog_pos = next_offset; - advance_first = false; - } - return 0; -} - -blargg_err_t Zip_Extractor::rewind_() -{ - catalog_pos = 0; - return update_info( false ); -} - -blargg_err_t Zip_Extractor::next_() -{ - return update_info( true ); -} - -// Reading - -void Zip_Extractor::clear_file_() -{ - remain_ = 0; - buf.end(); -} - -blargg_err_t Zip_Extractor::inflater_read( void* data, void* out, long* count ) -{ - Zip_Extractor& self = *(Zip_Extractor*) data; - if ( *count > self.raw_remain ) - { - *count = self.raw_remain; - if ( !*count ) - return 0; - } - self.raw_remain -= *count; - return self.file().read( out, *count ); -} - -long Zip_Extractor::remain() const { return remain_; } - -blargg_err_t Zip_Extractor::fill_buf( long offset, long buf_size, long initial_read ) -{ - raw_remain = file_size - offset; - RETURN_ERR( file().seek( offset ) ); - return buf.begin( inflater_read, this, buf_size, initial_read ); -} - -blargg_err_t Zip_Extractor::first_read( long count ) -{ - entry_t const& e = (entry_t&) catalog [catalog_pos]; - - method = get_le16( e.method ); - if ( (method && method != Z_DEFLATED) || get_le16( e.vers ) > 20 ) - return "Unsupported zip file compression"; - - long raw_size = get_le32( e.raw_size ); - - long file_offset = get_le32( e.file_offset ); - int align = file_offset & (disk_block_size - 1); - { - // read header - long buf_size = 3 * disk_block_size - 1 + raw_size; // space for all raw data - buf_size &= ~(disk_block_size - 1); - long initial_read = buf_size; - if ( !method || count < size() ) - { - buf_size = read_buf_size; - initial_read = disk_block_size * 2; - } - RETURN_ERR( fill_buf( file_offset - align, buf_size, initial_read ) ); - } - header_t const& h = (header_t&) buf.data() [align]; - if ( buf.filled() < align + header_size || memcmp( h.type, "PK\3\4", 4 ) ) - return buf.corrupt_error; - - // crc - correct_crc = get_le32( h.crc ); - if ( !correct_crc ) - correct_crc = get_le32( e.crc ); - check( correct_crc == get_le32( e.crc ) ); // catalog CRC should match - crc = crc32( 0, 0, 0 ); - - // data offset - long data_offset = file_offset + header_size + - get_le16( h.filename_len ) + get_le16( h.extra_len ); - if ( data_offset + raw_size > catalog_begin ) - return buf.corrupt_error; - - // refill buffer if there's lots of extra data after header - long buf_offset = data_offset - file_offset + align; - if ( buf_offset > buf.filled() ) - { - // TODO: this will almost never occur, making it a good place for bugs - buf_offset = data_offset % disk_block_size; - RETURN_ERR( fill_buf( data_offset - buf_offset, read_buf_size, disk_block_size ) ); - } - - raw_remain = raw_size - (buf.filled() - buf_offset); - return buf.set_mode( (method ? buf.mode_raw_deflate : buf.mode_copy), buf_offset ); -} - -blargg_err_t Zip_Extractor::read( void* out, long count ) -{ - if ( count > remain_ ) - return eof_error; - - if ( count ) - { - if ( remain_ == size() ) - RETURN_ERR( first_read( count ) ); - - long actual = count; - RETURN_ERR( buf.read( out, &actual ) ); - if ( actual < count ) - return buf.corrupt_error; - - crc = crc32( crc, (byte const*) out, count ); - remain_ -= count; - if ( !remain_ && crc != correct_crc ) - return buf.corrupt_error; - } - return 0; -} - -blargg_err_t Zip_Extractor::read_once( void* out, long count ) -{ - require( remain_ == size() ); - return read( out, count ); -} diff --git a/dependencies/File_Extractor-0.4.3/fex/Zip_Extractor.h b/dependencies/File_Extractor-0.4.3/fex/Zip_Extractor.h deleted file mode 100644 index 44b321f4..00000000 --- a/dependencies/File_Extractor-0.4.3/fex/Zip_Extractor.h +++ /dev/null @@ -1,42 +0,0 @@ -// ZIP archive extractor. Only supports deflation and store (no compression). - -// File_Extractor 0.4.3 -#ifndef ZIP_EXTRACTOR_H -#define ZIP_EXTRACTOR_H - -#include "File_Extractor.h" -#include "Zlib_Inflater.h" - -class Zip_Extractor : public File_Extractor { -public: - Zip_Extractor(); - ~Zip_Extractor(); - blargg_err_t read( void*, long ); - blargg_err_t read_once( void*, long ); - long remain() const; -protected: - void open_filter_( const char*, Std_File_Reader* ); - blargg_err_t open_(); - blargg_err_t next_(); - blargg_err_t rewind_(); - void clear_file_(); - void close_(); -private: - blargg_vector catalog; - long file_size; - long catalog_begin; // offset of first catalog entry in file (to detect corruption) - long catalog_pos; // position in catalog data - long raw_remain; // bytes remaining in raw data for current file - long remain_; // byres remaining to be extracted - unsigned long crc; - unsigned long correct_crc; - int method; - Zlib_Inflater buf; - - blargg_err_t fill_buf( long offset, long buf_size, long initial_read ); - blargg_err_t update_info( bool advance_first ); - blargg_err_t first_read( long count ); - static blargg_err_t inflater_read( void* data, void* out, long* count ); -}; - -#endif diff --git a/dependencies/File_Extractor-0.4.3/fex/Zlib_Inflater.cpp b/dependencies/File_Extractor-0.4.3/fex/Zlib_Inflater.cpp deleted file mode 100644 index 98f4ec2b..00000000 --- a/dependencies/File_Extractor-0.4.3/fex/Zlib_Inflater.cpp +++ /dev/null @@ -1,215 +0,0 @@ -// File_Extractor 0.4.3. http://www.slack.net/~ant/ - -#include "Zlib_Inflater.h" - -#include -#include - -/* Copyright (C) 2006-2007 Shay Green. This module is free software; you -can redistribute it and/or modify it under the terms of the GNU Lesser -General Public License as published by the Free Software Foundation; either -version 2.1 of the License, or (at your option) any later version. This -module is distributed in the hope that it will be useful, but WITHOUT ANY -WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS -FOR A PARTICULAR PURPOSE. See the GNU Lesser General Public License for more -details. You should have received a copy of the GNU Lesser General Public -License along with this module; if not, write to the Free Software Foundation, -Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA */ - -#include "blargg_source.h" - -long const block_size = 4096; - -const char Zlib_Inflater::corrupt_error [] = "Corrupt zip file"; - -static const char* get_zlib_err( int code ) -{ - assert( code != Z_OK ); - if ( code == Z_MEM_ERROR ) - return "Out of memory"; - - const char* str = zError( code ); - if ( code == Z_DATA_ERROR ) - str = Zlib_Inflater::corrupt_error; - if ( !str ) - str = "Zip error"; - return str; -} - -void Zlib_Inflater::end() -{ - if ( deflated_ ) - { - deflated_ = false; - if ( inflateEnd( &zbuf ) ) - check( false ); - } - buf.clear(); - - static z_stream const empty = { 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }; - memcpy( &zbuf, &empty, sizeof zbuf ); -} - -Zlib_Inflater::Zlib_Inflater() -{ - deflated_ = false; - end(); // initialize things -} - -Zlib_Inflater::~Zlib_Inflater() -{ - end(); -} - -blargg_err_t Zlib_Inflater::fill_buf( long count ) -{ - byte* out = buf.end() - count; - RETURN_ERR( callback( user_data, out, &count ) ); - zbuf.avail_in = count; - zbuf.next_in = out; - return 0; -} - -blargg_err_t Zlib_Inflater::begin( callback_t new_callback, void* new_user_data, - long new_buf_size, long initial_read ) -{ - callback = new_callback; - user_data = new_user_data; - - end(); - - if ( !new_buf_size || (new_buf_size && buf.resize( new_buf_size )) ) - { - RETURN_ERR( buf.resize( 4 * block_size ) ); - initial_read = 0; - } - - // Fill buffer with some data, less than normal buffer size since caller might - // just be examining beginning of file. - return fill_buf( initial_read ? initial_read : block_size ); -} - -blargg_err_t Zlib_Inflater::set_mode( mode_t mode, long data_offset ) -{ - zbuf.next_in += data_offset; - zbuf.avail_in -= data_offset; - - if ( mode == mode_auto ) - { - // examine buffer for gzip header - mode = mode_copy; - unsigned const min_gzip_size = 2 + 8 + 8; - if ( zbuf.avail_in >= min_gzip_size && - zbuf.next_in [0] == 0x1F && zbuf.next_in [1] == 0x8B ) - mode = mode_ungz; - } - - if ( mode != mode_copy ) - { - int wb = MAX_WBITS + 16; // have zlib handle gzip header - if ( mode == mode_raw_deflate ) - wb = -MAX_WBITS; - - int zerr = inflateInit2( &zbuf, wb ); - if ( zerr ) - { - zbuf.next_in = 0; - return get_zlib_err( zerr ); - } - - deflated_ = true; - } - return 0; -} - -blargg_err_t Zlib_Inflater::read( void* out, long* count_io ) -{ - long remain = *count_io; - if ( remain && zbuf.next_in ) - { - if ( deflated_ ) - { - zbuf.next_out = (Bytef*) out; - zbuf.avail_out = remain; - while ( 1 ) - { - uInt old_avail_in = zbuf.avail_in; - int err = inflate( &zbuf, Z_NO_FLUSH ); - if ( err == Z_STREAM_END ) - { - remain = zbuf.avail_out; - end(); - break; // no more data to inflate - } - - if ( err && (err != Z_BUF_ERROR || old_avail_in) ) - return get_zlib_err( err ); - - if ( !zbuf.avail_out ) - { - remain = 0; - break; // requested number of bytes inflate - } - - if ( zbuf.avail_in ) - { - // inflate() should never leave input if there's still space for output - assert( false ); - return corrupt_error; - } - - RETURN_ERR( fill_buf( buf.size() ) ); - if ( !zbuf.avail_in ) - return corrupt_error; // stream didn't end but there's no more data - } - } - else - { - while ( 1 ) - { - // copy buffered data - if ( zbuf.avail_in ) - { - long count = zbuf.avail_in; - if ( count > remain ) - count = remain; - memcpy( out, zbuf.next_in, count ); - zbuf.total_out += count; - out = (char*) out + count; - remain -= count; - zbuf.next_in += count; - zbuf.avail_in -= count; - } - - if ( !zbuf.avail_in && zbuf.next_in < buf.end() ) - { - end(); - break; - } - - // read large request directly - if ( remain + zbuf.total_out % block_size >= buf.size() ) - { - long count = remain; - RETURN_ERR( callback( user_data, out, &count ) ); - zbuf.total_out += count; - out = (char*) out + count; - remain -= count; - - if ( remain ) - { - end(); - break; - } - } - - if ( !remain ) - break; - - RETURN_ERR( fill_buf( buf.size() - zbuf.total_out % block_size ) ); - } - } - } - *count_io -= remain; - return 0; -} diff --git a/dependencies/File_Extractor-0.4.3/fex/Zlib_Inflater.h b/dependencies/File_Extractor-0.4.3/fex/Zlib_Inflater.h deleted file mode 100644 index b32aefec..00000000 --- a/dependencies/File_Extractor-0.4.3/fex/Zlib_Inflater.h +++ /dev/null @@ -1,68 +0,0 @@ -// Simplifies use of zlib for inflating data - -// File_Extractor 0.4.3 -#ifndef ZLIB_INFLATER_H -#define ZLIB_INFLATER_H - -#include "blargg_common.h" -#include "zlib.h" - -class Zlib_Inflater { -public: - - static const char corrupt_error []; - - // Data reader callback - typedef blargg_err_t (*callback_t)( void* user_data, void* out, long* count ); - - // Begins by setting callback and filling buffer. Default buffer is 16K and - // filled to 4K, or specify buf_size and initial_read for custom buffer size - // and how much to read initially. - blargg_err_t begin( callback_t, void* user_data, - long buf_size = 0, long initial_read = 0 ); - - // Data read into buffer by begin() - unsigned char const* data() const { return zbuf.next_in; } - long filled() const { return zbuf.avail_in; } - - // Begins inflation using specified mode. Using mode_auto selects between - // mode_copy and mode_ungz by examining first two bytes of buffer. Use - // buf_offset to specify where data begins in buffer, in case there is - // header data that should be skipped. - enum mode_t { mode_copy, mode_ungz, mode_raw_deflate, mode_auto }; - blargg_err_t set_mode( mode_t, long buf_offset = 0 ); - - // True if set_mode() has been called with mode_ungz or mode_raw_deflate - bool deflated() const { return deflated_; } - - // Reads/inflates at most *count_io bytes into *out and sets *count_io to actual - // number of bytes read (less than requested if end of data was reached). - // Buffers source data internally, even in copy mode. - blargg_err_t read( void* out, long* count_io ); - - // Total number of bytes read since begin() - long tell() const { return zbuf.total_out; } - - // Ends inflation and frees memory - void end(); - -private: - // noncopyable - Zlib_Inflater( const Zlib_Inflater& ); - Zlib_Inflater& operator = ( const Zlib_Inflater& ); - -public: - Zlib_Inflater(); - ~Zlib_Inflater(); -private: - z_stream_s zbuf; - blargg_vector buf; - bool deflated_; - callback_t callback; - void* user_data; - - blargg_err_t inflate_(); - blargg_err_t fill_buf( long count ); -}; - -#endif diff --git a/dependencies/File_Extractor-0.4.3/fex/abstract_file.cpp b/dependencies/File_Extractor-0.4.3/fex/abstract_file.cpp deleted file mode 100644 index 3d68690c..00000000 --- a/dependencies/File_Extractor-0.4.3/fex/abstract_file.cpp +++ /dev/null @@ -1,155 +0,0 @@ -// File_Extractor 0.4.3. http://www.slack.net/~ant/ - -#include "abstract_file.h" - -#include -#include - -/* Copyright (C) 2005-2007 Shay Green. This module is free software; you -can redistribute it and/or modify it under the terms of the GNU Lesser -General Public License as published by the Free Software Foundation; either -version 2.1 of the License, or (at your option) any later version. This -module is distributed in the hope that it will be useful, but WITHOUT ANY -WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS -FOR A PARTICULAR PURPOSE. See the GNU Lesser General Public License for more -details. You should have received a copy of the GNU Lesser General Public -License along with this module; if not, write to the Free Software Foundation, -Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA */ - -#include "blargg_source.h" - -Data_Writer::~Data_Writer() { } - -// Std_File_Writer - -Std_File_Writer::Std_File_Writer() : file_( 0 ) { } - -Std_File_Writer::~Std_File_Writer() { close(); } - -blargg_err_t Std_File_Writer::open( const char* path ) -{ - file_ = fopen( path, "wb" ); - if ( !file_ ) - return "Couldn't open file for writing"; - - // TODO: increase file buffer size? - //setvbuf( file_, 0, _IOFBF, 32 * 1024L ); - - return 0; -} - -blargg_err_t Std_File_Writer::write( const void* p, long s ) -{ - long result = fwrite( p, 1, s, (FILE*) file_ ); - if ( result != s ) - return "Couldn't write to file"; - return 0; -} - -void Std_File_Writer::close() -{ - if ( file_ ) - { - fclose( (FILE*) file_ ); - file_ = 0; - } -} - -// Mem_Writer - -Mem_Writer::Mem_Writer( void* p, long s, int b ) -{ - data_ = (char*) p; - size_ = 0; - allocated = s; - mode = b ? ignore_excess : fixed; -} - -Mem_Writer::Mem_Writer() -{ - data_ = 0; - size_ = 0; - allocated = 0; - mode = expanding; -} - -Mem_Writer::~Mem_Writer() -{ - if ( mode == expanding ) - free( data_ ); -} - -blargg_err_t Mem_Writer::write( const void* p, long s ) -{ - long remain = allocated - size_; - if ( s > remain ) - { - if ( mode == fixed ) - return "Tried to write more data than expected"; - - if ( mode == ignore_excess ) - { - s = remain; - } - else // expanding - { - long new_allocated = size_ + s; - new_allocated += (new_allocated >> 1) + 2048; - - void* p = realloc( data_, new_allocated ); - if ( !p ) - return "Out of memory"; - - data_ = (char*) p; - allocated = new_allocated; - } - } - - assert( size_ + s <= allocated ); - memcpy( data_ + size_, p, s ); - size_ += s; - - return 0; -} - -// Null_Writer - -blargg_err_t Null_Writer::write( const void*, long ) { return 0; } - -// Gzip_File_Writer - -#ifdef HAVE_ZLIB_H -#include "zlib.h" - -Gzip_File_Writer::Gzip_File_Writer() : file_( 0 ) { } - -Gzip_File_Writer::~Gzip_File_Writer() { close(); } - -blargg_err_t Gzip_File_Writer::open( const char* path, int level ) -{ - close(); - char mode [4] = "wb\0"; - if ( (unsigned) level <= 9 ) - mode [2] = '0' + level; - file_ = gzopen( path, mode ); - if ( !file_ ) - return "Couldn't open file for writing"; - return 0; -} - -blargg_err_t Gzip_File_Writer::write( const void* p, long s ) -{ - if ( s != gzwrite( file_ , (void*) p, s ) ) - return "Couldn't write to file"; - return 0; -} - -void Gzip_File_Writer::close() -{ - if ( file_ ) - { - gzclose( file_ ); - file_ = 0; - } -} -#endif diff --git a/dependencies/File_Extractor-0.4.3/fex/abstract_file.h b/dependencies/File_Extractor-0.4.3/fex/abstract_file.h deleted file mode 100644 index 525ae941..00000000 --- a/dependencies/File_Extractor-0.4.3/fex/abstract_file.h +++ /dev/null @@ -1,91 +0,0 @@ -// Lightweight interfaces for reading and writing data - -// File_Extractor 0.4.3 -#ifndef ABSTRACT_FILE_H -#define ABSTRACT_FILE_H - -#include "blargg_common.h" -#include "Data_Reader.h" - -// Supports writing -class Data_Writer { -public: - Data_Writer() { } - virtual ~Data_Writer(); - - // Writes 'n' bytes. Returns error if they couldn't all be written. - virtual blargg_err_t write( void const*, long n ) BLARGG_PURE( { (void) n; return 0; } ) - -public: - typedef blargg_err_t error_t; // deprecated - BLARGG_DISABLE_NOTHROW -private: - // noncopyable - Data_Writer( const Data_Writer& ); - Data_Writer& operator = ( const Data_Writer& ); -}; - -// Disk file -class Std_File_Writer : public Data_Writer { -public: - blargg_err_t open( const char* path ); - void close(); - -public: - Std_File_Writer(); - ~Std_File_Writer(); - blargg_err_t write( void const*, long ); -private: - void* file_; -}; - -// Writes data to memory -class Mem_Writer : public Data_Writer { -public: - // Keeps all written data in expanding block of memory - Mem_Writer(); - - // Writes to fixed-size block of memory. If ignore_excess is false, returns - // error if more than 'size' data is written, otherwise ignores any excess. - Mem_Writer( void*, long size, int ignore_excess = 0 ); - - // Pointer to beginning of written data - char* data() { return data_; } - - // Number of bytes written - long size() const { return size_; } - -public: - ~Mem_Writer(); - blargg_err_t write( void const*, long ); -private: - char* data_; - long size_; - long allocated; - enum { expanding, fixed, ignore_excess } mode; -}; - -// Written data is ignored -class Null_Writer : public Data_Writer { -public: - blargg_err_t write( void const*, long ); -}; - -// Gzip compressor -#ifdef HAVE_ZLIB_H -class Gzip_File_Writer : public Data_Writer { -public: - // Compression level varies from 0 (min, fast) to 9 (max, slow). -1 = default. - blargg_err_t open( const char* path, int compression_level = -1 ); - void close(); - -public: - Gzip_File_Writer(); - ~Gzip_File_Writer(); - blargg_err_t write( const void*, long ); -private: - void* file_; -}; -#endif - -#endif diff --git a/dependencies/File_Extractor-0.4.3/fex/blargg_common.h b/dependencies/File_Extractor-0.4.3/fex/blargg_common.h deleted file mode 100644 index 15771756..00000000 --- a/dependencies/File_Extractor-0.4.3/fex/blargg_common.h +++ /dev/null @@ -1,206 +0,0 @@ -// Sets up common environment for Shay Green's libraries. -// To change configuration options, modify blargg_config.h, not this file. - -// File_Extractor 0.4.3 -#ifndef BLARGG_COMMON_H -#define BLARGG_COMMON_H - -#include -#include -#include -#include - -#undef BLARGG_COMMON_H -// allow blargg_config.h to #include blargg_common.h -#include "blargg_config.h" -#ifndef BLARGG_COMMON_H -#define BLARGG_COMMON_H - -// BLARGG_RESTRICT: equivalent to restrict, where supported -#if __GNUC__ >= 3 || _MSC_VER >= 1100 - #define BLARGG_RESTRICT __restrict -#else - #define BLARGG_RESTRICT -#endif - -// STATIC_CAST(T,expr): Used in place of static_cast (expr) -// CONST_CAST( T,expr): Used in place of const_cast (expr) -#ifndef STATIC_CAST - #if __GNUC__ >= 4 - #define STATIC_CAST(T,expr) static_cast (expr) - #define CONST_CAST( T,expr) const_cast (expr) - #else - #define STATIC_CAST(T,expr) ((T) (expr)) - #define CONST_CAST( T,expr) ((T) (expr)) - #endif -#endif - -// blargg_err_t (0 on success, otherwise error string) -#ifndef blargg_err_t - typedef const char* blargg_err_t; -#endif - -// blargg_vector - very lightweight vector of POD types (no constructor/destructor) -template -class blargg_vector { - T* begin_; - size_t size_; -public: - blargg_vector() : begin_( 0 ), size_( 0 ) { } - ~blargg_vector() { free( begin_ ); } - size_t size() const { return size_; } - T* begin() const { return begin_; } - T* end() const { return begin_ + size_; } - blargg_err_t resize( size_t n ) - { - // TODO: blargg_common.cpp to hold this as an outline function, ugh - void* p = realloc( begin_, n * sizeof (T) ); - if ( p ) - begin_ = (T*) p; - else if ( n > size_ ) // realloc failure only a problem if expanding - return "Out of memory"; - size_ = n; - return 0; - } - void clear() { void* p = begin_; begin_ = 0; size_ = 0; free( p ); } - T& operator [] ( size_t n ) const - { - assert( n <= size_ ); // <= to allow past-the-end value - return begin_ [n]; - } -}; - -#ifndef BLARGG_DISABLE_NOTHROW - // throw spec mandatory in ISO C++ if operator new can return NULL - #if __cplusplus >= 199711 || __GNUC__ >= 3 - #define BLARGG_THROWS( spec ) throw spec - #else - #define BLARGG_THROWS( spec ) - #endif - #define BLARGG_DISABLE_NOTHROW \ - void* operator new ( size_t s ) BLARGG_THROWS(()) { return malloc( s ); }\ - void operator delete ( void* p ) { free( p ); } - #define BLARGG_NEW new -#else - #include - #define BLARGG_NEW new (std::nothrow) -#endif - -// BLARGG_4CHAR('a','b','c','d') = 'abcd' (four character integer constant) -#define BLARGG_4CHAR( a, b, c, d ) \ - ((a&0xFF)*0x1000000 + (b&0xFF)*0x10000 + (c&0xFF)*0x100 + (d&0xFF)) - -// BOOST_STATIC_ASSERT( expr ): Generates compile error if expr is 0. -#ifndef BOOST_STATIC_ASSERT - #ifdef _MSC_VER - // MSVC6 (_MSC_VER < 1300) fails for use of __LINE__ when /Zl is specified - #define BOOST_STATIC_ASSERT( expr ) \ - void blargg_failed_( int (*arg) [2 / (int) !!(expr) - 1] ) - #else - // Some other compilers fail when declaring same function multiple times in class, - // so differentiate them by line - #define BOOST_STATIC_ASSERT( expr ) \ - void blargg_failed_( int (*arg) [2 / !!(expr) - 1] [__LINE__] ) - #endif -#endif - -// BLARGG_COMPILER_HAS_BOOL: If 0, provides bool support for old compiler. If 1, -// compiler is assumed to support bool. If undefined, availability is determined. -#ifndef BLARGG_COMPILER_HAS_BOOL - #if defined (__MWERKS__) - #if !__option(bool) - #define BLARGG_COMPILER_HAS_BOOL 0 - #endif - #elif defined (_MSC_VER) - #if _MSC_VER < 1100 - #define BLARGG_COMPILER_HAS_BOOL 0 - #endif - #elif defined (__GNUC__) - // supports bool - #elif __cplusplus < 199711 - #define BLARGG_COMPILER_HAS_BOOL 0 - #endif -#endif -#if defined (BLARGG_COMPILER_HAS_BOOL) && !BLARGG_COMPILER_HAS_BOOL - // If you get errors here, modify your blargg_config.h file - typedef int bool; - const bool true = 1; - const bool false = 0; -#endif - -// blargg_long/blargg_ulong = at least 32 bits, int if it's big enough - -#if INT_MAX < 0x7FFFFFFF || LONG_MAX == 0x7FFFFFFF - typedef long blargg_long; -#else - typedef int blargg_long; -#endif - -#if UINT_MAX < 0xFFFFFFFF || ULONG_MAX == 0xFFFFFFFF - typedef unsigned long blargg_ulong; -#else - typedef unsigned blargg_ulong; -#endif - -// BOOST::int8_t etc. - -// HAVE_STDINT_H: If defined, use for int8_t etc. -#if defined (HAVE_STDINT_H) - #include - #define BOOST - -// HAVE_INTTYPES_H: If defined, use for int8_t etc. -#elif defined (HAVE_INTTYPES_H) - #include - #define BOOST - -#else - struct BOOST - { - #if UCHAR_MAX == 0xFF && SCHAR_MAX == 0x7F - typedef signed char int8_t; - typedef unsigned char uint8_t; - #else - // No suitable 8-bit type available - typedef struct see_blargg_common_h int8_t; - typedef struct see_blargg_common_h uint8_t; - #endif - - #if USHRT_MAX == 0xFFFF - typedef short int16_t; - typedef unsigned short uint16_t; - #else - // No suitable 16-bit type available - typedef struct see_blargg_common_h int16_t; - typedef struct see_blargg_common_h uint16_t; - #endif - - #if ULONG_MAX == 0xFFFFFFFF - typedef long int32_t; - typedef unsigned long uint32_t; - #elif UINT_MAX == 0xFFFFFFFF - typedef int int32_t; - typedef unsigned int uint32_t; - #else - // No suitable 32-bit type available - typedef struct see_blargg_common_h int32_t; - typedef struct see_blargg_common_h uint32_t; - #endif - }; -#endif - -#if __GNUC__ >= 3 - #define BLARGG_DEPRECATED __attribute__ ((deprecated)) -#else - #define BLARGG_DEPRECATED -#endif - -// Use in place of "= 0;" for a pure virtual, since these cause calls to std C++ lib. -// During development, BLARGG_PURE( x ) expands to = 0; -// virtual int func() BLARGG_PURE( { return 0; } ) -#ifndef BLARGG_PURE - #define BLARGG_PURE( def ) def -#endif - -#endif -#endif diff --git a/dependencies/File_Extractor-0.4.3/fex/blargg_config.h b/dependencies/File_Extractor-0.4.3/fex/blargg_config.h deleted file mode 100644 index d5db4a65..00000000 --- a/dependencies/File_Extractor-0.4.3/fex/blargg_config.h +++ /dev/null @@ -1,23 +0,0 @@ -// Library configuration. Modify this file as necessary. - -// File_Extractor 0.4.3 -#ifndef BLARGG_CONFIG_H -#define BLARGG_CONFIG_H - -// Uncomment to enable RAR archive support. Doing so adds extra licensing restrictions -// to this library (see unrar/readme.txt for more information). -//#define FEX_ENABLE_RAR 1 - -// Uncomment and edit to support only the listed archive types. See fex_type_list.cpp -// for a list of all types. -//#define FEX_TYPE_LIST fex_7z_type,fex_gz_type,fex_rar_type,fex_zip_type,fex_bin_type - -// Uncomment if you get errors in the bool section of blargg_common.h -//#define BLARGG_COMPILER_HAS_BOOL 1 - -// Use standard config.h if present -#ifdef HAVE_CONFIG_H - #include "config.h" -#endif - -#endif diff --git a/dependencies/File_Extractor-0.4.3/fex/blargg_endian.h b/dependencies/File_Extractor-0.4.3/fex/blargg_endian.h deleted file mode 100644 index 62ff977b..00000000 --- a/dependencies/File_Extractor-0.4.3/fex/blargg_endian.h +++ /dev/null @@ -1,185 +0,0 @@ -// CPU Byte Order Utilities - -// File_Extractor 0.4.3 -#ifndef BLARGG_ENDIAN -#define BLARGG_ENDIAN - -#include "blargg_common.h" - -// BLARGG_CPU_CISC: Defined if CPU has very few general-purpose registers (< 16) -#if defined (__i386__) || defined (__x86_64__) || defined (_M_IX86) || defined (_M_X64) - #define BLARGG_CPU_X86 1 - #define BLARGG_CPU_CISC 1 -#endif - -#if defined (__powerpc__) || defined (__ppc__) || defined (__ppc64__) || \ - defined (__POWERPC__) || defined (__powerc) - #define BLARGG_CPU_POWERPC 1 - #define BLARGG_CPU_RISC 1 -#endif - -// BLARGG_BIG_ENDIAN, BLARGG_LITTLE_ENDIAN: Determined automatically, otherwise only -// one may be #defined to 1. Only needed if something actually depends on byte order. -#if !defined (BLARGG_BIG_ENDIAN) && !defined (BLARGG_LITTLE_ENDIAN) -#ifdef __GLIBC__ - // GCC handles this for us - #include - #if __BYTE_ORDER == __LITTLE_ENDIAN - #define BLARGG_LITTLE_ENDIAN 1 - #elif __BYTE_ORDER == __BIG_ENDIAN - #define BLARGG_BIG_ENDIAN 1 - #endif -#else - -#if defined (LSB_FIRST) || defined (__LITTLE_ENDIAN__) || BLARGG_CPU_X86 || \ - (defined (LITTLE_ENDIAN) && LITTLE_ENDIAN+0 != 1234) - #define BLARGG_LITTLE_ENDIAN 1 -#endif - -#if defined (MSB_FIRST) || defined (__BIG_ENDIAN__) || defined (WORDS_BIGENDIAN) || \ - defined (__sparc__) || BLARGG_CPU_POWERPC || \ - (defined (BIG_ENDIAN) && BIG_ENDIAN+0 != 4321) - #define BLARGG_BIG_ENDIAN 1 -#elif !defined (__mips__) - // No endian specified; assume little-endian, since it's most common - #define BLARGG_LITTLE_ENDIAN 1 -#endif -#endif -#endif - -#if BLARGG_LITTLE_ENDIAN && BLARGG_BIG_ENDIAN - #undef BLARGG_LITTLE_ENDIAN - #undef BLARGG_BIG_ENDIAN -#endif - -inline void blargg_verify_byte_order() -{ - #ifndef NDEBUG - #if BLARGG_BIG_ENDIAN - volatile int i = 1; - assert( *(volatile char*) &i == 0 ); - #elif BLARGG_LITTLE_ENDIAN - volatile int i = 1; - assert( *(volatile char*) &i != 0 ); - #endif - #endif -} - -inline unsigned get_le16( void const* p ) -{ - return (unsigned) ((unsigned char const*) p) [1] << 8 | - (unsigned) ((unsigned char const*) p) [0]; -} - -inline unsigned get_be16( void const* p ) -{ - return (unsigned) ((unsigned char const*) p) [0] << 8 | - (unsigned) ((unsigned char const*) p) [1]; -} - -inline blargg_ulong get_le32( void const* p ) -{ - return (blargg_ulong) ((unsigned char const*) p) [3] << 24 | - (blargg_ulong) ((unsigned char const*) p) [2] << 16 | - (blargg_ulong) ((unsigned char const*) p) [1] << 8 | - (blargg_ulong) ((unsigned char const*) p) [0]; -} - -inline blargg_ulong get_be32( void const* p ) -{ - return (blargg_ulong) ((unsigned char const*) p) [0] << 24 | - (blargg_ulong) ((unsigned char const*) p) [1] << 16 | - (blargg_ulong) ((unsigned char const*) p) [2] << 8 | - (blargg_ulong) ((unsigned char const*) p) [3]; -} - -inline void set_le16( void* p, unsigned n ) -{ - ((unsigned char*) p) [1] = (unsigned char) (n >> 8); - ((unsigned char*) p) [0] = (unsigned char) n; -} - -inline void set_be16( void* p, unsigned n ) -{ - ((unsigned char*) p) [0] = (unsigned char) (n >> 8); - ((unsigned char*) p) [1] = (unsigned char) n; -} - -inline void set_le32( void* p, blargg_ulong n ) -{ - ((unsigned char*) p) [0] = (unsigned char) n; - ((unsigned char*) p) [1] = (unsigned char) (n >> 8); - ((unsigned char*) p) [2] = (unsigned char) (n >> 16); - ((unsigned char*) p) [3] = (unsigned char) (n >> 24); -} - -inline void set_be32( void* p, blargg_ulong n ) -{ - ((unsigned char*) p) [3] = (unsigned char) n; - ((unsigned char*) p) [2] = (unsigned char) (n >> 8); - ((unsigned char*) p) [1] = (unsigned char) (n >> 16); - ((unsigned char*) p) [0] = (unsigned char) (n >> 24); -} - -#if BLARGG_NONPORTABLE - // Optimized implementation if byte order is known - #if BLARGG_LITTLE_ENDIAN - #define GET_LE16( addr ) (*(BOOST::uint16_t*) (addr)) - #define GET_LE32( addr ) (*(BOOST::uint32_t*) (addr)) - #define SET_LE16( addr, data ) (void) (*(BOOST::uint16_t*) (addr) = (data)) - #define SET_LE32( addr, data ) (void) (*(BOOST::uint32_t*) (addr) = (data)) - #elif BLARGG_BIG_ENDIAN - #define GET_BE16( addr ) (*(BOOST::uint16_t*) (addr)) - #define GET_BE32( addr ) (*(BOOST::uint32_t*) (addr)) - #define SET_BE16( addr, data ) (void) (*(BOOST::uint16_t*) (addr) = (data)) - #define SET_BE32( addr, data ) (void) (*(BOOST::uint32_t*) (addr) = (data)) - - #if BLARGG_CPU_POWERPC - // PowerPC has special byte-reversed instructions - #if defined (__MWERKS__) - #define GET_LE16( addr ) (__lhbrx( addr, 0 )) - #define GET_LE32( addr ) (__lwbrx( addr, 0 )) - #define SET_LE16( addr, in ) (__sthbrx( in, addr, 0 )) - #define SET_LE32( addr, in ) (__stwbrx( in, addr, 0 )) - #elif defined (__GNUC__) - #define GET_LE16( addr ) ({unsigned short ppc_lhbrx_; __asm__ volatile( "lhbrx %0,0,%1" : "=r" (ppc_lhbrx_) : "r" (addr) : "memory" ); ppc_lhbrx_;}) - #define GET_LE32( addr ) ({unsigned short ppc_lwbrx_; __asm__ volatile( "lwbrx %0,0,%1" : "=r" (ppc_lwbrx_) : "r" (addr) : "memory" ); ppc_lwbrx_;}) - #define SET_LE16( addr, in ) ({__asm__ volatile( "sthbrx %0,0,%1" : : "r" (in), "r" (addr) : "memory" );}) - #define SET_LE32( addr, in ) ({__asm__ volatile( "stwbrx %0,0,%1" : : "r" (in), "r" (addr) : "memory" );}) - #endif - #endif - #endif -#endif - -#ifndef GET_LE16 - #define GET_LE16( addr ) get_le16( addr ) - #define SET_LE16( addr, data ) set_le16( addr, data ) -#endif - -#ifndef GET_LE32 - #define GET_LE32( addr ) get_le32( addr ) - #define SET_LE32( addr, data ) set_le32( addr, data ) -#endif - -#ifndef GET_BE16 - #define GET_BE16( addr ) get_be16( addr ) - #define SET_BE16( addr, data ) set_be16( addr, data ) -#endif - -#ifndef GET_BE32 - #define GET_BE32( addr ) get_be32( addr ) - #define SET_BE32( addr, data ) set_be32( addr, data ) -#endif - -// auto-selecting versions - -inline void set_le( BOOST::uint16_t* p, unsigned n ) { SET_LE16( p, n ); } -inline void set_le( BOOST::uint32_t* p, blargg_ulong n ) { SET_LE32( p, n ); } -inline void set_be( BOOST::uint16_t* p, unsigned n ) { SET_BE16( p, n ); } -inline void set_be( BOOST::uint32_t* p, blargg_ulong n ) { SET_BE32( p, n ); } -inline unsigned get_le( BOOST::uint16_t* p ) { return GET_LE16( p ); } -inline blargg_ulong get_le( BOOST::uint32_t* p ) { return GET_LE32( p ); } -inline unsigned get_be( BOOST::uint16_t* p ) { return GET_BE16( p ); } -inline blargg_ulong get_be( BOOST::uint32_t* p ) { return GET_BE32( p ); } - -#endif diff --git a/dependencies/File_Extractor-0.4.3/fex/blargg_source.h b/dependencies/File_Extractor-0.4.3/fex/blargg_source.h deleted file mode 100644 index 02e31954..00000000 --- a/dependencies/File_Extractor-0.4.3/fex/blargg_source.h +++ /dev/null @@ -1,92 +0,0 @@ -/* Included at the beginning of library source files, AFTER all other #include lines. -Sets up helpful macros and services used in my source code. Since this is only "active" -in my source code, I don't have to worry about polluting the global namespace with -unprefixed names. */ - -// File_Extractor 0.4.3 -#ifndef BLARGG_SOURCE_H -#define BLARGG_SOURCE_H - -// The following four macros are for debugging only. Some or all might be defined -// to do nothing, depending on the circumstances. Described is what happens when -// a particular macro is defined to do something. When defined to do nothing, the -// macros do NOT evaluate their argument(s). - -// If expr is false, prints file and line number, then aborts program. Meant for -// checking internal state and consistency. A failed assertion indicates a bug -// in MY code. -// -// void assert( bool expr ); -#include - -// If expr is false, prints file and line number, then aborts program. Meant for -// checking caller-supplied parameters and operations that are outside the control -// of the module. A failed requirement probably indicates a bug in YOUR code. -// -// void require( bool expr ); -#undef require -#define require( expr ) assert( expr ) - -// Like printf() except output goes to debugging console/file. -// -// void dprintf( const char* format, ... ); -static inline void blargg_dprintf_( const char*, ... ) { } -#undef dprintf -#define dprintf (1) ? (void) 0 : blargg_dprintf_ - -// If expr is false, prints file and line number to debug console/log, then -// continues execution normally. Meant for flagging potential problems or things -// that should be looked into, but that aren't serious problems. -// -// void check( bool expr ); -#undef check -#define check( expr ) ((void) 0) - -// If expr yields non-NULL error string, returns it from current function, -// otherwise continues normally. -#undef RETURN_ERR -#define RETURN_ERR( expr ) do { \ - blargg_err_t blargg_return_err_ = (expr); \ - if ( blargg_return_err_ ) return blargg_return_err_; \ - } while ( 0 ) - -// If ptr is NULL, returns "Out of memory" error string, otherwise continues normally. -#undef CHECK_ALLOC -#define CHECK_ALLOC( ptr ) do { if ( (ptr) == 0 ) return "Out of memory"; } while ( 0 ) - -// The usual min/max functions for built-in types. -// -// template T min( T x, T y ) { return x < y ? x : y; } -// template T max( T x, T y ) { return x > y ? x : y; } -#define BLARGG_DEF_MIN_MAX( type ) \ - static inline type blargg_min( type x, type y ) { if ( y < x ) x = y; return x; }\ - static inline type blargg_max( type x, type y ) { if ( x < y ) x = y; return x; } - -BLARGG_DEF_MIN_MAX( int ) -BLARGG_DEF_MIN_MAX( unsigned ) -BLARGG_DEF_MIN_MAX( long ) -BLARGG_DEF_MIN_MAX( unsigned long ) -BLARGG_DEF_MIN_MAX( float ) -BLARGG_DEF_MIN_MAX( double ) - -#undef min -#define min blargg_min - -#undef max -#define max blargg_max - -// typedef unsigned char byte; -typedef unsigned char blargg_byte; -#undef byte -#define byte blargg_byte - -// deprecated -#define BLARGG_CHECK_ALLOC CHECK_ALLOC -#define BLARGG_RETURN_ERR RETURN_ERR - -// BLARGG_SOURCE_BEGIN: If defined, #included, allowing redefition of dprintf and check -#ifdef BLARGG_SOURCE_BEGIN - #include BLARGG_SOURCE_BEGIN -#endif - -#endif diff --git a/dependencies/File_Extractor-0.4.3/fex/fex.cpp b/dependencies/File_Extractor-0.4.3/fex/fex.cpp deleted file mode 100644 index 5ff383b7..00000000 --- a/dependencies/File_Extractor-0.4.3/fex/fex.cpp +++ /dev/null @@ -1,188 +0,0 @@ -// File_Extractor 0.4.3. http://www.slack.net/~ant/ - -#include "fex.h" - -#include "File_Extractor.h" -#include "blargg_endian.h" -#include -#include - -/* Copyright (C) 2005-2007 Shay Green. This module is free software; you -can redistribute it and/or modify it under the terms of the GNU Lesser -General Public License as published by the Free Software Foundation; either -version 2.1 of the License, or (at your option) any later version. This -module is distributed in the hope that it will be useful, but WITHOUT ANY -WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS -FOR A PARTICULAR PURPOSE. See the GNU Lesser General Public License for more -details. You should have received a copy of the GNU Lesser General Public -License along with this module; if not, write to the Free Software Foundation, -Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA */ - -#include "blargg_source.h" - -#ifndef FEX_TYPE_LIST - -// Archive types supported by default. If you want to change this list, -// modify the copy in blargg_config.h, NOT this one. -#if FEX_ENABLE_RAR -#define FEX_TYPE_LIST \ - fex_7z_type, fex_gz_type, fex_zip_type, fex_bin_type -#else -#define FEX_TYPE_LIST \ - fex_7z_type, fex_gz_type, fex_zip_type, fex_bin_type -#endif - -#endif - -static fex_type_t const fex_type_list_ [] = { FEX_TYPE_LIST, 0 }; - -fex_type_t const* fex_type_list() { return fex_type_list_; } - -void fex_close( File_Extractor* fe ) { delete fe; } - -void* fex_user_data ( File_Extractor const* fe ) { return fe->user_data(); } -void fex_set_user_data ( File_Extractor* fe, void* new_user_data ) { fe->set_user_data( new_user_data ); } -void fex_set_user_cleanup ( File_Extractor* fe, fex_user_cleanup_t func ) { fe->set_user_cleanup( func ); } - -fex_type_t fex_type ( File_Extractor const* fe ) { return fe->type(); } -int fex_done ( File_Extractor const* fe ) { return fe->done(); } -const char* fex_name ( File_Extractor const* fe ) { return fe->name(); } -long fex_size ( File_Extractor const* fe ) { return fe->size(); } -unsigned long fex_dos_date ( File_Extractor const* fe ) { return fe->dos_date(); } -long fex_remain ( File_Extractor const* fe ) { return fe->remain(); } -fex_err_t fex_read ( File_Extractor* fe, void* out, long count ) { return fe->read( out, count ); } -long fex_read_avail ( File_Extractor* fe, void* out, long count ) { return fe->read_avail( out, count ); } -fex_err_t fex_read_once ( File_Extractor* fe, void* out, long count ) { return fe->read_once( out, count ); } -fex_err_t fex_next ( File_Extractor* fe ) { return fe->next(); } -fex_err_t fex_rewind ( File_Extractor* fe ) { return fe->rewind(); } -void fex_scan_only ( File_Extractor* fe ) { fe->scan_only(); } - -const unsigned char* fex_data( File_Extractor* fe, fex_err_t* err_out ) -{ - blargg_err_t berr; - const unsigned char* p = fe->data( &berr ); - if ( err_out ) - *err_out = berr; - return p; -} - -const char* fex_identify_header( void const* header ) -{ - unsigned long four = get_be32( header ); - switch ( four ) - { - case 0x52457E5E: - case 0x52617221: return "RAR"; - - case 0x377ABCAF: return "7Z"; - - case 0x504B0304: - case 0x504B0506: return "ZIP"; - - // TODO: also identify other archive types *not* supported? - // unsupported types, to avoid opening them in Single_File_Extractor - //case 0x53495421: return "SIT"; - } - - if ( (four >> 16) == 0x1F8B ) - return "GZ"; - - return ""; -} - -static void to_uppercase( const char* in, int len, char* out ) -{ - for ( int i = 0; i < len; i++ ) - { - if ( !(out [i] = toupper( in [i] )) ) - return; - } - *out = 0; // extension too long -} - -fex_type_t fex_identify_extension( const char* extension_ ) -{ - char const* end = strrchr( extension_, '.' ); - if ( end ) - extension_ = end + 1; - - char extension [6]; - to_uppercase( extension_, sizeof extension, extension ); - - fex_type_t result = 0; - for ( fex_type_t const* types = fex_type_list_; *types; types++ ) - { - if ( !*(*types)->extension ) - result = *types; // fex_bin_type, so use if nothing else matches - - if ( !strcmp( extension, (*types)->extension ) ) - return *types; - } - return result; -} - -static fex_err_t fex_identify_file_( const char* path, fex_type_t* type_out ) -{ - *type_out = fex_identify_extension( path ); - if ( !*type_out || !strrchr( path, '.' ) ) - { - *type_out = 0; - - FEX_FILE_READER in; - RETURN_ERR( in.open( path ) ); - - char header [4] = { 0 }; - if ( in.read_avail( header, sizeof header ) < 0 ) - return "Couldn't read file"; - - *type_out = fex_identify_extension( fex_identify_header( header ) ); - } - return 0; -} - -fex_type_t fex_identify_file( const char* path, fex_err_t* err_out ) -{ - fex_type_t type; - fex_err_t err = fex_identify_file_( path, &type ); - if ( err_out ) - *err_out = err; - return type; -} - -static fex_err_t fex_open_type_( fex_type_t type, const char* path, File_Extractor** fe_out ) -{ - *fe_out = 0; - if ( !type ) - return fex_wrong_file_type; - - File_Extractor* fe = type->new_fex(); - CHECK_ALLOC( fe ); - - fex_err_t err = fe->open( path ); - if ( err ) - { - delete fe; - return err; - } - - *fe_out = fe; - return 0; -} - -File_Extractor* fex_open_type( fex_type_t type, const char* path, fex_err_t* err_out ) -{ - File_Extractor* fe; - fex_err_t err = fex_open_type_( type, path, &fe ); - if ( err_out ) - *err_out = err; - return fe; -} - -File_Extractor* fex_open( const char* path, fex_err_t* err_out ) -{ - fex_type_t type = fex_identify_file( path, err_out ); - if ( !type ) - return 0; - - return fex_open_type( type, path, err_out ); -} diff --git a/dependencies/File_Extractor-0.4.3/fex/fex.h b/dependencies/File_Extractor-0.4.3/fex/fex.h deleted file mode 100644 index 1727f7b9..00000000 --- a/dependencies/File_Extractor-0.4.3/fex/fex.h +++ /dev/null @@ -1,140 +0,0 @@ -/* Compressed file archive C interface (also usable from C++) */ - -/* File_Extractor 0.4.3 */ -#ifndef FEX_H -#define FEX_H - -#ifdef __cplusplus - extern "C" { -#endif - -/* Error string returned by library functions, or NULL if no error (success). -If function takes fex_err_t* err_out, it sets *err_out to NULL on success, -otherwise error string, or you can pass NULL if you don't care about exact -cause of error (these functions still report error by returning NULL). */ -typedef const char* fex_err_t; - -/* First parameter of most extractor_ functions is a pointer to the -File_Extractor being acted on. */ -typedef struct File_Extractor File_Extractor; - - -/**** Basics ****/ - -/* Opens archive and returns pointer to it, or NULL if error. */ -File_Extractor* fex_open( const char* path, fex_err_t* err_out ); - -/* True if at end of archive. */ -int fex_done( File_Extractor const* ); - -/* Name of current file. */ -const char* fex_name( File_Extractor const* ); - -/* Size of current file. */ -long fex_size( File_Extractor const* ); - -/* Extracts n bytes and writes them to *out. Returns error if all n -bytes couldn't be extracted (due to end of file or read error). */ -fex_err_t fex_read( File_Extractor*, void* out, long n ); - -/* Goes to next file in archive (skips directories). */ -fex_err_t fex_next( File_Extractor* ); - -/* Closes archive and frees memory. */ -void fex_close( File_Extractor* ); - - -/**** Advanced ****/ - -/* Goes back to first file in archive. */ -fex_err_t fex_rewind( File_Extractor* ); - -/* Hints to fex_next() that no file extraction will occur, speeding scanning -of some archive types. */ -void fex_scan_only( File_Extractor* ); - -/* Modification date of current file (MS-DOS format). */ -unsigned long fex_dos_date( File_Extractor const* ); - -/* Number of bytes remaining to be read from current file. */ -long fex_remain( File_Extractor const* ); - -/* Reads at most n bytes and returns number actually read, or negative if error. */ -long fex_read_avail( File_Extractor*, void* out, long n ); - -/* Extracts first n bytes and ignores rest. Faster than a normal read since it -doesn't need to read any more data. Must not be called twice in a row. */ -fex_err_t fex_read_once( File_Extractor*, void* out, long n ); - -/* Loads file data into memory (if not already) and returns pointer to it, or -NULL if error. Pointer is valid until fex_next(), fex_rewind(), or fex_close() are -called. Will return same pointer if called more than once. */ -const unsigned char* fex_data( File_Extractor*, fex_err_t* err_out ); - - -/**** Archive types ****/ - -/* fex_type_t is a pointer to this structure. For example, fex_zip_type->extension is -"ZIP" and ex_zip_type->new_fex() is equilvant to 'new Zip_Extractor' (in C++). */ -struct fex_type_t_ -{ - const char* extension; /* file extension/type */ - File_Extractor* (*new_fex)(); -}; - -/* Archive type constants for each supported file type */ -extern struct fex_type_t_ const - fex_7z_type [1], /* .7z (7-zip) */ - fex_gz_type [1], /* .gz (gzip) */ - /*fex_rar_type [1],*/ /* .rar */ - fex_zip_type [1], /* .zip */ - fex_bin_type [1]; /* binary file, possibly gzipped */ -typedef struct fex_type_t_ const* fex_type_t; - -/* Array of supported archive types, with NULL entry at end. */ -fex_type_t const* fex_type_list(); - -/* Type of archive this extractor handles. */ -fex_type_t fex_type( File_Extractor const* ); - - -/******** Advanced opening ********/ - -/* Error returned if file is wrong type */ -extern const char fex_wrong_file_type [29]; - -/* Determines likely archive type based on first four bytes of file. Returns string -containing proper file suffix (i.e. "ZIP", "GZ", etc.) or "" (empty string) if file -header is not recognized. */ -const char* fex_identify_header( void const* header ); - -/* Gets corresponding archive type for file path or extension passed in. Returns NULL -if type isn't recognized. */ -fex_type_t fex_identify_extension( const char* path_or_extension ); - -/* Determines file type based on filename extension, or file header (if extension -isn't recognized). Returns NULL if unrecognized or error. */ -fex_type_t fex_identify_file( const char* path, fex_err_t* err_out ); - -/* Opens archive of specific type and returns pointer to it, or NULL if error. */ -File_Extractor* fex_open_type( fex_type_t, const char* path, fex_err_t* err_out ); - - -/******** User data ********/ - -/* Sets/gets pointer to data you want to associate with this extractor. -You can use this for whatever you want. */ -void fex_set_user_data( File_Extractor*, void* new_user_data ); -void* fex_user_data( File_Extractor const* ); - -/* Registers cleanup function to be called when closing extractor, or NULL to -clear it. Passes user_data (see above) to cleanup function. */ -typedef void (*fex_user_cleanup_t)( void* user_data ); -void fex_set_user_cleanup( File_Extractor*, fex_user_cleanup_t func ); - - -#ifdef __cplusplus - } -#endif - -#endif diff --git a/dependencies/File_Extractor-0.4.3/fex/unzip.cpp b/dependencies/File_Extractor-0.4.3/fex/unzip.cpp deleted file mode 100644 index 2ca3cf14..00000000 --- a/dependencies/File_Extractor-0.4.3/fex/unzip.cpp +++ /dev/null @@ -1,175 +0,0 @@ -// File_Extractor 0.4.3. http://www.slack.net/~ant/ - -#include "unzip.h" - -#include "File_Extractor.h" -#include -#include -#include - -/* Copyright (C) 2007 Shay Green. This module is free software; you -can redistribute it and/or modify it under the terms of the GNU Lesser -General Public License as published by the Free Software Foundation; either -version 2.1 of the License, or (at your option) any later version. This -module is distributed in the hope that it will be useful, but WITHOUT ANY -WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS -FOR A PARTICULAR PURPOSE. See the GNU Lesser General Public License for more -details. You should have received a copy of the GNU Lesser General Public -License along with this module; if not, write to the Free Software Foundation, -Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA */ - -#include "blargg_source.h" - -// log error message to stderr when debugging -inline unzError log_error( const char* str ) -{ - if ( !str ) - return UNZ_OK; - - #ifndef NDEBUG - fprintf( stderr, "unzip Error: %s\n", str ); - #endif - - return UNZ_INTERNALERROR; -} - -int unzStringFileNameCompare( const char* x, const char* y, int case_sensitive ) -{ - if ( !case_sensitive ) - { - case_sensitive = 1; - #if !defined (unix) - case_sensitive = 2; - #endif - } - - if ( case_sensitive == 1 ) - return strcmp( x, y ); - - int xx, yy; - do - { - xx = tolower( *x++ ); - yy = tolower( *y++ ); - } - while ( yy && xx == yy ); - return xx - yy; -} - -unzFile unzOpen( const char* path ) -{ - fex_err_t err; - File_Extractor* fex = fex_open( path, &err ); - if ( log_error( err ) ) - return 0; - fex->scan_only(); - return fex; -} - -unzError unzClose( unzFile fex ) -{ - delete fex; - return UNZ_OK; -} - -unzError unzGoToFirstFile( unzFile fex ) -{ - unzError err = log_error( fex->rewind() ); - if ( !err && fex->done() ) - err = UNZ_BADZIPFILE; // unzip interface can't handle an empty file - fex->scan_only(); - return err; -} - -unzError unzGoToNextFile( unzFile fex ) -{ - if ( fex->done() ) - return UNZ_END_OF_LIST_OF_FILE; - - unzError err = log_error( fex->next() ); - if ( !err && fex->done() ) - err = UNZ_END_OF_LIST_OF_FILE; - return err; -} - -unzError unzLocateFile( unzFile fex, const char* name, int case_sensitive ) -{ - unzError err = unzGoToFirstFile( fex ); - if ( !err ) - { - fex->scan_only( false ); // user is likely to extract file - do - { - if ( !unzStringFileNameCompare( fex->name(), name, case_sensitive ) ) - return UNZ_OK; - } - while ( (err = unzGoToNextFile( fex )) == 0 ); - } - return err; -} - -unzError unzGetCurrentFileInfo( unzFile fex, unz_file_info* info_out, - char* filename_out, uLong filename_size, - void* extra_out, uLong, char* comment_out, uLong ) -{ - // extra and comment aren't supported - assert( !extra_out && !comment_out ); - - memset( info_out, 0, sizeof *info_out ); - - if ( fex->done() ) - return UNZ_END_OF_LIST_OF_FILE; - - size_t name_len = strlen( fex->name() ); - if ( info_out ) - { - info_out->uncompressed_size = fex->size(); - info_out->size_filename = name_len; - info_out->dosDate = fex->dos_date(); - } - - if ( filename_out ) - { - if ( filename_size <= name_len ) - return UNZ_PARAMERROR; - strcpy( filename_out, fex->name() ); - } - - return UNZ_OK; -} - -unzError unzOpenCurrentFile( unzFile fex ) -{ - if ( fex->done() ) - return UNZ_END_OF_LIST_OF_FILE; - - // fails if you try to re-open file again (I can add support if necessary) - assert( fex->remain() == fex->size() ); - - // fex automatically opens on first read - return UNZ_OK; -} - -unzError unzReadCurrentFile( unzFile fex, void* out, unsigned count ) -{ - long actual = fex->read_avail( out, count ); - if ( actual < 0 ) - return UNZ_INTERNALERROR; - return (unzError) actual; -} - -z_off_t unztell( unzFile fex ) -{ - return fex->size() - fex->remain(); -} - -int unzeof( unzFile fex ) -{ - return !fex->remain(); -} - -unzError unzCloseCurrentFile( unzFile ) -{ - // fex automatically closes - return UNZ_OK; -} diff --git a/dependencies/File_Extractor-0.4.3/fex/unzip.h b/dependencies/File_Extractor-0.4.3/fex/unzip.h deleted file mode 100644 index 4cbb1859..00000000 --- a/dependencies/File_Extractor-0.4.3/fex/unzip.h +++ /dev/null @@ -1,109 +0,0 @@ -/* Accesses file archives using basic unzip 1.01e library interface functions. -With this you can use File_Extractor in place of the unzip library with minimal -changes to your code. If you're writing new code, use the fex.h interface. */ - -/* File_Extractor 0.4.3 */ -#ifndef _unz_H -#define _unz_H - -/* Your code can check for this to know to support other archive types */ -#define FEX_WRAPPER 1 - -#include "zlib.h" - -#ifdef __cplusplus - extern "C" { -#endif - -typedef int unzError; - -#define UNZ_OK 0 -#define UNZ_END_OF_LIST_OF_FILE -100 -#define UNZ_ERRNO Z_ERRNO -#define UNZ_EOF 0 -#define UNZ_PARAMERROR -102 -#define UNZ_BADZIPFILE -103 -#define UNZ_INTERNALERROR -104 -#define UNZ_CRCERROR -105 - -typedef struct File_Extractor* unzFile; - -/* Only indicated fields are supported; all others are set to 0 (and -named with a trailing _ so your code won't compile if it uses them). */ -typedef struct tm_unz_s -{ - uInt tm_sec_; - uInt tm_min_; - uInt tm_hour_; - uInt tm_mday_; - uInt tm_mon_; - uInt tm_year_; -} tm_unz; - -typedef struct unz_file_info_s -{ - uLong version_; - uLong version_needed_; - uLong flag_; - uLong compression_method_; - uLong dosDate; /* supported */ - uLong crc_; - uLong compressed_size_; - uLong uncompressed_size; /* supported */ - uLong size_filename; /* supported */ - uLong size_file_extra_; - uLong size_file_comment_; - - uLong disk_num_start_; - uLong internal_fa_; - uLong external_fa_; - - tm_unz tmu_date_; -} unz_file_info; - -/* Opens file archive or returns NULL if error */ -unzFile unzOpen( const char* path ); - -/* Goes to first file in archive */ -unzError unzGoToFirstFile( unzFile ); - -/* Goes to next file in archive */ -unzError unzGoToNextFile( unzFile ); - -/* Scans for file of given name and returns UNZ_OK if found */ -unzError unzLocateFile( unzFile, const char* name, int case_sensitive ); - -/* Compares two strings with optional case sensitivity */ -int unzStringFileNameCompare( const char* x, const char* y, int case_sensitive ); - -/* Gets name and size of current file. Doesn't support extra_out and -comment_out. */ -unzError unzGetCurrentFileInfo( unzFile, unz_file_info* info_out, - char* filename_out, uLong filename_size, - void* extra_out, uLong extra_size, - char* comment_out, uLong comment_size ); - -/* Prepares to read data from current file */ -unzError unzOpenCurrentFile( unzFile ); - -/* Reads at most 'count' bytes from current file into 'out' and returns number of -bytes actually read. Returns UNZ_EOF if end of file is reached, negative if error. */ -unzError unzReadCurrentFile( unzFile, void* out, unsigned count ); - -/* Number of bytes read from current file */ -z_off_t unztell( unzFile ); - -/* True if end of file has been reached */ -int unzeof( unzFile ); - -/* Finishes reading from current file */ -unzError unzCloseCurrentFile( unzFile ); - -/* Closes a file archive and frees memory */ -unzError unzClose( unzFile ); - -#ifdef __cplusplus - } -#endif - -#endif diff --git a/dependencies/File_Extractor-0.4.3/fex_mini.cpp b/dependencies/File_Extractor-0.4.3/fex_mini.cpp deleted file mode 100644 index df694fe8..00000000 --- a/dependencies/File_Extractor-0.4.3/fex_mini.cpp +++ /dev/null @@ -1,222 +0,0 @@ -// Minimal implementation of fex.h. Supports gzipped files if you have zlib -// available and HAVE_ZLIB_H is defined. - -// File_Extractor 0.4.3. http://www.slack.net/~ant/ - -#include "fex.h" - -#include -#include -#include - -#ifdef HAVE_CONFIG_H - #include "config.h" -#endif - -/* Copyright (C) 2007 Shay Green. This module is free software; you -can redistribute it and/or modify it under the terms of the GNU Lesser -General Public License as published by the Free Software Foundation; either -version 2.1 of the License, or (at your option) any later version. This -module is distributed in the hope that it will be useful, but WITHOUT ANY -WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS -FOR A PARTICULAR PURPOSE. See the GNU Lesser General Public License for more -details. You should have received a copy of the GNU Lesser General Public -License along with this module; if not, write to the Free Software Foundation, -Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA */ - -#ifndef HAVE_ZLIB_H - #define FILE_GZ( norm, gz ) norm - #define FILE_READ( ptr, size, file ) fread( ptr, 1, size, file ) -#else - #define FILE_GZ( norm, gz ) gz - #define FILE_READ( ptr, size, file ) gzread( file, ptr, size ) - -#include "zlib.h" - -static const char* get_gzip_size( const char* path, long* eof ) -{ - FILE* file = fopen( path, "rb" ); - if ( !file ) - return "Couldn't open file"; - - unsigned char buf [4]; - if ( fread( buf, 2, 1, file ) > 0 && buf [0] == 0x1F && buf [1] == 0x8B ) - { - fseek( file, -4, SEEK_END ); - fread( buf, 4, 1, file ); - *eof = buf [3] * 0x1000000 + buf [2] * 0x10000 + buf [1] * 0x100 + buf [0]; - } - else - { - fseek( file, 0, SEEK_END ); - *eof = ftell( file ); - } - const char* err = (ferror( file ) || feof( file )) ? "Couldn't get file size" : 0; - fclose( file ); - return err; -} -#endif - -const char fex_wrong_file_type [] = "Archive format not supported"; - -struct File_Extractor -{ - FILE_GZ(FILE*,gzFile) file; - int done; - long size; - void* data; // file data read into memory, ot 0 if not read - void* user_data; - fex_user_cleanup_t user_cleanup; - - char* name() { return (char*) (this + 1); } -}; - -// Always identify as single file extractor -fex_type_t_ const fex_bin_type [1] = {{ "" , 0 }}; -const char* fex_identify_header ( void const* ) { return ""; } -fex_type_t fex_identify_extension( const char* ) { return fex_bin_type; } -fex_type_t fex_identify_file ( const char*, fex_err_t* e ) { if ( e ) *e = 0; return fex_bin_type; } - -static fex_err_t fex_open_( const char* path, File_Extractor** fe_out ) -{ - *fe_out = 0; - - // name - const char* name = strrchr( path, '\\' ); // DOS - if ( !name ) - name = strrchr( path, '/' ); // UNIX - if ( !name ) - name = strrchr( path, ':' ); // Mac - if ( !name ) - name = path; - - // allocate space for struct and name - long name_size = strlen( name ) + 1; - File_Extractor* fe = (File_Extractor*) malloc( sizeof (File_Extractor) + name_size ); - if ( !fe ) return "Out of memory"; - - fe->done = 0; - fe->data = 0; - fe->user_data = 0; - fe->user_cleanup = 0; - memcpy( fe->name(), name, name_size ); - - #ifdef HAVE_ZLIB_H - // get gzip size BEFORE opening file - const char* err = get_gzip_size( path, &fe->size ); - if ( err ) - { - free( fe ); - return err; - } - #endif - - // open file - fe->file = FILE_GZ(fopen,gzopen)( path, "rb" ); - if ( !fe->file ) - { - free( fe ); - return "Couldn't open file"; - } - - // get normal size - #ifndef HAVE_ZLIB_H - fseek( fe->file, 0, SEEK_END ); - fe->size = ftell( fe->file ); - rewind( fe->file ); - #endif - - *fe_out = fe; - return 0; -} - -File_Extractor* fex_open( const char* path, fex_err_t* err_out ) -{ - File_Extractor* fe; - fex_err_t err = fex_open_( path, &fe ); - if ( err_out ) - *err_out = err; - return fe; -} - -File_Extractor* fex_open_type( fex_type_t, const char* path, fex_err_t* err_out ) -{ - return fex_open( path, err_out ); -} - -void* fex_user_data ( File_Extractor const* fe ) { return fe->user_data; } -void fex_set_user_data ( File_Extractor* fe, void* new_user_data ) { fe->user_data = new_user_data; } -void fex_set_user_cleanup ( File_Extractor* fe, fex_user_cleanup_t func ) { fe->user_cleanup = func; } - -fex_type_t fex_type ( File_Extractor const* ) { return fex_bin_type; } -int fex_done ( File_Extractor const* fe ) { return fe->done; } -const char* fex_name ( File_Extractor const* fe ) { return fe->name(); } -unsigned long fex_dos_date ( File_Extractor const* ) { return 0; } -long fex_size ( File_Extractor const* fe ) { return fe->size; } -long fex_remain ( File_Extractor const* fe ) { return fe->size - FILE_GZ(ftell,gztell)( fe->file ); } -void fex_scan_only ( File_Extractor* ) { } -fex_err_t fex_read_once ( File_Extractor* fe, void* out, long count ) { return fex_read( fe, out, count ); } -long fex_read_avail ( File_Extractor* fe, void* out, long count ) { return FILE_READ( out, count, fe->file ); } - -fex_err_t fex_read( File_Extractor* fe, void* out, long count ) -{ - if ( count == (long) FILE_READ( out, count, fe->file ) ) - return 0; - - if ( FILE_GZ(feof,gzeof)( fe->file ) ) - return "Unexpected end of file"; - - return "Couldn't read from file"; -} - -fex_err_t fex_next( File_Extractor* fe ) -{ - fe->done = 1; - return 0; -} - -fex_err_t fex_rewind( File_Extractor* fe ) -{ - fe->done = 0; - FILE_GZ(rewind,gzrewind)( fe->file ); - return 0; -} - -static fex_err_t fex_data_( File_Extractor* fe ) -{ - if ( !fe->data ) - { - fe->data = malloc( fe->size ); - if ( !fe->data ) return "Out of memory"; - - fex_err_t err = fex_read( fe, fe->data, fe->size ); - if ( err ) - { - free( fe->data ); - return err; - } - } - return 0; -} - -const unsigned char* fex_data( File_Extractor* fe, fex_err_t* err_out ) -{ - fex_err_t err = fex_data_( fe ); - if ( err_out ) - *err_out = err; - return (const unsigned char*) fe->data; -} - -void fex_close( File_Extractor* fe ) -{ - if ( fe ) - { - free( fe->data ); - FILE_GZ(fclose,gzclose)( fe->file ); - - if ( fe->user_cleanup ) - fe->user_cleanup( fe->user_data ); - - free( fe ); - } -} diff --git a/dependencies/File_Extractor-0.4.3/license.txt b/dependencies/File_Extractor-0.4.3/license.txt deleted file mode 100644 index 5faba9d4..00000000 --- a/dependencies/File_Extractor-0.4.3/license.txt +++ /dev/null @@ -1,504 +0,0 @@ - GNU LESSER GENERAL PUBLIC LICENSE - Version 2.1, February 1999 - - Copyright (C) 1991, 1999 Free Software Foundation, Inc. - 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - Everyone is permitted to copy and distribute verbatim copies - of this license document, but changing it is not allowed. - -[This is the first released version of the Lesser GPL. It also counts - as the successor of the GNU Library Public License, version 2, hence - the version number 2.1.] - - Preamble - - The licenses for most software are designed to take away your -freedom to share and change it. By contrast, the GNU General Public -Licenses are intended to guarantee your freedom to share and change -free software--to make sure the software is free for all its users. - - This license, the Lesser General Public License, applies to some -specially designated software packages--typically libraries--of the -Free Software Foundation and other authors who decide to use it. You -can use it too, but we suggest you first think carefully about whether -this license or the ordinary General Public License is the better -strategy to use in any particular case, based on the explanations below. - - When we speak of free software, we are referring to freedom of use, -not price. Our General Public Licenses are designed to make sure that -you have the freedom to distribute copies of free software (and charge -for this service if you wish); that you receive source code or can get -it if you want it; that you can change the software and use pieces of -it in new free programs; and that you are informed that you can do -these things. - - To protect your rights, we need to make restrictions that forbid -distributors to deny you these rights or to ask you to surrender these -rights. These restrictions translate to certain responsibilities for -you if you distribute copies of the library or if you modify it. - - For example, if you distribute copies of the library, whether gratis -or for a fee, you must give the recipients all the rights that we gave -you. You must make sure that they, too, receive or can get the source -code. If you link other code with the library, you must provide -complete object files to the recipients, so that they can relink them -with the library after making changes to the library and recompiling -it. And you must show them these terms so they know their rights. - - We protect your rights with a two-step method: (1) we copyright the -library, and (2) we offer you this license, which gives you legal -permission to copy, distribute and/or modify the library. - - To protect each distributor, we want to make it very clear that -there is no warranty for the free library. Also, if the library is -modified by someone else and passed on, the recipients should know -that what they have is not the original version, so that the original -author's reputation will not be affected by problems that might be -introduced by others. - - Finally, software patents pose a constant threat to the existence of -any free program. We wish to make sure that a company cannot -effectively restrict the users of a free program by obtaining a -restrictive license from a patent holder. Therefore, we insist that -any patent license obtained for a version of the library must be -consistent with the full freedom of use specified in this license. - - Most GNU software, including some libraries, is covered by the -ordinary GNU General Public License. This license, the GNU Lesser -General Public License, applies to certain designated libraries, and -is quite different from the ordinary General Public License. We use -this license for certain libraries in order to permit linking those -libraries into non-free programs. - - When a program is linked with a library, whether statically or using -a shared library, the combination of the two is legally speaking a -combined work, a derivative of the original library. The ordinary -General Public License therefore permits such linking only if the -entire combination fits its criteria of freedom. The Lesser General -Public License permits more lax criteria for linking other code with -the library. - - We call this license the "Lesser" General Public License because it -does Less to protect the user's freedom than the ordinary General -Public License. It also provides other free software developers Less -of an advantage over competing non-free programs. These disadvantages -are the reason we use the ordinary General Public License for many -libraries. However, the Lesser license provides advantages in certain -special circumstances. - - For example, on rare occasions, there may be a special need to -encourage the widest possible use of a certain library, so that it becomes -a de-facto standard. To achieve this, non-free programs must be -allowed to use the library. A more frequent case is that a free -library does the same job as widely used non-free libraries. In this -case, there is little to gain by limiting the free library to free -software only, so we use the Lesser General Public License. - - In other cases, permission to use a particular library in non-free -programs enables a greater number of people to use a large body of -free software. For example, permission to use the GNU C Library in -non-free programs enables many more people to use the whole GNU -operating system, as well as its variant, the GNU/Linux operating -system. - - Although the Lesser General Public License is Less protective of the -users' freedom, it does ensure that the user of a program that is -linked with the Library has the freedom and the wherewithal to run -that program using a modified version of the Library. - - The precise terms and conditions for copying, distribution and -modification follow. Pay close attention to the difference between a -"work based on the library" and a "work that uses the library". The -former contains code derived from the library, whereas the latter must -be combined with the library in order to run. - - GNU LESSER GENERAL PUBLIC LICENSE - TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION - - 0. This License Agreement applies to any software library or other -program which contains a notice placed by the copyright holder or -other authorized party saying it may be distributed under the terms of -this Lesser General Public License (also called "this License"). -Each licensee is addressed as "you". - - A "library" means a collection of software functions and/or data -prepared so as to be conveniently linked with application programs -(which use some of those functions and data) to form executables. - - The "Library", below, refers to any such software library or work -which has been distributed under these terms. A "work based on the -Library" means either the Library or any derivative work under -copyright law: that is to say, a work containing the Library or a -portion of it, either verbatim or with modifications and/or translated -straightforwardly into another language. (Hereinafter, translation is -included without limitation in the term "modification".) - - "Source code" for a work means the preferred form of the work for -making modifications to it. For a library, complete source code means -all the source code for all modules it contains, plus any associated -interface definition files, plus the scripts used to control compilation -and installation of the library. - - Activities other than copying, distribution and modification are not -covered by this License; they are outside its scope. The act of -running a program using the Library is not restricted, and output from -such a program is covered only if its contents constitute a work based -on the Library (independent of the use of the Library in a tool for -writing it). Whether that is true depends on what the Library does -and what the program that uses the Library does. - - 1. You may copy and distribute verbatim copies of the Library's -complete source code as you receive it, in any medium, provided that -you conspicuously and appropriately publish on each copy an -appropriate copyright notice and disclaimer of warranty; keep intact -all the notices that refer to this License and to the absence of any -warranty; and distribute a copy of this License along with the -Library. - - You may charge a fee for the physical act of transferring a copy, -and you may at your option offer warranty protection in exchange for a -fee. - - 2. You may modify your copy or copies of the Library or any portion -of it, thus forming a work based on the Library, and copy and -distribute such modifications or work under the terms of Section 1 -above, provided that you also meet all of these conditions: - - a) The modified work must itself be a software library. - - b) You must cause the files modified to carry prominent notices - stating that you changed the files and the date of any change. - - c) You must cause the whole of the work to be licensed at no - charge to all third parties under the terms of this License. - - d) If a facility in the modified Library refers to a function or a - table of data to be supplied by an application program that uses - the facility, other than as an argument passed when the facility - is invoked, then you must make a good faith effort to ensure that, - in the event an application does not supply such function or - table, the facility still operates, and performs whatever part of - its purpose remains meaningful. - - (For example, a function in a library to compute square roots has - a purpose that is entirely well-defined independent of the - application. Therefore, Subsection 2d requires that any - application-supplied function or table used by this function must - be optional: if the application does not supply it, the square - root function must still compute square roots.) - -These requirements apply to the modified work as a whole. If -identifiable sections of that work are not derived from the Library, -and can be reasonably considered independent and separate works in -themselves, then this License, and its terms, do not apply to those -sections when you distribute them as separate works. But when you -distribute the same sections as part of a whole which is a work based -on the Library, the distribution of the whole must be on the terms of -this License, whose permissions for other licensees extend to the -entire whole, and thus to each and every part regardless of who wrote -it. - -Thus, it is not the intent of this section to claim rights or contest -your rights to work written entirely by you; rather, the intent is to -exercise the right to control the distribution of derivative or -collective works based on the Library. - -In addition, mere aggregation of another work not based on the Library -with the Library (or with a work based on the Library) on a volume of -a storage or distribution medium does not bring the other work under -the scope of this License. - - 3. You may opt to apply the terms of the ordinary GNU General Public -License instead of this License to a given copy of the Library. To do -this, you must alter all the notices that refer to this License, so -that they refer to the ordinary GNU General Public License, version 2, -instead of to this License. (If a newer version than version 2 of the -ordinary GNU General Public License has appeared, then you can specify -that version instead if you wish.) Do not make any other change in -these notices. - - Once this change is made in a given copy, it is irreversible for -that copy, so the ordinary GNU General Public License applies to all -subsequent copies and derivative works made from that copy. - - This option is useful when you wish to copy part of the code of -the Library into a program that is not a library. - - 4. You may copy and distribute the Library (or a portion or -derivative of it, under Section 2) in object code or executable form -under the terms of Sections 1 and 2 above provided that you accompany -it with the complete corresponding machine-readable source code, which -must be distributed under the terms of Sections 1 and 2 above on a -medium customarily used for software interchange. - - If distribution of object code is made by offering access to copy -from a designated place, then offering equivalent access to copy the -source code from the same place satisfies the requirement to -distribute the source code, even though third parties are not -compelled to copy the source along with the object code. - - 5. A program that contains no derivative of any portion of the -Library, but is designed to work with the Library by being compiled or -linked with it, is called a "work that uses the Library". Such a -work, in isolation, is not a derivative work of the Library, and -therefore falls outside the scope of this License. - - However, linking a "work that uses the Library" with the Library -creates an executable that is a derivative of the Library (because it -contains portions of the Library), rather than a "work that uses the -library". The executable is therefore covered by this License. -Section 6 states terms for distribution of such executables. - - When a "work that uses the Library" uses material from a header file -that is part of the Library, the object code for the work may be a -derivative work of the Library even though the source code is not. -Whether this is true is especially significant if the work can be -linked without the Library, or if the work is itself a library. The -threshold for this to be true is not precisely defined by law. - - If such an object file uses only numerical parameters, data -structure layouts and accessors, and small macros and small inline -functions (ten lines or less in length), then the use of the object -file is unrestricted, regardless of whether it is legally a derivative -work. (Executables containing this object code plus portions of the -Library will still fall under Section 6.) - - Otherwise, if the work is a derivative of the Library, you may -distribute the object code for the work under the terms of Section 6. -Any executables containing that work also fall under Section 6, -whether or not they are linked directly with the Library itself. - - 6. As an exception to the Sections above, you may also combine or -link a "work that uses the Library" with the Library to produce a -work containing portions of the Library, and distribute that work -under terms of your choice, provided that the terms permit -modification of the work for the customer's own use and reverse -engineering for debugging such modifications. - - You must give prominent notice with each copy of the work that the -Library is used in it and that the Library and its use are covered by -this License. You must supply a copy of this License. If the work -during execution displays copyright notices, you must include the -copyright notice for the Library among them, as well as a reference -directing the user to the copy of this License. Also, you must do one -of these things: - - a) Accompany the work with the complete corresponding - machine-readable source code for the Library including whatever - changes were used in the work (which must be distributed under - Sections 1 and 2 above); and, if the work is an executable linked - with the Library, with the complete machine-readable "work that - uses the Library", as object code and/or source code, so that the - user can modify the Library and then relink to produce a modified - executable containing the modified Library. (It is understood - that the user who changes the contents of definitions files in the - Library will not necessarily be able to recompile the application - to use the modified definitions.) - - b) Use a suitable shared library mechanism for linking with the - Library. A suitable mechanism is one that (1) uses at run time a - copy of the library already present on the user's computer system, - rather than copying library functions into the executable, and (2) - will operate properly with a modified version of the library, if - the user installs one, as long as the modified version is - interface-compatible with the version that the work was made with. - - c) Accompany the work with a written offer, valid for at - least three years, to give the same user the materials - specified in Subsection 6a, above, for a charge no more - than the cost of performing this distribution. - - d) If distribution of the work is made by offering access to copy - from a designated place, offer equivalent access to copy the above - specified materials from the same place. - - e) Verify that the user has already received a copy of these - materials or that you have already sent this user a copy. - - For an executable, the required form of the "work that uses the -Library" must include any data and utility programs needed for -reproducing the executable from it. However, as a special exception, -the materials to be distributed need not include anything that is -normally distributed (in either source or binary form) with the major -components (compiler, kernel, and so on) of the operating system on -which the executable runs, unless that component itself accompanies -the executable. - - It may happen that this requirement contradicts the license -restrictions of other proprietary libraries that do not normally -accompany the operating system. Such a contradiction means you cannot -use both them and the Library together in an executable that you -distribute. - - 7. You may place library facilities that are a work based on the -Library side-by-side in a single library together with other library -facilities not covered by this License, and distribute such a combined -library, provided that the separate distribution of the work based on -the Library and of the other library facilities is otherwise -permitted, and provided that you do these two things: - - a) Accompany the combined library with a copy of the same work - based on the Library, uncombined with any other library - facilities. This must be distributed under the terms of the - Sections above. - - b) Give prominent notice with the combined library of the fact - that part of it is a work based on the Library, and explaining - where to find the accompanying uncombined form of the same work. - - 8. You may not copy, modify, sublicense, link with, or distribute -the Library except as expressly provided under this License. Any -attempt otherwise to copy, modify, sublicense, link with, or -distribute the Library is void, and will automatically terminate your -rights under this License. However, parties who have received copies, -or rights, from you under this License will not have their licenses -terminated so long as such parties remain in full compliance. - - 9. You are not required to accept this License, since you have not -signed it. However, nothing else grants you permission to modify or -distribute the Library or its derivative works. These actions are -prohibited by law if you do not accept this License. Therefore, by -modifying or distributing the Library (or any work based on the -Library), you indicate your acceptance of this License to do so, and -all its terms and conditions for copying, distributing or modifying -the Library or works based on it. - - 10. Each time you redistribute the Library (or any work based on the -Library), the recipient automatically receives a license from the -original licensor to copy, distribute, link with or modify the Library -subject to these terms and conditions. You may not impose any further -restrictions on the recipients' exercise of the rights granted herein. -You are not responsible for enforcing compliance by third parties with -this License. - - 11. If, as a consequence of a court judgment or allegation of patent -infringement or for any other reason (not limited to patent issues), -conditions are imposed on you (whether by court order, agreement or -otherwise) that contradict the conditions of this License, they do not -excuse you from the conditions of this License. If you cannot -distribute so as to satisfy simultaneously your obligations under this -License and any other pertinent obligations, then as a consequence you -may not distribute the Library at all. For example, if a patent -license would not permit royalty-free redistribution of the Library by -all those who receive copies directly or indirectly through you, then -the only way you could satisfy both it and this License would be to -refrain entirely from distribution of the Library. - -If any portion of this section is held invalid or unenforceable under any -particular circumstance, the balance of the section is intended to apply, -and the section as a whole is intended to apply in other circumstances. - -It is not the purpose of this section to induce you to infringe any -patents or other property right claims or to contest validity of any -such claims; this section has the sole purpose of protecting the -integrity of the free software distribution system which is -implemented by public license practices. Many people have made -generous contributions to the wide range of software distributed -through that system in reliance on consistent application of that -system; it is up to the author/donor to decide if he or she is willing -to distribute software through any other system and a licensee cannot -impose that choice. - -This section is intended to make thoroughly clear what is believed to -be a consequence of the rest of this License. - - 12. If the distribution and/or use of the Library is restricted in -certain countries either by patents or by copyrighted interfaces, the -original copyright holder who places the Library under this License may add -an explicit geographical distribution limitation excluding those countries, -so that distribution is permitted only in or among countries not thus -excluded. In such case, this License incorporates the limitation as if -written in the body of this License. - - 13. The Free Software Foundation may publish revised and/or new -versions of the Lesser General Public License from time to time. -Such new versions will be similar in spirit to the present version, -but may differ in detail to address new problems or concerns. - -Each version is given a distinguishing version number. If the Library -specifies a version number of this License which applies to it and -"any later version", you have the option of following the terms and -conditions either of that version or of any later version published by -the Free Software Foundation. If the Library does not specify a -license version number, you may choose any version ever published by -the Free Software Foundation. - - 14. If you wish to incorporate parts of the Library into other free -programs whose distribution conditions are incompatible with these, -write to the author to ask for permission. For software which is -copyrighted by the Free Software Foundation, write to the Free -Software Foundation; we sometimes make exceptions for this. Our -decision will be guided by the two goals of preserving the free status -of all derivatives of our free software and of promoting the sharing -and reuse of software generally. - - NO WARRANTY - - 15. BECAUSE THE LIBRARY IS LICENSED FREE OF CHARGE, THERE IS NO -WARRANTY FOR THE LIBRARY, TO THE EXTENT PERMITTED BY APPLICABLE LAW. -EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR -OTHER PARTIES PROVIDE THE LIBRARY "AS IS" WITHOUT WARRANTY OF ANY -KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE -IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR -PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE -LIBRARY IS WITH YOU. SHOULD THE LIBRARY PROVE DEFECTIVE, YOU ASSUME -THE COST OF ALL NECESSARY SERVICING, REPAIR OR CORRECTION. - - 16. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN -WRITING WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MAY MODIFY -AND/OR REDISTRIBUTE THE LIBRARY AS PERMITTED ABOVE, BE LIABLE TO YOU -FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR -CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE -LIBRARY (INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING -RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A -FAILURE OF THE LIBRARY TO OPERATE WITH ANY OTHER SOFTWARE), EVEN IF -SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH -DAMAGES. - - END OF TERMS AND CONDITIONS - - How to Apply These Terms to Your New Libraries - - If you develop a new library, and you want it to be of the greatest -possible use to the public, we recommend making it free software that -everyone can redistribute and change. You can do so by permitting -redistribution under these terms (or, alternatively, under the terms of the -ordinary General Public License). - - To apply these terms, attach the following notices to the library. It is -safest to attach them to the start of each source file to most effectively -convey the exclusion of warranty; and each file should have at least the -"copyright" line and a pointer to where the full notice is found. - - - Copyright (C) - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - -Also add information on how to contact you by electronic and paper mail. - -You should also get your employer (if you work as a programmer) or your -school, if any, to sign a "copyright disclaimer" for the library, if -necessary. Here is a sample; alter the names: - - Yoyodyne, Inc., hereby disclaims all copyright interest in the - library `Frob' (a library for tweaking knobs) written by James Random Hacker. - - , 1 April 1990 - Ty Coon, President of Vice - -That's all there is to it! - - diff --git a/dependencies/File_Extractor-0.4.3/makefile b/dependencies/File_Extractor-0.4.3/makefile deleted file mode 100644 index 9536e63d..00000000 --- a/dependencies/File_Extractor-0.4.3/makefile +++ /dev/null @@ -1,18 +0,0 @@ -# I don't compile zlib into fex.a since most systems have a native version. -# RAR support must be enabled in blargg_config.h. - -all: libfex.a demo.exe - -libfex.a: fex/fex.h fex/blargg_config.h - cd fex;$(CXX) -I.. -c -Os -fno-rtti -fno-exceptions *.cpp - cd 7z_C;$(CC) -c -Os *.c - cd 7z_C;$(CC) -c -Os *.c Archive/7z/*.c Compress/Branch/*.c Compress/Lzma/*.c - $(AR) $(ARFLAGS) libfex.a fex/*.o 7z_C/*.o - -ranlib libfex.a - -demo.exe: demo.c libfex.a - $(CC) -o demo.exe -I. -lz demo.c libfex.a - -clean: - -$(RM) fex/*.o 7z_C/*.o - -$(RM) libfex.a demo.exe diff --git a/dependencies/File_Extractor-0.4.3/readme.txt b/dependencies/File_Extractor-0.4.3/readme.txt deleted file mode 100644 index adc3ded2..00000000 --- a/dependencies/File_Extractor-0.4.3/readme.txt +++ /dev/null @@ -1,95 +0,0 @@ -File_Extractor 0.4.3 --------------------- -File_Extractor provides uniform access to files in popular compressed -archive formats. It is meant for programs which want to transparently -read from compressed files. Wrappers are also included that make the -library act like the unzip and unrarlib libraries, allowing your code to -work with minimal changes if you already use one of these libraries. - -Features: -* C and C++ interfaces -* Supports ZIP, GZIP, 7-Zip (7Z), and RAR(*) archive formats -* File data can be extracted in several ways -* Uncompressed files can be treated as archives, simplifying your code -* Modular design allows removal of support for unneeded archive formats - -(*) RAR support must be enabled before use, due to its special -licensing. - -Author : Shay Green -Website : http://www.slack.net/~ant/ -License : GNU Lesser General Public License (LGPL) for all except RAR -Language: C or C++ - - -Getting Started ---------------- -Build demo.exe by typing "make" at the command-line. If that doesn't -work, manually build a program from demo.c, fex/*.cpp, 7z_C/*.c, and -zlib/*.c. Be sure "test.zip" is in the same directory. Running the -program should list the files and content of the test.zip archive. - -To enable RAR support, edit fex/blargg_config.h. - -See fex.h for reference and fex.txt for documentation. - - -Files ------ -fex.txt Manual -changes.txt Change log -license.txt LGPL license - -makefile Builds libfex.a and demo.exe - -demo.c Basic library usage -test.zip Test archive used by demo - -fex_mini.cpp Minimal version (no other sources needed) - -fex/ - blargg_config.h Configuration (modify as needed) - - fex.h C interface (also usable from C++) - File_Extractor.h C++ interface - - unzip.h Makes library act like unzip library - unzip.cpp - - unrarlib.h Makes library act like unrarlib - unrarlib.cpp - - Single_File_Extractor.h Single file support - Single_File_Extractor.cpp - Gzip_Reader.h - Gzip_Reader.cpp - - Zip_Extractor.h Zip support - Zip_Extractor.cpp - - Zip7_Extractor.h 7-Zip support - Zip7_Extractor.cpp - - Rar_Extractor.h RAR support - Rar_Extractor.cpp - - blargg_common.h Required - blargg_endian.h - blargg_source.h - abstract_file.h - abstract_file.cpp - Data_Reader.h - Data_Reader.cpp - File_Extractor.cpp - Zlib_Inflater.cpp - Zlib_Inflater.h - fex.cpp - -zlib/ Gzip support (or use standard zlib) - -7z_C/ 7-Zip support - -unrar/ RAR support - --- -Shay Green diff --git a/dependencies/File_Extractor-0.4.3/test.zip b/dependencies/File_Extractor-0.4.3/test.zip deleted file mode 100644 index 462d1635..00000000 Binary files a/dependencies/File_Extractor-0.4.3/test.zip and /dev/null differ diff --git a/dependencies/LICENSE b/dependencies/LICENSE deleted file mode 100644 index f6ff4f01..00000000 --- a/dependencies/LICENSE +++ /dev/null @@ -1,29 +0,0 @@ -NASM is now licensed under the 2-clause BSD license, also known as the -simplified BSD license. - - Copyright 1996-2009 the NASM Authors - All rights reserved. - - Redistribution and use in source and binary forms, with or without - modification, are permitted provided that the following - conditions are met: - - * Redistributions of source code must retain the above copyright - notice, this list of conditions and the following disclaimer. - * Redistributions in binary form must reproduce the above - copyright notice, this list of conditions and the following - disclaimer in the documentation and/or other materials provided - with the distribution. - - THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND - CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, - INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF - MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE - DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR - CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, - SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT - NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; - LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) - HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN - CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR - OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, - EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. diff --git a/dependencies/SFML/build/vc2008/sfml-network.vcproj b/dependencies/SFML/build/vc2008/sfml-network.vcproj deleted file mode 100644 index 23d3d9c4..00000000 --- a/dependencies/SFML/build/vc2008/sfml-network.vcproj +++ /dev/null @@ -1,248 +0,0 @@ - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - diff --git a/dependencies/SFML/build/vc2008/sfml-network.vcproj.GOLIATH.Shawn.user b/dependencies/SFML/build/vc2008/sfml-network.vcproj.GOLIATH.Shawn.user deleted file mode 100644 index 3737b836..00000000 --- a/dependencies/SFML/build/vc2008/sfml-network.vcproj.GOLIATH.Shawn.user +++ /dev/null @@ -1,65 +0,0 @@ - - - - - - - - - - - diff --git a/dependencies/SFML/include/SFML/Config.hpp b/dependencies/SFML/include/SFML/Config.hpp deleted file mode 100644 index 91d052f8..00000000 --- a/dependencies/SFML/include/SFML/Config.hpp +++ /dev/null @@ -1,165 +0,0 @@ -//////////////////////////////////////////////////////////// -// -// SFML - Simple and Fast Multimedia Library -// Copyright (C) 2007-2009 Laurent Gomila (laurent.gom@gmail.com) -// -// This software is provided 'as-is', without any express or implied warranty. -// In no event will the authors be held liable for any damages arising from the use of this software. -// -// Permission is granted to anyone to use this software for any purpose, -// including commercial applications, and to alter it and redistribute it freely, -// subject to the following restrictions: -// -// 1. The origin of this software must not be misrepresented; -// you must not claim that you wrote the original software. -// If you use this software in a product, an acknowledgment -// in the product documentation would be appreciated but is not required. -// -// 2. Altered source versions must be plainly marked as such, -// and must not be misrepresented as being the original software. -// -// 3. This notice may not be removed or altered from any source distribution. -// -//////////////////////////////////////////////////////////// - -#ifndef SFML_CONFIG_HPP -#define SFML_CONFIG_HPP - -//////////////////////////////////////////////////////////// -// Identify the operating system -//////////////////////////////////////////////////////////// -#if defined(_WIN32) || defined(__WIN32__) - - // Windows - #define SFML_SYSTEM_WINDOWS - #ifndef WIN32_LEAN_AND_MEAN - #define WIN32_LEAN_AND_MEAN - #endif - #ifndef NOMINMAX - #define NOMINMAX - #endif - -#elif defined(linux) || defined(__linux) - - // Linux - #define SFML_SYSTEM_LINUX - -#elif defined(__APPLE__) || defined(MACOSX) || defined(macintosh) || defined(Macintosh) - - // MacOS - #define SFML_SYSTEM_MACOS - -#elif defined(__FreeBSD__) - - // FreeBSD - #define SFML_SYSTEM_FREEBSD - -#else - - // Unsupported system - #error This operating system is not supported by SFML library - -#endif - - -//////////////////////////////////////////////////////////// -// Define a portable debug macro -//////////////////////////////////////////////////////////// -#if !defined(NDEBUG) - - #define SFML_DEBUG - -#endif - - -//////////////////////////////////////////////////////////// -// Define portable import / export macros -//////////////////////////////////////////////////////////// -#if defined(SFML_SYSTEM_WINDOWS) - - #ifdef SFML_DYNAMIC - - // Windows platforms - #ifdef SFML_EXPORTS - - // From DLL side, we must export - #define SFML_API __declspec(dllexport) - - #else - - // From client application side, we must import - #define SFML_API __declspec(dllimport) - - #endif - - // For Visual C++ compilers, we also need to turn off this annoying C4251 warning. - // You can read lots ot different things about it, but the point is the code will - // just work fine, and so the simplest way to get rid of this warning is to disable it - #ifdef _MSC_VER - - #pragma warning(disable : 4251) - - #endif - - #else - - // No specific directive needed for static build - #define SFML_API - - #endif - -#else - - // Other platforms don't need to define anything - #define SFML_API - -#endif - - -//////////////////////////////////////////////////////////// -// Define portable fixed-size types -//////////////////////////////////////////////////////////// -#include - -namespace sf -{ - // 8 bits integer types - #if UCHAR_MAX == 0xFF - typedef signed char Int8; - typedef unsigned char Uint8; - #else - #error No 8 bits integer type for this platform - #endif - - // 16 bits integer types - #if USHRT_MAX == 0xFFFF - typedef signed short Int16; - typedef unsigned short Uint16; - #elif UINT_MAX == 0xFFFF - typedef signed int Int16; - typedef unsigned int Uint16; - #elif ULONG_MAX == 0xFFFF - typedef signed long Int16; - typedef unsigned long Uint16; - #else - #error No 16 bits integer type for this platform - #endif - - // 32 bits integer types - #if USHRT_MAX == 0xFFFFFFFF - typedef signed short Int32; - typedef unsigned short Uint32; - #elif UINT_MAX == 0xFFFFFFFF - typedef signed int Int32; - typedef unsigned int Uint32; - #elif ULONG_MAX == 0xFFFFFFFF - typedef signed long Int32; - typedef unsigned long Uint32; - #else - #error No 32 bits integer type for this platform - #endif - -} // namespace sf - - -#endif // SFML_CONFIG_HPP diff --git a/dependencies/SFML/include/SFML/Network.hpp b/dependencies/SFML/include/SFML/Network.hpp deleted file mode 100644 index 6ec13d35..00000000 --- a/dependencies/SFML/include/SFML/Network.hpp +++ /dev/null @@ -1,42 +0,0 @@ -//////////////////////////////////////////////////////////// -// -// SFML - Simple and Fast Multimedia Library -// Copyright (C) 2007-2009 Laurent Gomila (laurent.gom@gmail.com) -// -// This software is provided 'as-is', without any express or implied warranty. -// In no event will the authors be held liable for any damages arising from the use of this software. -// -// Permission is granted to anyone to use this software for any purpose, -// including commercial applications, and to alter it and redistribute it freely, -// subject to the following restrictions: -// -// 1. The origin of this software must not be misrepresented; -// you must not claim that you wrote the original software. -// If you use this software in a product, an acknowledgment -// in the product documentation would be appreciated but is not required. -// -// 2. Altered source versions must be plainly marked as such, -// and must not be misrepresented as being the original software. -// -// 3. This notice may not be removed or altered from any source distribution. -// -//////////////////////////////////////////////////////////// - -#ifndef SFML_NETWORK_HPP -#define SFML_NETWORK_HPP - -//////////////////////////////////////////////////////////// -// Headers -//////////////////////////////////////////////////////////// - -#include -#include -#include -#include -#include -#include -#include -#include - - -#endif // SFML_NETWORK_HPP diff --git a/dependencies/SFML/include/SFML/Network/Ftp.hpp b/dependencies/SFML/include/SFML/Network/Ftp.hpp deleted file mode 100644 index f2f1bd33..00000000 --- a/dependencies/SFML/include/SFML/Network/Ftp.hpp +++ /dev/null @@ -1,448 +0,0 @@ -//////////////////////////////////////////////////////////// -// -// SFML - Simple and Fast Multimedia Library -// Copyright (C) 2007-2009 Laurent Gomila (laurent.gom@gmail.com) -// -// This software is provided 'as-is', without any express or implied warranty. -// In no event will the authors be held liable for any damages arising from the use of this software. -// -// Permission is granted to anyone to use this software for any purpose, -// including commercial applications, and to alter it and redistribute it freely, -// subject to the following restrictions: -// -// 1. The origin of this software must not be misrepresented; -// you must not claim that you wrote the original software. -// If you use this software in a product, an acknowledgment -// in the product documentation would be appreciated but is not required. -// -// 2. Altered source versions must be plainly marked as such, -// and must not be misrepresented as being the original software. -// -// 3. This notice may not be removed or altered from any source distribution. -// -//////////////////////////////////////////////////////////// - -#ifndef SFML_FTP_HPP -#define SFML_FTP_HPP - -//////////////////////////////////////////////////////////// -// Headers -//////////////////////////////////////////////////////////// -#include -#include -#include -#include - - -namespace sf -{ -class IPAddress; - -//////////////////////////////////////////////////////////// -/// This class provides methods for manipulating the FTP -/// protocol (described in RFC 959). -/// It provides easy access and transfers to remote -/// directories and files on a FTP server -//////////////////////////////////////////////////////////// -class SFML_API Ftp : NonCopyable -{ -public : - - //////////////////////////////////////////////////////////// - /// Enumeration of transfer modes - //////////////////////////////////////////////////////////// - enum TransferMode - { - Binary, ///< Binary mode (file is transfered as a sequence of bytes) - Ascii, ///< Text mode using ASCII encoding - Ebcdic ///< Text mode using EBCDIC encoding - }; - - //////////////////////////////////////////////////////////// - /// This class wraps a FTP response, which is basically : - /// - a status code - /// - a message - //////////////////////////////////////////////////////////// - class SFML_API Response - { - public : - - //////////////////////////////////////////////////////////// - /// Enumerate all the valid status codes returned in - /// a FTP response - //////////////////////////////////////////////////////////// - enum Status - { - // 1xx: the requested action is being initiated, - // expect another reply before proceeding with a new command - RestartMarkerReply = 110, ///< Restart marker reply - ServiceReadySoon = 120, ///< Service ready in N minutes - DataConnectionAlreadyOpened = 125, ///< Data connection already opened, transfer starting - OpeningDataConnection = 150, ///< File status ok, about to open data connection - - // 2xx: the requested action has been successfully completed - Ok = 200, ///< Command ok - PointlessCommand = 202, ///< Command not implemented - SystemStatus = 211, ///< System status, or system help reply - DirectoryStatus = 212, ///< Directory status - FileStatus = 213, ///< File status - HelpMessage = 214, ///< Help message - SystemType = 215, ///< NAME system type, where NAME is an official system name from the list in the Assigned Numbers document - ServiceReady = 220, ///< Service ready for new user - ClosingConnection = 221, ///< Service closing control connection - DataConnectionOpened = 225, ///< Data connection open, no transfer in progress - ClosingDataConnection = 226, ///< Closing data connection, requested file action successful - EnteringPassiveMode = 227, ///< Entering passive mode - LoggedIn = 230, ///< User logged in, proceed. Logged out if appropriate - FileActionOk = 250, ///< Requested file action ok - DirectoryOk = 257, ///< PATHNAME created - - // 3xx: the command has been accepted, but the requested action - // is dormant, pending receipt of further information - NeedPassword = 331, ///< User name ok, need password - NeedAccountToLogIn = 332, ///< Need account for login - NeedInformation = 350, ///< Requested file action pending further information - - // 4xx: the command was not accepted and the requested action did not take place, - // but the error condition is temporary and the action may be requested again - ServiceUnavailable = 421, ///< Service not available, closing control connection - DataConnectionUnavailable = 425, ///< Can't open data connection - TransferAborted = 426, ///< Connection closed, transfer aborted - FileActionAborted = 450, ///< Requested file action not taken - LocalError = 451, ///< Requested action aborted, local error in processing - InsufficientStorageSpace = 452, ///< Requested action not taken; insufficient storage space in system, file unavailable - - // 5xx: the command was not accepted and - // the requested action did not take place - CommandUnknown = 500, ///< Syntax error, command unrecognized - ParametersUnknown = 501, ///< Syntax error in parameters or arguments - CommandNotImplemented = 502, ///< Command not implemented - BadCommandSequence = 503, ///< Bad sequence of commands - ParameterNotImplemented = 504, ///< Command not implemented for that parameter - NotLoggedIn = 530, ///< Not logged in - NeedAccountToStore = 532, ///< Need account for storing files - FileUnavailable = 550, ///< Requested action not taken, file unavailable - PageTypeUnknown = 551, ///< Requested action aborted, page type unknown - NotEnoughMemory = 552, ///< Requested file action aborted, exceeded storage allocation - FilenameNotAllowed = 553, ///< Requested action not taken, file name not allowed - - // 10xx: SFML custom codes - InvalidResponse = 1000, ///< Response is not a valid FTP one - ConnectionFailed = 1001, ///< Connection with server failed - ConnectionClosed = 1002, ///< Connection with server closed - InvalidFile = 1003 ///< Invalid file to upload / download - }; - - //////////////////////////////////////////////////////////// - /// Default constructor - /// - /// \param Code : Response status code (InvalidResponse by default) - /// \param Message : Response message (empty by default) - /// - //////////////////////////////////////////////////////////// - Response(Status Code = InvalidResponse, const std::string& Message = ""); - - //////////////////////////////////////////////////////////// - /// Convenience function to check if the response status code - /// means a success - /// - /// \return True if status is success (code < 400) - /// - //////////////////////////////////////////////////////////// - bool IsOk() const; - - //////////////////////////////////////////////////////////// - /// Get the response status code - /// - /// \return Status code - /// - //////////////////////////////////////////////////////////// - Status GetStatus() const; - - //////////////////////////////////////////////////////////// - /// Get the full message contained in the response - /// - /// \return The response message - /// - //////////////////////////////////////////////////////////// - const std::string& GetMessage() const; - - private : - - //////////////////////////////////////////////////////////// - // Member data - //////////////////////////////////////////////////////////// - Status myStatus; ///< Status code returned from the server - std::string myMessage; ///< Last message received from the server - }; - - //////////////////////////////////////////////////////////// - /// Specialization of FTP response returning a directory - //////////////////////////////////////////////////////////// - class SFML_API DirectoryResponse : public Response - { - public : - - //////////////////////////////////////////////////////////// - /// Default constructor - /// - /// \param Resp : Source response - /// - //////////////////////////////////////////////////////////// - DirectoryResponse(Response Resp); - - //////////////////////////////////////////////////////////// - /// Get the directory returned in the response - /// - /// \return Directory name - /// - //////////////////////////////////////////////////////////// - const std::string& GetDirectory() const; - - private : - - //////////////////////////////////////////////////////////// - // Member data - //////////////////////////////////////////////////////////// - std::string myDirectory; ///< Directory extracted from the response message - }; - - - //////////////////////////////////////////////////////////// - /// Specialization of FTP response returning a filename lisiting - //////////////////////////////////////////////////////////// - class SFML_API ListingResponse : public Response - { - public : - - //////////////////////////////////////////////////////////// - /// Default constructor - /// - /// \param Resp : Source response - /// \param Data : Data containing the raw listing - /// - //////////////////////////////////////////////////////////// - ListingResponse(Response Resp, const std::vector& Data); - - //////////////////////////////////////////////////////////// - /// Get the number of filenames in the listing - /// - /// \return Total number of filenames - /// - //////////////////////////////////////////////////////////// - std::size_t GetCount() const; - - //////////////////////////////////////////////////////////// - /// Get the Index-th filename in the directory - /// - /// \param Index : Index of the filename to get - /// - /// \return Index-th filename - /// - //////////////////////////////////////////////////////////// - const std::string& GetFilename(std::size_t Index) const; - - private : - - //////////////////////////////////////////////////////////// - // Member data - //////////////////////////////////////////////////////////// - std::vector myFilenames; ///< Filenames extracted from the data - }; - - - //////////////////////////////////////////////////////////// - /// Destructor -- close the connection with the server - /// - //////////////////////////////////////////////////////////// - ~Ftp(); - - //////////////////////////////////////////////////////////// - /// Connect to the specified FTP server - /// - /// \param Server : FTP server to connect to - /// \param Port : Port used for connection (21 by default, standard FTP port) - /// \param Timeout : Maximum time to wait, in seconds (0 by default, means no timeout) - /// - /// \return Server response to the request - /// - //////////////////////////////////////////////////////////// - Response Connect(const IPAddress& Server, unsigned short Port = 21, float Timeout = 0.f); - - //////////////////////////////////////////////////////////// - /// Log in using anonymous account - /// - /// \return Server response to the request - /// - //////////////////////////////////////////////////////////// - Response Login(); - - //////////////////////////////////////////////////////////// - /// Log in using a username and a password - /// - /// \param UserName : User name - /// \param Password : Password - /// - /// \return Server response to the request - /// - //////////////////////////////////////////////////////////// - Response Login(const std::string& UserName, const std::string& Password); - - //////////////////////////////////////////////////////////// - /// Close the connection with FTP server - /// - /// \return Server response to the request - /// - //////////////////////////////////////////////////////////// - Response Disconnect(); - - //////////////////////////////////////////////////////////// - /// Send a null command just to prevent from being disconnected - /// - /// \return Server response to the request - /// - //////////////////////////////////////////////////////////// - Response KeepAlive(); - - //////////////////////////////////////////////////////////// - /// Get the current working directory - /// - /// \return Server response to the request - /// - //////////////////////////////////////////////////////////// - DirectoryResponse GetWorkingDirectory(); - - //////////////////////////////////////////////////////////// - /// Get the contents of the given directory - /// (subdirectories and files) - /// - /// \param Directory : Directory to list ("" by default, the current one) - /// - /// \return Server response to the request - /// - //////////////////////////////////////////////////////////// - ListingResponse GetDirectoryListing(const std::string& Directory = ""); - - //////////////////////////////////////////////////////////// - /// Change the current working directory - /// - /// \param Directory : New directory, relative to the current one - /// - /// \return Server response to the request - /// - //////////////////////////////////////////////////////////// - Response ChangeDirectory(const std::string& Directory); - - //////////////////////////////////////////////////////////// - /// Go to the parent directory of the current one - /// - /// \return Server response to the request - /// - //////////////////////////////////////////////////////////// - Response ParentDirectory(); - - //////////////////////////////////////////////////////////// - /// Create a new directory - /// - /// \param Name : Name of the directory to create - /// - /// \return Server response to the request - /// - //////////////////////////////////////////////////////////// - Response MakeDirectory(const std::string& Name); - - //////////////////////////////////////////////////////////// - /// Remove an existing directory - /// - /// \param Name : Name of the directory to remove - /// - /// \return Server response to the request - /// - //////////////////////////////////////////////////////////// - Response DeleteDirectory(const std::string& Name); - - //////////////////////////////////////////////////////////// - /// Rename a file - /// - /// \param File : File to rename - /// \param NewName : New name - /// - /// \return Server response to the request - /// - //////////////////////////////////////////////////////////// - Response RenameFile(const std::string& File, const std::string& NewName); - - //////////////////////////////////////////////////////////// - /// Remove an existing file - /// - /// \param Name : File to remove - /// - /// \return Server response to the request - /// - //////////////////////////////////////////////////////////// - Response DeleteFile(const std::string& Name); - - //////////////////////////////////////////////////////////// - /// Download a file from the server - /// - /// \param DistantFile : Path of the distant file to download - /// \param DestPath : Where to put to file on the local computer - /// \param Mode : Transfer mode (binary by default) - /// - /// \return Server response to the request - /// - //////////////////////////////////////////////////////////// - Response Download(const std::string& DistantFile, const std::string& DestPath, TransferMode Mode = Binary); - - //////////////////////////////////////////////////////////// - /// Upload a file to the server - /// - /// \param LocalFile : Path of the local file to upload - /// \param DestPath : Where to put to file on the server - /// \param Mode : Transfer mode (binary by default) - /// - /// \return Server response to the request - /// - //////////////////////////////////////////////////////////// - Response Upload(const std::string& LocalFile, const std::string& DestPath, TransferMode Mode = Binary); - -private : - - //////////////////////////////////////////////////////////// - /// Send a command to the FTP server - /// - /// \param Command : Command to send - /// \param Parameter : Command parameter ("" by default) - /// - /// \return Server response to the request - /// - //////////////////////////////////////////////////////////// - Response SendCommand(const std::string& Command, const std::string& Parameter = ""); - - //////////////////////////////////////////////////////////// - /// Receive a response from the server - /// (usually after a command has been sent) - /// - /// \return Server response to the request - /// - //////////////////////////////////////////////////////////// - Response GetResponse(); - - //////////////////////////////////////////////////////////// - /// Utility class for exchanging datas with the server - /// on the data channel - //////////////////////////////////////////////////////////// - class DataChannel; - - friend class DataChannel; - - //////////////////////////////////////////////////////////// - // Member data - //////////////////////////////////////////////////////////// - SocketTCP myCommandSocket; ///< Socket holding the control connection with the server -}; - -} // namespace sf - - -#endif // SFML_FTP_HPP diff --git a/dependencies/SFML/include/SFML/Network/Http.hpp b/dependencies/SFML/include/SFML/Network/Http.hpp deleted file mode 100644 index 54e5c1fc..00000000 --- a/dependencies/SFML/include/SFML/Network/Http.hpp +++ /dev/null @@ -1,340 +0,0 @@ -//////////////////////////////////////////////////////////// -// -// SFML - Simple and Fast Multimedia Library -// Copyright (C) 2007-2009 Laurent Gomila (laurent.gom@gmail.com) -// -// This software is provided 'as-is', without any express or implied warranty. -// In no event will the authors be held liable for any damages arising from the use of this software. -// -// Permission is granted to anyone to use this software for any purpose, -// including commercial applications, and to alter it and redistribute it freely, -// subject to the following restrictions: -// -// 1. The origin of this software must not be misrepresented; -// you must not claim that you wrote the original software. -// If you use this software in a product, an acknowledgment -// in the product documentation would be appreciated but is not required. -// -// 2. Altered source versions must be plainly marked as such, -// and must not be misrepresented as being the original software. -// -// 3. This notice may not be removed or altered from any source distribution. -// -//////////////////////////////////////////////////////////// - -#ifndef SFML_HTTP_HPP -#define SFML_HTTP_HPP - -//////////////////////////////////////////////////////////// -// Headers -//////////////////////////////////////////////////////////// -#include -#include -#include -#include -#include - - -namespace sf -{ -//////////////////////////////////////////////////////////// -/// This class provides methods for manipulating the HTTP -/// protocol (described in RFC 1945). -/// It can connect to a website, get its files, send requests, etc. -//////////////////////////////////////////////////////////// -class SFML_API Http : NonCopyable -{ -public : - - //////////////////////////////////////////////////////////// - /// This class wraps an HTTP request, which is basically : - /// - a header with a method, a target URI, and a set of field/value pairs - /// - an optional body (for POST requests) - //////////////////////////////////////////////////////////// - class SFML_API Request - { - public : - - //////////////////////////////////////////////////////////// - /// Enumerate the available HTTP methods for a request - //////////////////////////////////////////////////////////// - enum Method - { - Get, ///< Request in get mode, standard method to retrieve a page - Post, ///< Request in post mode, usually to send data to a page - Head ///< Request a page's header only - }; - - //////////////////////////////////////////////////////////// - /// Default constructor - /// - /// \param RequestMethod : Method to use for the request (Get by default) - /// \param URI : Target URI ("/" by default -- index page) - /// \param Body : Content of the request's body (empty by default) - /// - //////////////////////////////////////////////////////////// - Request(Method RequestMethod = Get, const std::string& URI = "/", const std::string& Body = ""); - - //////////////////////////////////////////////////////////// - /// Set the value of a field; the field is added if it doesn't exist - /// - /// \param Field : Name of the field to set (case-insensitive) - /// \param Value : Value of the field - /// - //////////////////////////////////////////////////////////// - void SetField(const std::string& Field, const std::string& Value); - - //////////////////////////////////////////////////////////// - /// Set the request method. - /// This parameter is Http::Request::Get by default - /// - /// \param RequestMethod : Method to use for the request - /// - //////////////////////////////////////////////////////////// - void SetMethod(Method RequestMethod); - - //////////////////////////////////////////////////////////// - /// Set the target URI of the request. - /// This parameter is "/" by default - /// - /// \param URI : URI to request, local to the host - /// - //////////////////////////////////////////////////////////// - void SetURI(const std::string& URI); - - //////////////////////////////////////////////////////////// - /// Set the HTTP version of the request. - /// This parameter is 1.0 by default - /// - /// \param Major : Major version number - /// \param Minor : Minor version number - /// - //////////////////////////////////////////////////////////// - void SetHttpVersion(unsigned int Major, unsigned int Minor); - - //////////////////////////////////////////////////////////// - /// Set the body of the request. This parameter is optional and - /// makes sense only for POST requests. - /// This parameter is empty by default - /// - /// \param Body : Content of the request body - /// - //////////////////////////////////////////////////////////// - void SetBody(const std::string& Body); - - private : - - friend class Http; - - //////////////////////////////////////////////////////////// - /// Get the string representation of the request header - /// - /// \return String containing the request - /// - //////////////////////////////////////////////////////////// - std::string ToString() const; - - //////////////////////////////////////////////////////////// - /// Check if the given field has been defined - /// - /// \param Field : Name of the field to check (case-insensitive) - /// - /// \return True if the field exists - /// - //////////////////////////////////////////////////////////// - bool HasField(const std::string& Field) const; - - //////////////////////////////////////////////////////////// - // Types - //////////////////////////////////////////////////////////// - typedef std::map FieldTable; - - //////////////////////////////////////////////////////////// - // Member data - //////////////////////////////////////////////////////////// - FieldTable myFields; ///< Fields of the header - Method myMethod; ///< Method to use for the request - std::string myURI; ///< Target URI of the request - unsigned int myMajorVersion; ///< Major HTTP version - unsigned int myMinorVersion; ///< Minor HTTP version - std::string myBody; ///< Body of the request - }; - - //////////////////////////////////////////////////////////// - /// This class wraps an HTTP response, which is basically : - /// - a header with a status code and a set of field/value pairs - /// - a body (the content of the requested resource) - //////////////////////////////////////////////////////////// - class SFML_API Response - { - public : - - //////////////////////////////////////////////////////////// - /// Enumerate all the valid status codes returned in - /// a HTTP response - //////////////////////////////////////////////////////////// - enum Status - { - // 2xx: success - Ok = 200, ///< Most common code returned when operation was successful - Created = 201, ///< The resource has successfully been created - Accepted = 202, ///< The request has been accepted, but will be processed later by the server - NoContent = 204, ///< Sent when the server didn't send any data in return - - // 3xx: redirection - MultipleChoices = 300, ///< The requested page can be accessed from several locations - MovedPermanently = 301, ///< The requested page has permanently moved to a new location - MovedTemporarily = 302, ///< The requested page has temporarily moved to a new location - NotModified = 304, ///< For conditionnal requests, means the requested page hasn't changed and doesn't need to be refreshed - - // 4xx: client error - BadRequest = 400, ///< The server couldn't understand the request (syntax error) - Unauthorized = 401, ///< The requested page needs an authentification to be accessed - Forbidden = 403, ///< The requested page cannot be accessed at all, even with authentification - NotFound = 404, ///< The requested page doesn't exist - - // 5xx: server error - InternalServerError = 500, ///< The server encountered an unexpected error - NotImplemented = 501, ///< The server doesn't implement a requested feature - BadGateway = 502, ///< The gateway server has received an error from the source server - ServiceNotAvailable = 503, ///< The server is temporarily unavailable (overloaded, in maintenance, ...) - - // 10xx: SFML custom codes - InvalidResponse = 1000, ///< Response is not a valid HTTP one - ConnectionFailed = 1001 ///< Connection with server failed - }; - - //////////////////////////////////////////////////////////// - /// Default constructor - /// - //////////////////////////////////////////////////////////// - Response(); - - //////////////////////////////////////////////////////////// - /// Get the value of a field - /// - /// \param Field : Name of the field to get (case-insensitive) - /// - /// \return Value of the field, or empty string if not found - /// - //////////////////////////////////////////////////////////// - const std::string& GetField(const std::string& Field) const; - - //////////////////////////////////////////////////////////// - /// Get the header's status code - /// - /// \return Header's status code - /// - //////////////////////////////////////////////////////////// - Status GetStatus() const; - - //////////////////////////////////////////////////////////// - /// Get the major HTTP version number of the response - /// - /// \return Major version number - /// - //////////////////////////////////////////////////////////// - unsigned int GetMajorHttpVersion() const; - - //////////////////////////////////////////////////////////// - /// Get the major HTTP version number of the response - /// - /// \return Major version number - /// - //////////////////////////////////////////////////////////// - unsigned int GetMinorHttpVersion() const; - - //////////////////////////////////////////////////////////// - /// Get the body of the response. The body can contain : - /// - the requested page (for GET requests) - /// - a response from the server (for POST requests) - /// - nothing (for HEAD requests) - /// - an error message (in case of an error) - /// - /// \return The response body - /// - //////////////////////////////////////////////////////////// - const std::string& GetBody() const; - - private : - - friend class Http; - - //////////////////////////////////////////////////////////// - /// Construct the header from a response string - /// - /// \param Data : Content of the response's header to parse - /// - //////////////////////////////////////////////////////////// - void FromString(const std::string& Data); - - //////////////////////////////////////////////////////////// - // Types - //////////////////////////////////////////////////////////// - typedef std::map FieldTable; - - //////////////////////////////////////////////////////////// - // Member data - //////////////////////////////////////////////////////////// - FieldTable myFields; ///< Fields of the header - Status myStatus; ///< Status code - unsigned int myMajorVersion; ///< Major HTTP version - unsigned int myMinorVersion; ///< Minor HTTP version - std::string myBody; ///< Body of the response - }; - - //////////////////////////////////////////////////////////// - /// Default constructor - /// - //////////////////////////////////////////////////////////// - Http(); - - //////////////////////////////////////////////////////////// - /// Construct the Http instance with the target host - /// - /// \param Host : Web server to connect to - /// \param Port : Port to use for connection (0 by default -- use the standard port of the protocol used) - /// - //////////////////////////////////////////////////////////// - Http(const std::string& Host, unsigned short Port = 0); - - //////////////////////////////////////////////////////////// - /// Set the target host - /// - /// \param Host : Web server to connect to - /// \param Port : Port to use for connection (0 by default -- use the standard port of the protocol used) - /// - //////////////////////////////////////////////////////////// - void SetHost(const std::string& Host, unsigned short Port = 0); - - //////////////////////////////////////////////////////////// - /// Send a HTTP request and return the server's response. - /// You must be connected to a host before sending requests. - /// Any missing mandatory header field will be added with an appropriate value. - /// Warning : this function waits for the server's response and may - /// not return instantly; use a thread if you don't want to block your - /// application. - /// - /// \param Req : Request to send - /// \param Timeout : Maximum time to wait, in seconds (0 by default, means no timeout) - /// - /// \return Server's response - /// - //////////////////////////////////////////////////////////// - Response SendRequest(const Request& Req, float Timeout = 0.f); - -private : - - //////////////////////////////////////////////////////////// - // Member data - //////////////////////////////////////////////////////////// - SocketTCP myConnection; ///< Connection to the host - IPAddress myHost; ///< Web host address - std::string myHostName; ///< Web host name - unsigned short myPort; ///< Port used for connection with host -}; - -} // namespace sf - - -#endif // SFML_HTTP_HPP diff --git a/dependencies/SFML/include/SFML/Network/IPAddress.hpp b/dependencies/SFML/include/SFML/Network/IPAddress.hpp deleted file mode 100644 index 638dc478..00000000 --- a/dependencies/SFML/include/SFML/Network/IPAddress.hpp +++ /dev/null @@ -1,231 +0,0 @@ -//////////////////////////////////////////////////////////// -// -// SFML - Simple and Fast Multimedia Library -// Copyright (C) 2007-2009 Laurent Gomila (laurent.gom@gmail.com) -// -// This software is provided 'as-is', without any express or implied warranty. -// In no event will the authors be held liable for any damages arising from the use of this software. -// -// Permission is granted to anyone to use this software for any purpose, -// including commercial applications, and to alter it and redistribute it freely, -// subject to the following restrictions: -// -// 1. The origin of this software must not be misrepresented; -// you must not claim that you wrote the original software. -// If you use this software in a product, an acknowledgment -// in the product documentation would be appreciated but is not required. -// -// 2. Altered source versions must be plainly marked as such, -// and must not be misrepresented as being the original software. -// -// 3. This notice may not be removed or altered from any source distribution. -// -//////////////////////////////////////////////////////////// - -#ifndef SFML_IPADDRESS_HPP -#define SFML_IPADDRESS_HPP - -//////////////////////////////////////////////////////////// -// Headers -//////////////////////////////////////////////////////////// -#include -#include -#include -#include - - -namespace sf -{ -//////////////////////////////////////////////////////////// -/// IPAddress provides easy manipulation of IP v4 addresses -//////////////////////////////////////////////////////////// -class SFML_API IPAddress -{ -public : - - //////////////////////////////////////////////////////////// - /// Default constructor -- constructs an invalid address - /// - //////////////////////////////////////////////////////////// - IPAddress(); - - //////////////////////////////////////////////////////////// - /// Construct the address from a string - /// - /// \param Address : IP address ("xxx.xxx.xxx.xxx") or network name - /// - //////////////////////////////////////////////////////////// - IPAddress(const std::string& Address); - - //////////////////////////////////////////////////////////// - /// Construct the address from a C-style string ; - /// Needed for implicit conversions from literal strings to IPAddress to work - /// - /// \param Address : IP address ("xxx.xxx.xxx.xxx") or network name - /// - //////////////////////////////////////////////////////////// - IPAddress(const char* Address); - - //////////////////////////////////////////////////////////// - /// Construct the address from 4 bytes - /// - /// \param Byte0 : First byte of the address - /// \param Byte1 : Second byte of the address - /// \param Byte2 : Third byte of the address - /// \param Byte3 : Fourth byte of the address - /// - //////////////////////////////////////////////////////////// - IPAddress(Uint8 Byte0, Uint8 Byte1, Uint8 Byte2, Uint8 Byte3); - - //////////////////////////////////////////////////////////// - /// Construct the address from a 32-bits integer - /// - /// \param Address : 4 bytes of the address packed into a 32-bits integer - /// - //////////////////////////////////////////////////////////// - IPAddress(Uint32 Address); - - //////////////////////////////////////////////////////////// - /// Tell if the address is a valid one - /// - /// \return True if address has a valid syntax - /// - //////////////////////////////////////////////////////////// - bool IsValid() const; - - //////////////////////////////////////////////////////////// - /// Get a string representation of the address - /// - /// \return String representation of the IP address ("xxx.xxx.xxx.xxx") - /// - //////////////////////////////////////////////////////////// - std::string ToString() const; - - //////////////////////////////////////////////////////////// - /// Get an integer representation of the address - /// - /// \return 32-bits integer containing the 4 bytes of the address, in system endianness - /// - //////////////////////////////////////////////////////////// - Uint32 ToInteger() const; - - //////////////////////////////////////////////////////////// - /// Get the computer's local IP address (from the LAN point of view) - /// - /// \return Local IP address - /// - //////////////////////////////////////////////////////////// - static IPAddress GetLocalAddress(); - - //////////////////////////////////////////////////////////// - /// Get the computer's public IP address (from the web point of view). - /// The only way to get a public address is to ask it to a - /// distant website ; as a consequence, this function may be - /// very slow -- use it as few as possible ! - /// - /// \param Timeout : Maximum time to wait, in seconds (0 by default : no timeout) - /// - /// \return Public IP address - /// - //////////////////////////////////////////////////////////// - static IPAddress GetPublicAddress(float Timeout = 0.f); - - //////////////////////////////////////////////////////////// - /// Comparison operator == - /// - /// \param Other : Address to compare - /// - /// \return True if *this == Other - /// - //////////////////////////////////////////////////////////// - bool operator ==(const IPAddress& Other) const; - - //////////////////////////////////////////////////////////// - /// Comparison operator != - /// - /// \param Other : Address to compare - /// - /// \return True if *this != Other - /// - //////////////////////////////////////////////////////////// - bool operator !=(const IPAddress& Other) const; - - //////////////////////////////////////////////////////////// - /// Comparison operator < - /// - /// \param Other : Address to compare - /// - /// \return True if *this < Other - /// - //////////////////////////////////////////////////////////// - bool operator <(const IPAddress& Other) const; - - //////////////////////////////////////////////////////////// - /// Comparison operator > - /// - /// \param Other : Address to compare - /// - /// \return True if *this > Other - /// - //////////////////////////////////////////////////////////// - bool operator >(const IPAddress& Other) const; - - //////////////////////////////////////////////////////////// - /// Comparison operator <= - /// - /// \param Other : Address to compare - /// - /// \return True if *this <= Other - /// - //////////////////////////////////////////////////////////// - bool operator <=(const IPAddress& Other) const; - - //////////////////////////////////////////////////////////// - /// Comparison operator >= - /// - /// \param Other : Address to compare - /// - /// \return True if *this >= Other - /// - //////////////////////////////////////////////////////////// - bool operator >=(const IPAddress& Other) const; - - //////////////////////////////////////////////////////////// - // Static member data - //////////////////////////////////////////////////////////// - static const IPAddress LocalHost; ///< Local host address (to connect to the same computer) - -private : - - //////////////////////////////////////////////////////////// - // Member data - //////////////////////////////////////////////////////////// - Uint32 myAddress; ///< Address stored as an unsigned 32 bits integer -}; - -//////////////////////////////////////////////////////////// -/// Operator >> overload to extract an address from an input stream -/// -/// \param Stream : Input stream -/// \param Address : Address to extract -/// -/// \return Reference to the input stream -/// -//////////////////////////////////////////////////////////// -SFML_API std::istream& operator >>(std::istream& Stream, IPAddress& Address); - -//////////////////////////////////////////////////////////// -/// Operator << overload to print an address to an output stream -/// -/// \param Stream : Output stream -/// \param Address : Address to print -/// -/// \return Reference to the output stream -/// -//////////////////////////////////////////////////////////// -SFML_API std::ostream& operator <<(std::ostream& Stream, const IPAddress& Address); - -} // namespace sf - - -#endif // SFML_IPADDRESS_HPP diff --git a/dependencies/SFML/include/SFML/Network/Packet.hpp b/dependencies/SFML/include/SFML/Network/Packet.hpp deleted file mode 100644 index 9c5463f4..00000000 --- a/dependencies/SFML/include/SFML/Network/Packet.hpp +++ /dev/null @@ -1,187 +0,0 @@ -//////////////////////////////////////////////////////////// -// -// SFML - Simple and Fast Multimedia Library -// Copyright (C) 2007-2009 Laurent Gomila (laurent.gom@gmail.com) -// -// This software is provided 'as-is', without any express or implied warranty. -// In no event will the authors be held liable for any damages arising from the use of this software. -// -// Permission is granted to anyone to use this software for any purpose, -// including commercial applications, and to alter it and redistribute it freely, -// subject to the following restrictions: -// -// 1. The origin of this software must not be misrepresented; -// you must not claim that you wrote the original software. -// If you use this software in a product, an acknowledgment -// in the product documentation would be appreciated but is not required. -// -// 2. Altered source versions must be plainly marked as such, -// and must not be misrepresented as being the original software. -// -// 3. This notice may not be removed or altered from any source distribution. -// -//////////////////////////////////////////////////////////// - -#ifndef SFML_PACKET_HPP -#define SFML_PACKET_HPP - -//////////////////////////////////////////////////////////// -// Headers -//////////////////////////////////////////////////////////// -#include -#include -#include - - -namespace sf -{ -//////////////////////////////////////////////////////////// -/// Packet wraps data to send / to receive through the network -//////////////////////////////////////////////////////////// -class SFML_API Packet -{ -public : - - //////////////////////////////////////////////////////////// - /// Default constructor - /// - //////////////////////////////////////////////////////////// - Packet(); - - //////////////////////////////////////////////////////////// - /// Virtual destructor - /// - //////////////////////////////////////////////////////////// - virtual ~Packet(); - - //////////////////////////////////////////////////////////// - /// Append data to the end of the packet - /// - /// \param Data : Pointer to the bytes to append - /// \param SizeInBytes : Number of bytes to append - /// - //////////////////////////////////////////////////////////// - void Append(const void* Data, std::size_t SizeInBytes); - - //////////////////////////////////////////////////////////// - /// Clear the packet data - /// - //////////////////////////////////////////////////////////// - void Clear(); - - //////////////////////////////////////////////////////////// - /// Get a pointer to the data contained in the packet - /// Warning : the returned pointer may be invalid after you - /// append data to the packet - /// - /// \return Pointer to the data - /// - //////////////////////////////////////////////////////////// - const char* GetData() const; - - //////////////////////////////////////////////////////////// - /// Get the size of the data contained in the packet - /// - /// \return Data size, in bytes - /// - //////////////////////////////////////////////////////////// - std::size_t GetDataSize() const; - - //////////////////////////////////////////////////////////// - /// Tell if the reading position has reached the end of the packet - /// - /// \return True if all data have been read into the packet - /// - //////////////////////////////////////////////////////////// - bool EndOfPacket() const; - - //////////////////////////////////////////////////////////// - /// Return the validity of packet - /// - /// \return True if last data extraction from packet was successful - /// - //////////////////////////////////////////////////////////// - operator bool() const; - - //////////////////////////////////////////////////////////// - /// Operator >> overloads to extract data from the packet - /// - //////////////////////////////////////////////////////////// - Packet& operator >>(bool& Data); - Packet& operator >>(Int8& Data); - Packet& operator >>(Uint8& Data); - Packet& operator >>(Int16& Data); - Packet& operator >>(Uint16& Data); - Packet& operator >>(Int32& Data); - Packet& operator >>(Uint32& Data); - Packet& operator >>(float& Data); - Packet& operator >>(double& Data); - Packet& operator >>(char* Data); - Packet& operator >>(std::string& Data); - Packet& operator >>(wchar_t* Data); - Packet& operator >>(std::wstring& Data); - - //////////////////////////////////////////////////////////// - /// Operator << overloads to put data into the packet - /// - //////////////////////////////////////////////////////////// - Packet& operator <<(bool Data); - Packet& operator <<(Int8 Data); - Packet& operator <<(Uint8 Data); - Packet& operator <<(Int16 Data); - Packet& operator <<(Uint16 Data); - Packet& operator <<(Int32 Data); - Packet& operator <<(Uint32 Data); - Packet& operator <<(float Data); - Packet& operator <<(double Data); - Packet& operator <<(const char* Data); - Packet& operator <<(const std::string& Data); - Packet& operator <<(const wchar_t* Data); - Packet& operator <<(const std::wstring& Data); - -private : - - friend class SocketTCP; - friend class SocketUDP; - - //////////////////////////////////////////////////////////// - /// Check if the packet can extract a given size of bytes - /// - /// \param Size : Size to check - /// - /// \return True if Size bytes can be read from the packet's data - /// - //////////////////////////////////////////////////////////// - bool CheckSize(std::size_t Size); - - //////////////////////////////////////////////////////////// - /// Called before the packet is sent to the network - /// - /// \param DataSize : Variable to fill with the size of data to send - /// - /// \return Pointer to the array of bytes to send - /// - //////////////////////////////////////////////////////////// - virtual const char* OnSend(std::size_t& DataSize); - - //////////////////////////////////////////////////////////// - /// Called after the packet has been received from the network - /// - /// \param Data : Pointer to the array of received bytes - /// \param DataSize : Size of the array of bytes - /// - //////////////////////////////////////////////////////////// - virtual void OnReceive(const char* Data, std::size_t DataSize); - - //////////////////////////////////////////////////////////// - // Member data - //////////////////////////////////////////////////////////// - std::vector myData; ///< Data stored in the packet - std::size_t myReadPos; ///< Current reading position in the packet - bool myIsValid; ///< Reading state of the packet -}; - -} // namespace sf - - -#endif // SFML_PACKET_HPP diff --git a/dependencies/SFML/include/SFML/Network/Selector.hpp b/dependencies/SFML/include/SFML/Network/Selector.hpp deleted file mode 100644 index 588a72c1..00000000 --- a/dependencies/SFML/include/SFML/Network/Selector.hpp +++ /dev/null @@ -1,116 +0,0 @@ -//////////////////////////////////////////////////////////// -// -// SFML - Simple and Fast Multimedia Library -// Copyright (C) 2007-2009 Laurent Gomila (laurent.gom@gmail.com) -// -// This software is provided 'as-is', without any express or implied warranty. -// In no event will the authors be held liable for any damages arising from the use of this software. -// -// Permission is granted to anyone to use this software for any purpose, -// including commercial applications, and to alter it and redistribute it freely, -// subject to the following restrictions: -// -// 1. The origin of this software must not be misrepresented; -// you must not claim that you wrote the original software. -// If you use this software in a product, an acknowledgment -// in the product documentation would be appreciated but is not required. -// -// 2. Altered source versions must be plainly marked as such, -// and must not be misrepresented as being the original software. -// -// 3. This notice may not be removed or altered from any source distribution. -// -//////////////////////////////////////////////////////////// - -#ifndef SFML_SELECTOR_HPP -#define SFML_SELECTOR_HPP - -//////////////////////////////////////////////////////////// -// Headers -//////////////////////////////////////////////////////////// -#include -#include -#include -#include - - -namespace sf -{ -//////////////////////////////////////////////////////////// -/// Selector allow reading from multiple sockets -/// without blocking. It's a kind of multiplexer -//////////////////////////////////////////////////////////// -template -class Selector : private SelectorBase -{ -public : - - //////////////////////////////////////////////////////////// - /// Add a socket to watch - /// - /// \param Socket : Socket to add - /// - //////////////////////////////////////////////////////////// - void Add(Type Socket); - - //////////////////////////////////////////////////////////// - /// Remove a socket - /// - /// \param Socket : Socket to remove - /// - //////////////////////////////////////////////////////////// - void Remove(Type Socket); - - //////////////////////////////////////////////////////////// - /// Remove all sockets - /// - //////////////////////////////////////////////////////////// - void Clear(); - - //////////////////////////////////////////////////////////// - /// Wait and collect sockets which are ready for reading. - /// This functions will return either when at least one socket - /// is ready, or when the given time is out - /// - /// \param Timeout : Timeout, in seconds (0 by default : no timeout) - /// - /// \return Number of sockets ready to be read - /// - //////////////////////////////////////////////////////////// - unsigned int Wait(float Timeout = 0.f); - - //////////////////////////////////////////////////////////// - /// After a call to Wait(), get the Index-th socket which is - /// ready for reading. The total number of sockets ready - /// is the integer returned by the previous call to Wait() - /// - /// \param Index : Index of the socket to get - /// - /// \return The Index-th socket - /// - //////////////////////////////////////////////////////////// - Type GetSocketReady(unsigned int Index); - -private : - - //////////////////////////////////////////////////////////// - // Types - //////////////////////////////////////////////////////////// - typedef std::map SocketTable; - - //////////////////////////////////////////////////////////// - // Member data - //////////////////////////////////////////////////////////// - SocketTable mySockets; ///< Table matching the SFML socket instances with their low-level handles -}; - -#include - -// Let's define the two only valid types of Selector -typedef Selector SelectorUDP; -typedef Selector SelectorTCP; - -} // namespace sf - - -#endif // SFML_SELECTOR_HPP diff --git a/dependencies/SFML/include/SFML/Network/Selector.inl b/dependencies/SFML/include/SFML/Network/Selector.inl deleted file mode 100644 index 40ac948a..00000000 --- a/dependencies/SFML/include/SFML/Network/Selector.inl +++ /dev/null @@ -1,97 +0,0 @@ -//////////////////////////////////////////////////////////// -// -// SFML - Simple and Fast Multimedia Library -// Copyright (C) 2007-2009 Laurent Gomila (laurent.gom@gmail.com) -// -// This software is provided 'as-is', without any express or implied warranty. -// In no event will the authors be held liable for any damages arising from the use of this software. -// -// Permission is granted to anyone to use this software for any purpose, -// including commercial applications, and to alter it and redistribute it freely, -// subject to the following restrictions: -// -// 1. The origin of this software must not be misrepresented; -// you must not claim that you wrote the original software. -// If you use this software in a product, an acknowledgment -// in the product documentation would be appreciated but is not required. -// -// 2. Altered source versions must be plainly marked as such, -// and must not be misrepresented as being the original software. -// -// 3. This notice may not be removed or altered from any source distribution. -// -//////////////////////////////////////////////////////////// - - -//////////////////////////////////////////////////////////// -/// Add a socket to watch -//////////////////////////////////////////////////////////// -template -void Selector::Add(Type Socket) -{ - if (Socket.IsValid()) - { - SelectorBase::Add(Socket.mySocket); - mySockets[Socket.mySocket] = Socket; - } -} - - -//////////////////////////////////////////////////////////// -/// Remove a socket -//////////////////////////////////////////////////////////// -template -void Selector::Remove(Type Socket) -{ - typename SocketTable::iterator It = mySockets.find(Socket.mySocket); - if (It != mySockets.end()) - { - SelectorBase::Remove(Socket.mySocket); - mySockets.erase(It); - } -} - - -//////////////////////////////////////////////////////////// -/// Remove all sockets -//////////////////////////////////////////////////////////// -template -void Selector::Clear() -{ - SelectorBase::Clear(); - mySockets.clear(); -} - - -//////////////////////////////////////////////////////////// -/// Wait and collect sockets which are ready for reading. -/// This functions will return either when at least one socket -/// is ready, or when the given time is out -//////////////////////////////////////////////////////////// -template -unsigned int Selector::Wait(float Timeout) -{ - // No socket in the selector : return 0 - if (mySockets.empty()) - return 0; - - return SelectorBase::Wait(Timeout); -} - - -//////////////////////////////////////////////////////////// -/// After a call to Wait(), get the Index-th socket which is -/// ready for reading. The total number of sockets ready -/// is the integer returned by the previous call to Wait() -//////////////////////////////////////////////////////////// -template -Type Selector::GetSocketReady(unsigned int Index) -{ - SocketHelper::SocketType Socket = SelectorBase::GetSocketReady(Index); - - typename SocketTable::const_iterator It = mySockets.find(Socket); - if (It != mySockets.end()) - return It->second; - else - return Type(Socket); -} diff --git a/dependencies/SFML/include/SFML/Network/SelectorBase.hpp b/dependencies/SFML/include/SFML/Network/SelectorBase.hpp deleted file mode 100644 index 4b9e9157..00000000 --- a/dependencies/SFML/include/SFML/Network/SelectorBase.hpp +++ /dev/null @@ -1,112 +0,0 @@ -//////////////////////////////////////////////////////////// -// -// SFML - Simple and Fast Multimedia Library -// Copyright (C) 2007-2009 Laurent Gomila (laurent.gom@gmail.com) -// -// This software is provided 'as-is', without any express or implied warranty. -// In no event will the authors be held liable for any damages arising from the use of this software. -// -// Permission is granted to anyone to use this software for any purpose, -// including commercial applications, and to alter it and redistribute it freely, -// subject to the following restrictions: -// -// 1. The origin of this software must not be misrepresented; -// you must not claim that you wrote the original software. -// If you use this software in a product, an acknowledgment -// in the product documentation would be appreciated but is not required. -// -// 2. Altered source versions must be plainly marked as such, -// and must not be misrepresented as being the original software. -// -// 3. This notice may not be removed or altered from any source distribution. -// -//////////////////////////////////////////////////////////// - -#ifndef SFML_SELECTORBASE_HPP -#define SFML_SELECTORBASE_HPP - -//////////////////////////////////////////////////////////// -// Headers -//////////////////////////////////////////////////////////// -#include -#include -#include - - -namespace sf -{ -//////////////////////////////////////////////////////////// -/// Private base class for selectors. -/// As Selector is a template class, this base is needed so that -/// every system call get compiled in SFML (not inlined) -//////////////////////////////////////////////////////////// -class SFML_API SelectorBase -{ -public : - - //////////////////////////////////////////////////////////// - /// Default constructor - /// - //////////////////////////////////////////////////////////// - SelectorBase(); - - //////////////////////////////////////////////////////////// - /// Add a socket to watch - /// - /// \param Socket : Socket to add - /// - //////////////////////////////////////////////////////////// - void Add(SocketHelper::SocketType Socket); - - //////////////////////////////////////////////////////////// - /// Remove a socket - /// - /// \param Socket : Socket to remove - /// - //////////////////////////////////////////////////////////// - void Remove(SocketHelper::SocketType Socket); - - //////////////////////////////////////////////////////////// - /// Remove all sockets - /// - //////////////////////////////////////////////////////////// - void Clear(); - - //////////////////////////////////////////////////////////// - /// Wait and collect sockets which are ready for reading. - /// This functions will return either when at least one socket - /// is ready, or when the given time is out - /// - /// \param Timeout : Timeout, in seconds (0 by default : no timeout) - /// - /// \return Number of sockets ready to be read - /// - //////////////////////////////////////////////////////////// - unsigned int Wait(float Timeout = 0.f); - - //////////////////////////////////////////////////////////// - /// After a call to Wait(), get the Index-th socket which is - /// ready for reading. The total number of sockets ready - /// is the integer returned by the previous call to Wait() - /// - /// \param Index : Index of the socket to get - /// - /// \return The Index-th socket - /// - //////////////////////////////////////////////////////////// - SocketHelper::SocketType GetSocketReady(unsigned int Index); - -private : - - //////////////////////////////////////////////////////////// - // Member data - //////////////////////////////////////////////////////////// - fd_set mySet; ///< Set of socket to watch - fd_set mySetReady; ///< Set of socket which are ready for reading - int myMaxSocket; ///< Maximum socket index -}; - -} // namespace sf - - -#endif // SFML_SELECTORBASE_HPP diff --git a/dependencies/SFML/include/SFML/Network/SocketHelper.hpp b/dependencies/SFML/include/SFML/Network/SocketHelper.hpp deleted file mode 100644 index 166ce607..00000000 --- a/dependencies/SFML/include/SFML/Network/SocketHelper.hpp +++ /dev/null @@ -1,64 +0,0 @@ -//////////////////////////////////////////////////////////// -// -// SFML - Simple and Fast Multimedia Library -// Copyright (C) 2007-2009 Laurent Gomila (laurent.gom@gmail.com) -// -// This software is provided 'as-is', without any express or implied warranty. -// In no event will the authors be held liable for any damages arising from the use of this software. -// -// Permission is granted to anyone to use this software for any purpose, -// including commercial applications, and to alter it and redistribute it freely, -// subject to the following restrictions: -// -// 1. The origin of this software must not be misrepresented; -// you must not claim that you wrote the original software. -// If you use this software in a product, an acknowledgment -// in the product documentation would be appreciated but is not required. -// -// 2. Altered source versions must be plainly marked as such, -// and must not be misrepresented as being the original software. -// -// 3. This notice may not be removed or altered from any source distribution. -// -//////////////////////////////////////////////////////////// - -#ifndef SFML_SOCKETHELPER_HPP -#define SFML_SOCKETHELPER_HPP - -//////////////////////////////////////////////////////////// -// Headers -//////////////////////////////////////////////////////////// -#include - - -namespace sf -{ -namespace Socket -{ - //////////////////////////////////////////////////////////// - /// Enumeration of status returned by socket functions - //////////////////////////////////////////////////////////// - enum Status - { - Done, ///< The socket has sent / received the data - NotReady, ///< The socket is not ready to send / receive data yet - Disconnected, ///< The TCP socket has been disconnected - Error ///< An unexpected error happened - }; -} - -} // namespace sf - - -#ifdef SFML_SYSTEM_WINDOWS - - #include - -#else - - #include - -#endif - - -#endif // SFML_SOCKETHELPER_HPP diff --git a/dependencies/SFML/include/SFML/Network/SocketTCP.hpp b/dependencies/SFML/include/SFML/Network/SocketTCP.hpp deleted file mode 100644 index 964686a5..00000000 --- a/dependencies/SFML/include/SFML/Network/SocketTCP.hpp +++ /dev/null @@ -1,225 +0,0 @@ -//////////////////////////////////////////////////////////// -// -// SFML - Simple and Fast Multimedia Library -// Copyright (C) 2007-2009 Laurent Gomila (laurent.gom@gmail.com) -// -// This software is provided 'as-is', without any express or implied warranty. -// In no event will the authors be held liable for any damages arising from the use of this software. -// -// Permission is granted to anyone to use this software for any purpose, -// including commercial applications, and to alter it and redistribute it freely, -// subject to the following restrictions: -// -// 1. The origin of this software must not be misrepresented; -// you must not claim that you wrote the original software. -// If you use this software in a product, an acknowledgment -// in the product documentation would be appreciated but is not required. -// -// 2. Altered source versions must be plainly marked as such, -// and must not be misrepresented as being the original software. -// -// 3. This notice may not be removed or altered from any source distribution. -// -//////////////////////////////////////////////////////////// - -#ifndef SFML_SOCKETTCP_HPP -#define SFML_SOCKETTCP_HPP - -//////////////////////////////////////////////////////////// -// Headers -//////////////////////////////////////////////////////////// -#include -#include - - -namespace sf -{ -class Packet; -class IPAddress; -template class Selector; - -//////////////////////////////////////////////////////////// -/// SocketTCP wraps a socket using TCP protocol to -/// send data safely (but a bit slower) -//////////////////////////////////////////////////////////// -class SFML_API SocketTCP -{ -public : - - //////////////////////////////////////////////////////////// - /// Default constructor - /// - //////////////////////////////////////////////////////////// - SocketTCP(); - - //////////////////////////////////////////////////////////// - /// Change the blocking state of the socket. - /// The default behaviour of a socket is blocking - /// - /// \param Blocking : Pass true to set the socket as blocking, or false for non-blocking - /// - //////////////////////////////////////////////////////////// - void SetBlocking(bool Blocking); - - //////////////////////////////////////////////////////////// - /// Connect to another computer on a specified port - /// - /// \param Port : Port to use for transfers (warning : ports < 1024 are reserved) - /// \param HostAddress : IP Address of the host to connect to - /// \param Timeout : Maximum time to wait, in seconds (0 by default : no timeout) (this parameter is ignored for non-blocking sockets) - /// - /// \return True if operation has been successful - /// - //////////////////////////////////////////////////////////// - Socket::Status Connect(unsigned short Port, const IPAddress& HostAddress, float Timeout = 0.f); - - //////////////////////////////////////////////////////////// - /// Listen to a specified port for incoming data or connections - /// - /// \param Port : Port to listen to - /// - /// \return True if operation has been successful - /// - //////////////////////////////////////////////////////////// - bool Listen(unsigned short Port); - - //////////////////////////////////////////////////////////// - /// Wait for a connection (must be listening to a port). - /// This function will block if the socket is blocking - /// - /// \param Connected : Socket containing the connection with the connected client - /// \param Address : Pointer to an address to fill with client infos (NULL by default) - /// - /// \return Status code - /// - //////////////////////////////////////////////////////////// - Socket::Status Accept(SocketTCP& Connected, IPAddress* Address = NULL); - - //////////////////////////////////////////////////////////// - /// Send an array of bytes to the host (must be connected first) - /// - /// \param Data : Pointer to the bytes to send - /// \param Size : Number of bytes to send - /// - /// \return Status code - /// - //////////////////////////////////////////////////////////// - Socket::Status Send(const char* Data, std::size_t Size); - - //////////////////////////////////////////////////////////// - /// Receive an array of bytes from the host (must be connected first). - /// This function will block if the socket is blocking - /// - /// \param Data : Pointer to a byte array to fill (make sure it is big enough) - /// \param MaxSize : Maximum number of bytes to read - /// \param SizeReceived : Number of bytes received - /// - /// \return Status code - /// - //////////////////////////////////////////////////////////// - Socket::Status Receive(char* Data, std::size_t MaxSize, std::size_t& SizeReceived); - - //////////////////////////////////////////////////////////// - /// Send a packet of data to the host (must be connected first) - /// - /// \param PacketToSend : Packet to send - /// - /// \return Status code - /// - //////////////////////////////////////////////////////////// - Socket::Status Send(Packet& PacketToSend); - - //////////////////////////////////////////////////////////// - /// Receive a packet from the host (must be connected first). - /// This function will block if the socket is blocking - /// - /// \param PacketToReceive : Packet to fill with received data - /// - /// \return Status code - /// - //////////////////////////////////////////////////////////// - Socket::Status Receive(Packet& PacketToReceive); - - //////////////////////////////////////////////////////////// - /// Close the socket - /// - /// \return True if operation has been successful - /// - //////////////////////////////////////////////////////////// - bool Close(); - - //////////////////////////////////////////////////////////// - /// Check if the socket is in a valid state ; this function - /// can be called any time to check if the socket is OK - /// - /// \return True if the socket is valid - /// - //////////////////////////////////////////////////////////// - bool IsValid() const; - - //////////////////////////////////////////////////////////// - /// Comparison operator == - /// - /// \param Other : Socket to compare - /// - /// \return True if *this == Other - /// - //////////////////////////////////////////////////////////// - bool operator ==(const SocketTCP& Other) const; - - //////////////////////////////////////////////////////////// - /// Comparison operator != - /// - /// \param Other : Socket to compare - /// - /// \return True if *this != Other - /// - //////////////////////////////////////////////////////////// - bool operator !=(const SocketTCP& Other) const; - - //////////////////////////////////////////////////////////// - /// Comparison operator <. - /// Provided for compatibility with standard containers, as - /// comparing two sockets doesn't make much sense... - /// - /// \param Other : Socket to compare - /// - /// \return True if *this < Other - /// - //////////////////////////////////////////////////////////// - bool operator <(const SocketTCP& Other) const; - -private : - - friend class Selector; - - //////////////////////////////////////////////////////////// - /// Construct the socket from a socket descriptor - /// (for internal use only) - /// - /// \param Descriptor : Socket descriptor - /// - //////////////////////////////////////////////////////////// - SocketTCP(SocketHelper::SocketType Descriptor); - - //////////////////////////////////////////////////////////// - /// Create the socket - /// - /// \param Descriptor : System socket descriptor to use (0 by default -- create a new socket) - /// - //////////////////////////////////////////////////////////// - void Create(SocketHelper::SocketType Descriptor = 0); - - //////////////////////////////////////////////////////////// - // Member data - //////////////////////////////////////////////////////////// - SocketHelper::SocketType mySocket; ///< Socket descriptor - std::vector myPendingPacket; ///< Data of the current pending packet, if any (in non-blocking mode) - Int32 myPendingPacketSize; ///< Size of the current pending packet, if any (in non-blocking mode) - bool myIsBlocking; ///< Is the socket blocking or non-blocking ? -}; - -} // namespace sf - - -#endif // SFML_SOCKETTCP_HPP diff --git a/dependencies/SFML/include/SFML/Network/SocketUDP.hpp b/dependencies/SFML/include/SFML/Network/SocketUDP.hpp deleted file mode 100644 index 37df3f7d..00000000 --- a/dependencies/SFML/include/SFML/Network/SocketUDP.hpp +++ /dev/null @@ -1,226 +0,0 @@ -//////////////////////////////////////////////////////////// -// -// SFML - Simple and Fast Multimedia Library -// Copyright (C) 2007-2009 Laurent Gomila (laurent.gom@gmail.com) -// -// This software is provided 'as-is', without any express or implied warranty. -// In no event will the authors be held liable for any damages arising from the use of this software. -// -// Permission is granted to anyone to use this software for any purpose, -// including commercial applications, and to alter it and redistribute it freely, -// subject to the following restrictions: -// -// 1. The origin of this software must not be misrepresented; -// you must not claim that you wrote the original software. -// If you use this software in a product, an acknowledgment -// in the product documentation would be appreciated but is not required. -// -// 2. Altered source versions must be plainly marked as such, -// and must not be misrepresented as being the original software. -// -// 3. This notice may not be removed or altered from any source distribution. -// -//////////////////////////////////////////////////////////// - -#ifndef SFML_SOCKETUDP_HPP -#define SFML_SOCKETUDP_HPP - -//////////////////////////////////////////////////////////// -// Headers -//////////////////////////////////////////////////////////// -#include -#include - - -namespace sf -{ -class Packet; -class IPAddress; -template class Selector; - -//////////////////////////////////////////////////////////// -/// SocketUDP wraps a socket using UDP protocol to -/// send data fastly (but with less safety) -//////////////////////////////////////////////////////////// -class SFML_API SocketUDP -{ -public : - - //////////////////////////////////////////////////////////// - /// Default constructor - /// - //////////////////////////////////////////////////////////// - SocketUDP(); - - //////////////////////////////////////////////////////////// - /// Change the blocking state of the socket. - /// The default behaviour of a socket is blocking - /// - /// \param Blocking : Pass true to set the socket as blocking, or false for non-blocking - /// - //////////////////////////////////////////////////////////// - void SetBlocking(bool Blocking); - - //////////////////////////////////////////////////////////// - /// Bind the socket to a specific port - /// - /// \param Port : Port to bind the socket to - /// - /// \return True if operation has been successful - /// - //////////////////////////////////////////////////////////// - bool Bind(unsigned short Port); - - //////////////////////////////////////////////////////////// - /// Unbind the socket from its previous port, if any - /// - /// \return True if operation has been successful - /// - //////////////////////////////////////////////////////////// - bool Unbind(); - - //////////////////////////////////////////////////////////// - /// Send an array of bytes - /// - /// \param Data : Pointer to the bytes to send - /// \param Size : Number of bytes to send - /// \param Address : Address of the computer to send the packet to - /// \param Port : Port to send the data to - /// - /// \return Status code - /// - //////////////////////////////////////////////////////////// - Socket::Status Send(const char* Data, std::size_t Size, const IPAddress& Address, unsigned short Port); - - //////////////////////////////////////////////////////////// - /// Receive an array of bytes. - /// This function will block if the socket is blocking - /// - /// \param Data : Pointer to a byte array to fill (make sure it is big enough) - /// \param MaxSize : Maximum number of bytes to read - /// \param SizeReceived : Number of bytes received - /// \param Address : Address of the computer which sent the data - /// \param Port : Port on which the remote computer sent the data - /// - /// \return Status code - /// - //////////////////////////////////////////////////////////// - Socket::Status Receive(char* Data, std::size_t MaxSize, std::size_t& SizeReceived, IPAddress& Address, unsigned short& Port); - - //////////////////////////////////////////////////////////// - /// Send a packet of data - /// - /// \param PacketToSend : Packet to send - /// \param Address : Address of the computer to send the packet to - /// \param Port : Port to send the data to - /// - /// \return Status code - /// - //////////////////////////////////////////////////////////// - Socket::Status Send(Packet& PacketToSend, const IPAddress& Address, unsigned short Port); - - //////////////////////////////////////////////////////////// - /// Receive a packet. - /// This function will block if the socket is blocking - /// - /// \param PacketToReceive : Packet to fill with received data - /// \param Address : Address of the computer which sent the packet - /// \param Port : Port on which the remote computer sent the data - /// - /// \return Status code - /// - //////////////////////////////////////////////////////////// - Socket::Status Receive(Packet& PacketToReceive, IPAddress& Address, unsigned short& Port); - - //////////////////////////////////////////////////////////// - /// Close the socket - /// - /// \return True if operation has been successful - /// - //////////////////////////////////////////////////////////// - bool Close(); - - //////////////////////////////////////////////////////////// - /// Check if the socket is in a valid state ; this function - /// can be called any time to check if the socket is OK - /// - /// \return True if the socket is valid - /// - //////////////////////////////////////////////////////////// - bool IsValid() const; - - //////////////////////////////////////////////////////////// - /// Get the port the socket is currently bound to - /// - /// \return Current port (0 means the socket is not bound) - /// - //////////////////////////////////////////////////////////// - unsigned short GetPort() const; - - //////////////////////////////////////////////////////////// - /// Comparison operator == - /// - /// \param Other : Socket to compare - /// - /// \return True if *this == Other - /// - //////////////////////////////////////////////////////////// - bool operator ==(const SocketUDP& Other) const; - - //////////////////////////////////////////////////////////// - /// Comparison operator != - /// - /// \param Other : Socket to compare - /// - /// \return True if *this != Other - /// - //////////////////////////////////////////////////////////// - bool operator !=(const SocketUDP& Other) const; - - //////////////////////////////////////////////////////////// - /// Comparison operator <. - /// Provided for compatibility with standard containers, as - /// comparing two sockets doesn't make much sense... - /// - /// \param Other : Socket to compare - /// - /// \return True if *this < Other - /// - //////////////////////////////////////////////////////////// - bool operator <(const SocketUDP& Other) const; - -private : - - friend class Selector; - - //////////////////////////////////////////////////////////// - /// Construct the socket from a socket descriptor - /// (for internal use only) - /// - /// \param Descriptor : Socket descriptor - /// - //////////////////////////////////////////////////////////// - SocketUDP(SocketHelper::SocketType Descriptor); - - //////////////////////////////////////////////////////////// - /// Create the socket - /// - /// \param Descriptor : System socket descriptor to use (0 by default -- create a new socket) - /// - //////////////////////////////////////////////////////////// - void Create(SocketHelper::SocketType Descriptor = 0); - - //////////////////////////////////////////////////////////// - // Member data - //////////////////////////////////////////////////////////// - SocketHelper::SocketType mySocket; ///< Socket identifier - unsigned short myPort; ///< Port to which the socket is bound - std::vector myPendingPacket; ///< Data of the current pending packet, if any (in non-blocking mode) - Int32 myPendingPacketSize; ///< Size of the current pending packet, if any (in non-blocking mode) - bool myIsBlocking; ///< Is the socket blocking or non-blocking ? -}; - -} // namespace sf - - -#endif // SFML_SOCKETUDP_HPP diff --git a/dependencies/SFML/include/SFML/Network/Sockets.hpp b/dependencies/SFML/include/SFML/Network/Sockets.hpp deleted file mode 100644 index 1359cb97..00000000 --- a/dependencies/SFML/include/SFML/Network/Sockets.hpp +++ /dev/null @@ -1,45 +0,0 @@ -//////////////////////////////////////////////////////////// -// -// SFML - Simple and Fast Multimedia Library -// Copyright (C) 2007-2009 Laurent Gomila (laurent.gom@gmail.com) -// -// This software is provided 'as-is', without any express or implied warranty. -// In no event will the authors be held liable for any damages arising from the use of this software. -// -// Permission is granted to anyone to use this software for any purpose, -// including commercial applications, and to alter it and redistribute it freely, -// subject to the following restrictions: -// -// 1. The origin of this software must not be misrepresented; -// you must not claim that you wrote the original software. -// If you use this software in a product, an acknowledgment -// in the product documentation would be appreciated but is not required. -// -// 2. Altered source versions must be plainly marked as such, -// and must not be misrepresented as being the original software. -// -// 3. This notice may not be removed or altered from any source distribution. -// -//////////////////////////////////////////////////////////// - -#ifndef SFML_SOCKETS_HPP -#define SFML_SOCKETS_HPP - -//////////////////////////////////////////////////////////// -// Headers -//////////////////////////////////////////////////////////// -#include - - -#ifdef SFML_SYSTEM_WINDOWS - - #include - -#else - - #include - -#endif - - -#endif // SFML_SOCKETS_HPP diff --git a/dependencies/SFML/include/SFML/Network/Unix/SocketHelper.hpp b/dependencies/SFML/include/SFML/Network/Unix/SocketHelper.hpp deleted file mode 100644 index 1068cd85..00000000 --- a/dependencies/SFML/include/SFML/Network/Unix/SocketHelper.hpp +++ /dev/null @@ -1,96 +0,0 @@ -//////////////////////////////////////////////////////////// -// -// SFML - Simple and Fast Multimedia Library -// Copyright (C) 2007 Laurent Gomila (laurent.gom@gmail.com) -// -// This software is provided 'as-is', without any express or implied warranty. -// In no event will the authors be held liable for any damages arising from the use of this software. -// -// Permission is granted to anyone to use this software for any purpose, -// including commercial applications, and to alter it and redistribute it freely, -// subject to the following restrictions: -// -// 1. The origin of this software must not be misrepresented; -// you must not claim that you wrote the original software. -// If you use this software in a product, an acknowledgment -// in the product documentation would be appreciated but is not required. -// -// 2. Altered source versions must be plainly marked as such, -// and must not be misrepresented as being the original software. -// -// 3. This notice may not be removed or altered from any source distribution. -// -//////////////////////////////////////////////////////////// - -#ifndef SFML_SOCKETHELPERUNIX_HPP -#define SFML_SOCKETHELPERUNIX_HPP - -//////////////////////////////////////////////////////////// -// Headers -//////////////////////////////////////////////////////////// -#include -#include -#include -#include -#include -#include -#include - - -namespace sf -{ -//////////////////////////////////////////////////////////// -/// This class defines helper functions to do all the -/// non-portable socket stuff. This class is meant for internal -/// use only -//////////////////////////////////////////////////////////// -class SFML_API SocketHelper -{ -public : - - //////////////////////////////////////////////////////////// - // Define some socket types - //////////////////////////////////////////////////////////// - typedef int SocketType; - typedef socklen_t LengthType; - - //////////////////////////////////////////////////////////// - /// Return the value of the invalid socket - /// - /// \return Unique value of the invalid socket - /// - //////////////////////////////////////////////////////////// - static SocketType InvalidSocket(); - - //////////////////////////////////////////////////////////// - /// Close / destroy a socket - /// - /// \param Socket : Socket to close - /// - /// \return True on success - /// - //////////////////////////////////////////////////////////// - static bool Close(SocketType Socket); - - //////////////////////////////////////////////////////////// - /// Set a socket as blocking or non-blocking - /// - /// \param Socket : Socket to modify - /// \param Block : New blocking state of the socket - /// - //////////////////////////////////////////////////////////// - static void SetBlocking(SocketType Socket, bool Block); - - //////////////////////////////////////////////////////////// - /// Get the last socket error status - /// - /// \return Status corresponding to the last socket error - /// - //////////////////////////////////////////////////////////// - static Socket::Status GetErrorStatus(); -}; - -} // namespace sf - - -#endif // SFML_SOCKETHELPERUNIX_HPP diff --git a/dependencies/SFML/include/SFML/Network/Win32/SocketHelper.hpp b/dependencies/SFML/include/SFML/Network/Win32/SocketHelper.hpp deleted file mode 100644 index 6199c0a2..00000000 --- a/dependencies/SFML/include/SFML/Network/Win32/SocketHelper.hpp +++ /dev/null @@ -1,90 +0,0 @@ -//////////////////////////////////////////////////////////// -// -// SFML - Simple and Fast Multimedia Library -// Copyright (C) 2007-2009 Laurent Gomila (laurent.gom@gmail.com) -// -// This software is provided 'as-is', without any express or implied warranty. -// In no event will the authors be held liable for any damages arising from the use of this software. -// -// Permission is granted to anyone to use this software for any purpose, -// including commercial applications, and to alter it and redistribute it freely, -// subject to the following restrictions: -// -// 1. The origin of this software must not be misrepresented; -// you must not claim that you wrote the original software. -// If you use this software in a product, an acknowledgment -// in the product documentation would be appreciated but is not required. -// -// 2. Altered source versions must be plainly marked as such, -// and must not be misrepresented as being the original software. -// -// 3. This notice may not be removed or altered from any source distribution. -// -//////////////////////////////////////////////////////////// - -#ifndef SFML_SOCKETHELPERWIN32_HPP -#define SFML_SOCKETHELPERWIN32_HPP - -//////////////////////////////////////////////////////////// -// Headers -//////////////////////////////////////////////////////////// -#include - - -namespace sf -{ -//////////////////////////////////////////////////////////// -/// This class defines helper functions to do all the -/// non-portable socket stuff. This class is meant for internal -/// use only -//////////////////////////////////////////////////////////// -class SFML_API SocketHelper -{ -public : - - //////////////////////////////////////////////////////////// - // Define some socket types - //////////////////////////////////////////////////////////// - typedef SOCKET SocketType; - typedef int LengthType; - - //////////////////////////////////////////////////////////// - /// Return the value of the invalid socket - /// - /// \return Unique value of the invalid socket - /// - //////////////////////////////////////////////////////////// - static SocketType InvalidSocket(); - - //////////////////////////////////////////////////////////// - /// Close / destroy a socket - /// - /// \param Socket : Socket to close - /// - /// \return True on success - /// - //////////////////////////////////////////////////////////// - static bool Close(SocketType Socket); - - //////////////////////////////////////////////////////////// - /// Set a socket as blocking or non-blocking - /// - /// \param Socket : Socket to modify - /// \param Block : New blocking state of the socket - /// - //////////////////////////////////////////////////////////// - static void SetBlocking(SocketType Socket, bool Block); - - //////////////////////////////////////////////////////////// - /// Get the last socket error status - /// - /// \return Status corresponding to the last socket error - /// - //////////////////////////////////////////////////////////// - static Socket::Status GetErrorStatus(); -}; - -} // namespace sf - - -#endif // SFML_SOCKETHELPERWIN32_HPP diff --git a/dependencies/SFML/include/SFML/System.hpp b/dependencies/SFML/include/SFML/System.hpp deleted file mode 100644 index 769262b4..00000000 --- a/dependencies/SFML/include/SFML/System.hpp +++ /dev/null @@ -1,43 +0,0 @@ -//////////////////////////////////////////////////////////// -// -// SFML - Simple and Fast Multimedia Library -// Copyright (C) 2007-2009 Laurent Gomila (laurent.gom@gmail.com) -// -// This software is provided 'as-is', without any express or implied warranty. -// In no event will the authors be held liable for any damages arising from the use of this software. -// -// Permission is granted to anyone to use this software for any purpose, -// including commercial applications, and to alter it and redistribute it freely, -// subject to the following restrictions: -// -// 1. The origin of this software must not be misrepresented; -// you must not claim that you wrote the original software. -// If you use this software in a product, an acknowledgment -// in the product documentation would be appreciated but is not required. -// -// 2. Altered source versions must be plainly marked as such, -// and must not be misrepresented as being the original software. -// -// 3. This notice may not be removed or altered from any source distribution. -// -//////////////////////////////////////////////////////////// - -#ifndef SFML_SYSTEM_HPP -#define SFML_SYSTEM_HPP - -//////////////////////////////////////////////////////////// -// Headers -//////////////////////////////////////////////////////////// - -#include -// #include -// #include -// #include -// #include -// #include -// #include -// #include -// #include -// #include - -#endif // SFML_SYSTEM_HPP diff --git a/dependencies/SFML/include/SFML/System/NonCopyable.hpp b/dependencies/SFML/include/SFML/System/NonCopyable.hpp deleted file mode 100644 index 3ac6719f..00000000 --- a/dependencies/SFML/include/SFML/System/NonCopyable.hpp +++ /dev/null @@ -1,70 +0,0 @@ -//////////////////////////////////////////////////////////// -// -// SFML - Simple and Fast Multimedia Library -// Copyright (C) 2007-2009 Laurent Gomila (laurent.gom@gmail.com) -// -// This software is provided 'as-is', without any express or implied warranty. -// In no event will the authors be held liable for any damages arising from the use of this software. -// -// Permission is granted to anyone to use this software for any purpose, -// including commercial applications, and to alter it and redistribute it freely, -// subject to the following restrictions: -// -// 1. The origin of this software must not be misrepresented; -// you must not claim that you wrote the original software. -// If you use this software in a product, an acknowledgment -// in the product documentation would be appreciated but is not required. -// -// 2. Altered source versions must be plainly marked as such, -// and must not be misrepresented as being the original software. -// -// 3. This notice may not be removed or altered from any source distribution. -// -//////////////////////////////////////////////////////////// - -#ifndef SFML_NONCOPYABLE_HPP -#define SFML_NONCOPYABLE_HPP - -//////////////////////////////////////////////////////////// -// Headers -//////////////////////////////////////////////////////////// -#include - - -namespace sf -{ -//////////////////////////////////////////////////////////// -/// Utility base class to easily declare non-copyable classes. -/// Just inherit from NonCopyable to get a non-copyable class -//////////////////////////////////////////////////////////// -struct SFML_API NonCopyable -{ -protected : - - //////////////////////////////////////////////////////////// - /// The default constructor won't be generated, so provide it - /// - //////////////////////////////////////////////////////////// - NonCopyable() {} - -private : - - //////////////////////////////////////////////////////////// - /// Copy constructor : declare it private and don't implement - /// it to prevent from calling it - /// - //////////////////////////////////////////////////////////// - NonCopyable(const NonCopyable&); - - //////////////////////////////////////////////////////////// - /// Assignment operator : declare it private and don't implement - /// it to prevent from calling it - /// - //////////////////////////////////////////////////////////// - NonCopyable& operator =(const NonCopyable&); -}; - -} // namespace sf - - -#endif // SFML_NONCOPYABLE_HPP diff --git a/dependencies/SFML/src/SFML/Network/Ftp.cpp b/dependencies/SFML/src/SFML/Network/Ftp.cpp deleted file mode 100644 index 85146d4e..00000000 --- a/dependencies/SFML/src/SFML/Network/Ftp.cpp +++ /dev/null @@ -1,709 +0,0 @@ -//////////////////////////////////////////////////////////// -// -// SFML - Simple and Fast Multimedia Library -// Copyright (C) 2007-2009 Laurent Gomila (laurent.gom@gmail.com) -// -// This software is provided 'as-is', without any express or implied warranty. -// In no event will the authors be held liable for any damages arising from the use of this software. -// -// Permission is granted to anyone to use this software for any purpose, -// including commercial applications, and to alter it and redistribute it freely, -// subject to the following restrictions: -// -// 1. The origin of this software must not be misrepresented; -// you must not claim that you wrote the original software. -// If you use this software in a product, an acknowledgment -// in the product documentation would be appreciated but is not required. -// -// 2. Altered source versions must be plainly marked as such, -// and must not be misrepresented as being the original software. -// -// 3. This notice may not be removed or altered from any source distribution. -// -//////////////////////////////////////////////////////////// - -//////////////////////////////////////////////////////////// -// Headers -//////////////////////////////////////////////////////////// -#include -#include -#include -#include -#include -#include - - -namespace sf -{ -//////////////////////////////////////////////////////////// -// Utility class for exchanging stuff with the server -// on the data channel -//////////////////////////////////////////////////////////// -class Ftp::DataChannel : NonCopyable -{ -public : - - //////////////////////////////////////////////////////////// - // Constructor - //////////////////////////////////////////////////////////// - DataChannel(Ftp& Owner); - - //////////////////////////////////////////////////////////// - // Destructor - //////////////////////////////////////////////////////////// - ~DataChannel(); - - //////////////////////////////////////////////////////////// - // Open the data channel using the specified mode and port - //////////////////////////////////////////////////////////// - Ftp::Response Open(Ftp::TransferMode Mode); - - //////////////////////////////////////////////////////////// - // Send data on the data channel - //////////////////////////////////////////////////////////// - void Send(const std::vector& Data); - - //////////////////////////////////////////////////////////// - // Receive data on the data channel until it is closed - //////////////////////////////////////////////////////////// - void Receive(std::vector& Data); - -private : - - //////////////////////////////////////////////////////////// - // Member data - //////////////////////////////////////////////////////////// - Ftp& myFtp; ///< Reference to the owner Ftp instance - SocketTCP myDataSocket; ///< Socket used for data transfers -}; - - -//////////////////////////////////////////////////////////// -/// Default constructor -//////////////////////////////////////////////////////////// -Ftp::Response::Response(Status Code, const std::string& Message) : -myStatus (Code), -myMessage(Message) -{ - -} - - -//////////////////////////////////////////////////////////// -/// Convenience function to check if the response status code -/// means a success -//////////////////////////////////////////////////////////// -bool Ftp::Response::IsOk() const -{ - return myStatus < 400; -} - - -//////////////////////////////////////////////////////////// -/// Get the response status code -//////////////////////////////////////////////////////////// -Ftp::Response::Status Ftp::Response::GetStatus() const -{ - return myStatus; -} - - -//////////////////////////////////////////////////////////// -/// Get the full message contained in the response -//////////////////////////////////////////////////////////// -const std::string& Ftp::Response::GetMessage() const -{ - return myMessage; -} - - -//////////////////////////////////////////////////////////// -/// Default constructor -//////////////////////////////////////////////////////////// -Ftp::DirectoryResponse::DirectoryResponse(Ftp::Response Resp) : -Ftp::Response(Resp) -{ - if (IsOk()) - { - // Extract the directory from the server response - std::string::size_type Begin = Resp.GetMessage().find('"', 0); - std::string::size_type End = Resp.GetMessage().find('"', Begin + 1); - myDirectory = Resp.GetMessage().substr(Begin + 1, End - Begin - 1); - } -} - - -//////////////////////////////////////////////////////////// -/// Get the directory returned in the response -//////////////////////////////////////////////////////////// -const std::string& Ftp::DirectoryResponse::GetDirectory() const -{ - return myDirectory; -} - - -//////////////////////////////////////////////////////////// -/// Default constructor -//////////////////////////////////////////////////////////// -Ftp::ListingResponse::ListingResponse(Ftp::Response Resp, const std::vector& Data) : -Ftp::Response(Resp) -{ - if (IsOk()) - { - // Fill the array of strings - std::string Paths(Data.begin(), Data.end()); - std::string::size_type LastPos = 0; - for (std::string::size_type Pos = Paths.find("\r\n"); Pos != std::string::npos; Pos = Paths.find("\r\n", LastPos)) - { - myFilenames.push_back(Paths.substr(LastPos, Pos - LastPos)); - LastPos = Pos + 2; - } - } -} - - -//////////////////////////////////////////////////////////// -/// Get the number of filenames in the listing -//////////////////////////////////////////////////////////// -std::size_t Ftp::ListingResponse::GetCount() const -{ - return myFilenames.size(); -} - - -//////////////////////////////////////////////////////////// -/// Get the Index-th filename in the directory -//////////////////////////////////////////////////////////// -const std::string& Ftp::ListingResponse::GetFilename(std::size_t Index) const -{ - return myFilenames[Index]; -} - - -//////////////////////////////////////////////////////////// -/// Destructor -- close the connection with the server -//////////////////////////////////////////////////////////// -Ftp::~Ftp() -{ - Disconnect(); -} - - -//////////////////////////////////////////////////////////// -/// Connect to the specified FTP server -//////////////////////////////////////////////////////////// -Ftp::Response Ftp::Connect(const IPAddress& Server, unsigned short Port, float Timeout) -{ - // Connect to the server - if (myCommandSocket.Connect(Port, Server, Timeout) != Socket::Done) - return Response(Response::ConnectionFailed); - - // Get the response to the connection - return GetResponse(); -} - - -//////////////////////////////////////////////////////////// -/// Log in using anonymous account -//////////////////////////////////////////////////////////// -Ftp::Response Ftp::Login() -{ - return Login("anonymous", "user@sfml-dev.org"); -} - - -//////////////////////////////////////////////////////////// -/// Log in using a username and a password -//////////////////////////////////////////////////////////// -Ftp::Response Ftp::Login(const std::string& UserName, const std::string& Password) -{ - Response Resp = SendCommand("USER", UserName); - if (Resp.IsOk()) - Resp = SendCommand("PASS", Password); - - return Resp; -} - - -//////////////////////////////////////////////////////////// -/// Close the connection with FTP server -//////////////////////////////////////////////////////////// -Ftp::Response Ftp::Disconnect() -{ - // Send the exit command - Response Resp = SendCommand("QUIT"); - if (Resp.IsOk()) - myCommandSocket.Close(); - - return Resp; -} - - -//////////////////////////////////////////////////////////// -/// Send a null command just to prevent from being disconnected -//////////////////////////////////////////////////////////// -Ftp::Response Ftp::KeepAlive() -{ - return SendCommand("NOOP"); -} - - -//////////////////////////////////////////////////////////// -/// Get the current working directory -//////////////////////////////////////////////////////////// -Ftp::DirectoryResponse Ftp::GetWorkingDirectory() -{ - return DirectoryResponse(SendCommand("PWD")); -} - - -//////////////////////////////////////////////////////////// -/// Get the contents of the given directory -/// (subdirectories and files) -//////////////////////////////////////////////////////////// -Ftp::ListingResponse Ftp::GetDirectoryListing(const std::string& Directory) -{ - // Open a data channel on default port (20) using ASCII transfer mode - std::vector DirData; - DataChannel Data(*this); - Response Resp = Data.Open(Ascii); - if (Resp.IsOk()) - { - // Tell the server to send us the listing - Resp = SendCommand("NLST", Directory); - if (Resp.IsOk()) - { - // Receive the listing - Data.Receive(DirData); - - // Get the response from the server - Resp = GetResponse(); - } - } - - return ListingResponse(Resp, DirData); -} - - -//////////////////////////////////////////////////////////// -/// Change the current working directory -//////////////////////////////////////////////////////////// -Ftp::Response Ftp::ChangeDirectory(const std::string& Directory) -{ - return SendCommand("CWD", Directory); -} - - -//////////////////////////////////////////////////////////// -/// Go to the parent directory of the current one -//////////////////////////////////////////////////////////// -Ftp::Response Ftp::ParentDirectory() -{ - return SendCommand("CDUP"); -} - - -//////////////////////////////////////////////////////////// -/// Create a new directory -//////////////////////////////////////////////////////////// -Ftp::Response Ftp::MakeDirectory(const std::string& Name) -{ - return SendCommand("MKD", Name); -} - - -//////////////////////////////////////////////////////////// -/// Remove an existing directory -//////////////////////////////////////////////////////////// -Ftp::Response Ftp::DeleteDirectory(const std::string& Name) -{ - return SendCommand("RMD", Name); -} - - -//////////////////////////////////////////////////////////// -/// Rename a file -//////////////////////////////////////////////////////////// -Ftp::Response Ftp::RenameFile(const std::string& File, const std::string& NewName) -{ - Response Resp = SendCommand("RNFR", File); - if (Resp.IsOk()) - Resp = SendCommand("RNTO", NewName); - - return Resp; -} - - -//////////////////////////////////////////////////////////// -/// Remove an existing file -//////////////////////////////////////////////////////////// -Ftp::Response Ftp::DeleteFile(const std::string& Name) -{ - return SendCommand("DELE", Name); -} - - -//////////////////////////////////////////////////////////// -/// Download a file from the server -//////////////////////////////////////////////////////////// -Ftp::Response Ftp::Download(const std::string& DistantFile, const std::string& DestPath, TransferMode Mode) -{ - // Open a data channel using the given transfer mode - DataChannel Data(*this); - Response Resp = Data.Open(Mode); - if (Resp.IsOk()) - { - // Tell the server to start the transfer - Resp = SendCommand("RETR", DistantFile); - if (Resp.IsOk()) - { - // Receive the file data - std::vector FileData; - Data.Receive(FileData); - - // Get the response from the server - Resp = GetResponse(); - if (Resp.IsOk()) - { - // Extract the filename from the file path - std::string Filename = DistantFile; - std::string::size_type Pos = Filename.find_last_of("/\\"); - if (Pos != std::string::npos) - Filename = Filename.substr(Pos + 1); - - // Make sure the destination path ends with a slash - std::string Path = DestPath; - if (!Path.empty() && (Path[Path.size() - 1] != '\\') && (Path[Path.size() - 1] != '/')) - Path += "/"; - - // Create the file and copy the received data into it - std::ofstream File((Path + Filename).c_str(), std::ios_base::binary); - if (!File) - return Response(Response::InvalidFile); - File.write(&FileData[0], static_cast(FileData.size())); - } - } - } - - return Resp; -} - - -//////////////////////////////////////////////////////////// -/// Upload a file to the server -//////////////////////////////////////////////////////////// -Ftp::Response Ftp::Upload(const std::string& LocalFile, const std::string& DestPath, TransferMode Mode) -{ - // Get the contents of the file to send - std::ifstream File(LocalFile.c_str(), std::ios_base::binary); - if (!File) - return Response(Response::InvalidFile); - File.seekg(0, std::ios::end); - std::size_t Length = File.tellg(); - File.seekg(0, std::ios::beg); - std::vector FileData(Length); - File.read(&FileData[0], static_cast(Length)); - - // Extract the filename from the file path - std::string Filename = LocalFile; - std::string::size_type Pos = Filename.find_last_of("/\\"); - if (Pos != std::string::npos) - Filename = Filename.substr(Pos + 1); - - // Make sure the destination path ends with a slash - std::string Path = DestPath; - if (!Path.empty() && (Path[Path.size() - 1] != '\\') && (Path[Path.size() - 1] != '/')) - Path += "/"; - - // Open a data channel using the given transfer mode - DataChannel Data(*this); - Response Resp = Data.Open(Mode); - if (Resp.IsOk()) - { - // Tell the server to start the transfer - Resp = SendCommand("STOR", Path + Filename); - if (Resp.IsOk()) - { - // Send the file data - Data.Send(FileData); - - // Get the response from the server - Resp = GetResponse(); - } - } - - return Resp; -} - - -//////////////////////////////////////////////////////////// -/// Send a command to the FTP server -//////////////////////////////////////////////////////////// -Ftp::Response Ftp::SendCommand(const std::string& Command, const std::string& Parameter) -{ - // Build the command string - std::string CommandStr; - if (Parameter != "") - CommandStr = Command + " " + Parameter + "\r\n"; - else - CommandStr = Command + "\r\n"; - - // Send it to the server - if (myCommandSocket.Send(CommandStr.c_str(), CommandStr.length()) != sf::Socket::Done) - return Response(Response::ConnectionClosed); - - // Get the response - return GetResponse(); -} - - -//////////////////////////////////////////////////////////// -/// Receive a response from the server -/// (usually after a command has been sent) -//////////////////////////////////////////////////////////// -Ftp::Response Ftp::GetResponse() -{ - // We'll use a variable to keep track of the last valid code. - // It is useful in case of multi-lines responses, because the end of such a response - // will start by the same code - unsigned int LastCode = 0; - bool IsInsideMultiline = false; - std::string Message; - - for (;;) - { - // Receive the response from the server - char Buffer[1024]; - std::size_t Length; - if (myCommandSocket.Receive(Buffer, sizeof(Buffer), Length) != sf::Socket::Done) - return Response(Response::ConnectionClosed); - - // There can be several lines inside the received buffer, extract them all - std::istringstream In(std::string(Buffer, Length), std::ios_base::binary); - while (In) - { - // Try to extract the code - unsigned int Code; - if (In >> Code) - { - // Extract the separator - char Sep; - In.get(Sep); - - // The '-' character means a multiline response - if ((Sep == '-') && !IsInsideMultiline) - { - // Set the multiline flag - IsInsideMultiline = true; - - // Keep track of the code - if (LastCode == 0) - LastCode = Code; - - // Extract the line - std::getline(In, Message); - - // Remove the ending '\r' (all lines are terminated by "\r\n") - Message.erase(Message.length() - 1); - Message = Sep + Message + "\n"; - } - else - { - // We must make sure that the code is the same, otherwise it means - // we haven't reached the end of the multiline response - if ((Sep != '-') && ((Code == LastCode) || (LastCode == 0))) - { - // Clear the multiline flag - IsInsideMultiline = false; - - // Extract the line - std::string Line; - std::getline(In, Line); - - // Remove the ending '\r' (all lines are terminated by "\r\n") - Line.erase(Line.length() - 1); - - // Append it to the message - if (Code == LastCode) - { - std::ostringstream Out; - Out << Code << Sep << Line; - Message += Out.str(); - } - else - { - Message = Sep + Line; - } - - // Return the response code and message - return Response(static_cast(Code), Message); - } - else - { - // The line we just read was actually not a response, - // only a new part of the current multiline response - - // Extract the line - std::string Line; - std::getline(In, Line); - - if (!Line.empty()) - { - // Remove the ending '\r' (all lines are terminated by "\r\n") - Line.erase(Line.length() - 1); - - // Append it to the current message - std::ostringstream Out; - Out << Code << Sep << Line << "\n"; - Message += Out.str(); - } - } - } - } - else if (LastCode != 0) - { - // It seems we are in the middle of a multiline response - - // Clear the error bits of the stream - In.clear(); - - // Extract the line - std::string Line; - std::getline(In, Line); - - if (!Line.empty()) - { - // Remove the ending '\r' (all lines are terminated by "\r\n") - Line.erase(Line.length() - 1); - - // Append it to the current message - Message += Line + "\n"; - } - } - else - { - // Error : cannot extract the code, and we are not in a multiline response - return Response(Response::InvalidResponse); - } - } - } - - // We never reach there -} - - -//////////////////////////////////////////////////////////// -/// Constructor -//////////////////////////////////////////////////////////// -Ftp::DataChannel::DataChannel(Ftp& Owner) : -myFtp(Owner) -{ - -} - - -//////////////////////////////////////////////////////////// -/// Destructor -//////////////////////////////////////////////////////////// -Ftp::DataChannel::~DataChannel() -{ - // Close the data socket - myDataSocket.Close(); -} - - -//////////////////////////////////////////////////////////// -/// Open the data channel using the specified mode and port -//////////////////////////////////////////////////////////// -Ftp::Response Ftp::DataChannel::Open(Ftp::TransferMode Mode) -{ - // Open a data connection in active mode (we connect to the server) - Ftp::Response Resp = myFtp.SendCommand("PASV"); - if (Resp.IsOk()) - { - // Extract the connection address and port from the response - std::string::size_type begin = Resp.GetMessage().find_first_of("0123456789"); - if (begin != std::string::npos) - { - sf::Uint8 Data[6] = {0, 0, 0, 0, 0, 0}; - std::string Str = Resp.GetMessage().substr(begin); - std::size_t Index = 0; - for (int i = 0; i < 6; ++i) - { - // Extract the current number - while (isdigit(Str[Index])) - { - Data[i] = Data[i] * 10 + (Str[Index] - '0'); - Index++; - } - - // Skip separator - Index++; - } - - // Reconstruct connection port and address - unsigned short Port = Data[4] * 256 + Data[5]; - sf::IPAddress Address(static_cast(Data[0]), - static_cast(Data[1]), - static_cast(Data[2]), - static_cast(Data[3])); - - // Connect the data channel to the server - if (myDataSocket.Connect(Port, Address) == Socket::Done) - { - // Translate the transfer mode to the corresponding FTP parameter - std::string ModeStr; - switch (Mode) - { - case Ftp::Binary : ModeStr = "I"; break; - case Ftp::Ascii : ModeStr = "A"; break; - case Ftp::Ebcdic : ModeStr = "E"; break; - } - - // Set the transfer mode - Resp = myFtp.SendCommand("TYPE", ModeStr); - } - else - { - // Failed to connect to the server - Resp = Ftp::Response(Ftp::Response::ConnectionFailed); - } - } - } - - return Resp; -} - - -//////////////////////////////////////////////////////////// -/// Receive data on the data channel until it is closed -//////////////////////////////////////////////////////////// -void Ftp::DataChannel::Receive(std::vector& Data) -{ - // Receive data - Data.clear(); - char Buffer[1024]; - std::size_t Received; - while (myDataSocket.Receive(Buffer, sizeof(Buffer), Received) == sf::Socket::Done) - { - std::copy(Buffer, Buffer + Received, std::back_inserter(Data)); - } - - // Close the data socket - myDataSocket.Close(); -} - - -//////////////////////////////////////////////////////////// -/// Send data on the data channel -//////////////////////////////////////////////////////////// -void Ftp::DataChannel::Send(const std::vector& Data) -{ - // Send data - myDataSocket.Send(&Data[0], Data.size()); - - // Close the data socket - myDataSocket.Close(); -} - -} // namespace sf diff --git a/dependencies/SFML/src/SFML/Network/Http.cpp b/dependencies/SFML/src/SFML/Network/Http.cpp deleted file mode 100644 index af34a345..00000000 --- a/dependencies/SFML/src/SFML/Network/Http.cpp +++ /dev/null @@ -1,425 +0,0 @@ -//////////////////////////////////////////////////////////// -// -// SFML - Simple and Fast Multimedia Library -// Copyright (C) 2007-2009 Laurent Gomila (laurent.gom@gmail.com) -// -// This software is provided 'as-is', without any express or implied warranty. -// In no event will the authors be held liable for any damages arising from the use of this software. -// -// Permission is granted to anyone to use this software for any purpose, -// including commercial applications, and to alter it and redistribute it freely, -// subject to the following restrictions: -// -// 1. The origin of this software must not be misrepresented; -// you must not claim that you wrote the original software. -// If you use this software in a product, an acknowledgment -// in the product documentation would be appreciated but is not required. -// -// 2. Altered source versions must be plainly marked as such, -// and must not be misrepresented as being the original software. -// -// 3. This notice may not be removed or altered from any source distribution. -// -//////////////////////////////////////////////////////////// - -//////////////////////////////////////////////////////////// -// Headers -//////////////////////////////////////////////////////////// -#include -#include -#include - - -namespace -{ - //////////////////////////////////////////////////////////// - // Convenience function to convert a string to lower case - //////////////////////////////////////////////////////////// - std::string ToLower(const std::string& Str) - { - std::string Ret = Str; - for (std::string::iterator i = Ret.begin(); i != Ret.end(); ++i) - *i = static_cast(tolower(*i)); - - return Ret; - } -} - - -namespace sf -{ -//////////////////////////////////////////////////////////// -/// Default constructor -//////////////////////////////////////////////////////////// -Http::Request::Request(Method RequestMethod, const std::string& URI, const std::string& Body) : -myMethod (RequestMethod), -myURI (URI), -myMajorVersion(1), -myMinorVersion(0), -myBody (Body) -{ - -} - - -//////////////////////////////////////////////////////////// -/// Set the value of a field; the field is added if it doesn't exist -//////////////////////////////////////////////////////////// -void Http::Request::SetField(const std::string& Field, const std::string& Value) -{ - myFields[ToLower(Field)] = Value; -} - - -//////////////////////////////////////////////////////////// -/// Set the request method. -/// This parameter is Get by default -//////////////////////////////////////////////////////////// -void Http::Request::SetMethod(Http::Request::Method RequestMethod) -{ - myMethod = RequestMethod; -} - - -//////////////////////////////////////////////////////////// -/// Set the target URI of the request. -/// This parameter is "/" by default -//////////////////////////////////////////////////////////// -void Http::Request::SetURI(const std::string& URI) -{ - myURI = URI; - - // Make sure it starts with a '/' - if (myURI.empty() || (myURI[0] != '/')) - myURI.insert(0, "/"); -} - - -//////////////////////////////////////////////////////////// -/// Set the HTTP version of the request. -/// This parameter is 1.0 by default -//////////////////////////////////////////////////////////// -void Http::Request::SetHttpVersion(unsigned int Major, unsigned int Minor) -{ - myMajorVersion = Major; - myMinorVersion = Minor; -} - - -//////////////////////////////////////////////////////////// -/// Set the body of the request. This parameter is optional and -/// makes sense only for POST requests. -/// This parameter is empty by default -//////////////////////////////////////////////////////////// -void Http::Request::SetBody(const std::string& Body) -{ - myBody = Body; -} - - -//////////////////////////////////////////////////////////// -/// Get the string representation of a request header -//////////////////////////////////////////////////////////// -std::string Http::Request::ToString() const -{ - std::ostringstream Out; - - // Convert the method to its string representation - std::string RequestMethod; - switch (myMethod) - { - default : - case Get : RequestMethod = "GET"; break; - case Post : RequestMethod = "POST"; break; - case Head : RequestMethod = "HEAD"; break; - } - - // Write the first line containing the request type - Out << RequestMethod << " " << myURI << " "; - Out << "HTTP/" << myMajorVersion << "." << myMinorVersion << "\r\n"; - - // Write fields - for (FieldTable::const_iterator i = myFields.begin(); i != myFields.end(); ++i) - { - Out << i->first << ": " << i->second << "\r\n"; - } - - // Use an extra \r\n to separate the header from the body - Out << "\r\n"; - - // Add the body - Out << myBody; - - return Out.str(); -} - - -//////////////////////////////////////////////////////////// -/// Check if the given field has been defined -//////////////////////////////////////////////////////////// -bool Http::Request::HasField(const std::string& Field) const -{ - return myFields.find(Field) != myFields.end(); -} - - -//////////////////////////////////////////////////////////// -/// Default constructor -//////////////////////////////////////////////////////////// -Http::Response::Response() : -myStatus (ConnectionFailed), -myMajorVersion(0), -myMinorVersion(0) -{ - -} - - -//////////////////////////////////////////////////////////// -/// Get the value of a field -//////////////////////////////////////////////////////////// -const std::string& Http::Response::GetField(const std::string& Field) const -{ - FieldTable::const_iterator It = myFields.find(Field); - if (It != myFields.end()) - { - return It->second; - } - else - { - static const std::string Empty = ""; - return Empty; - } -} - - -//////////////////////////////////////////////////////////// -/// Get the header's status code -//////////////////////////////////////////////////////////// -Http::Response::Status Http::Response::GetStatus() const -{ - return myStatus; -} - - -//////////////////////////////////////////////////////////// -/// Get the major HTTP version number of the response -//////////////////////////////////////////////////////////// -unsigned int Http::Response::GetMajorHttpVersion() const -{ - return myMajorVersion; -} - - -//////////////////////////////////////////////////////////// -/// Get the major HTTP version number of the response -//////////////////////////////////////////////////////////// -unsigned int Http::Response::GetMinorHttpVersion() const -{ - return myMinorVersion; -} - - -//////////////////////////////////////////////////////////// -/// Get the body of the response. The body can contain : -/// - the requested page (for GET requests) -/// - a response from the server (for POST requests) -/// - nothing (for HEAD requests) -/// - an error message (in case of an error) -//////////////////////////////////////////////////////////// -const std::string& Http::Response::GetBody() const -{ - return myBody; -} - - -//////////////////////////////////////////////////////////// -/// Construct the header from a response string -//////////////////////////////////////////////////////////// -void Http::Response::FromString(const std::string& Data) -{ - std::istringstream In(Data); - - // Extract the HTTP version from the first line - std::string Version; - if (In >> Version) - { - if ((Version.size() >= 8) && (Version[6] == '.') && - (ToLower(Version.substr(0, 5)) == "http/") && - isdigit(Version[5]) && isdigit(Version[7])) - { - myMajorVersion = Version[5] - '0'; - myMinorVersion = Version[7] - '0'; - } - else - { - // Invalid HTTP version - myStatus = InvalidResponse; - return; - } - } - - // Extract the status code from the first line - int StatusCode; - if (In >> StatusCode) - { - myStatus = static_cast(StatusCode); - } - else - { - // Invalid status code - myStatus = InvalidResponse; - return; - } - - // Ignore the end of the first line - In.ignore(10000, '\n'); - - // Parse the other lines, which contain fields, one by one - std::string Line; - while (std::getline(In, Line) && (Line.size() > 2)) - { - std::string::size_type Pos = Line.find(": "); - if (Pos != std::string::npos) - { - // Extract the field name and its value - std::string Field = Line.substr(0, Pos); - std::string Value = Line.substr(Pos + 2); - - // Remove any trailing \r - if (!Value.empty() && (*Value.rbegin() == '\r')) - Value.erase(Value.size() - 1); - - // Add the field - myFields[ToLower(Field)] = Value; - } - } - - // Finally extract the body - myBody.clear(); - while (std::getline(In, Line)) - myBody += Line + "\n"; -} - - -//////////////////////////////////////////////////////////// -/// Default constructor -//////////////////////////////////////////////////////////// -Http::Http() : -myHost(), -myPort(0) -{ - -} - - -//////////////////////////////////////////////////////////// -/// Construct the Http instance with the target host -//////////////////////////////////////////////////////////// -Http::Http(const std::string& Host, unsigned short Port) -{ - SetHost(Host, Port); -} - - -//////////////////////////////////////////////////////////// -/// Set the target host -//////////////////////////////////////////////////////////// -void Http::SetHost(const std::string& Host, unsigned short Port) -{ - // Detect the protocol used - std::string Protocol = ToLower(Host.substr(0, 8)); - if (Protocol.substr(0, 7) == "http://") - { - // HTTP protocol - myHostName = Host.substr(7); - myPort = (Port != 0 ? Port : 80); - } - else if (Protocol == "https://") - { - // HTTPS protocol - myHostName = Host.substr(8); - myPort = (Port != 0 ? Port : 443); - } - else - { - // Undefined protocol - use HTTP - myHostName = Host; - myPort = (Port != 0 ? Port : 80); - } - - // Remove any trailing '/' from the host name - if (!myHostName.empty() && (*myHostName.rbegin() == '/')) - myHostName.erase(myHostName.size() - 1); - - myHost = sf::IPAddress(myHostName); -} - - -//////////////////////////////////////////////////////////// -/// Send a HTTP request and return the server's response. -/// You must be connected to a host before sending requests. -/// Any missing mandatory header field will be added with an appropriate value. -/// Warning : this function waits for the server's response and may -/// not return instantly; use a thread if you don't want to block your -/// application. -//////////////////////////////////////////////////////////// -Http::Response Http::SendRequest(const Http::Request& Req, float Timeout) -{ - // First make sure the request is valid -- add missing mandatory fields - Request ToSend(Req); - if (!ToSend.HasField("From")) - { - ToSend.SetField("From", "user@sfml-dev.org"); - } - if (!ToSend.HasField("User-Agent")) - { - ToSend.SetField("User-Agent", "libsfml-network/1.x"); - } - if (!ToSend.HasField("Host")) - { - ToSend.SetField("Host", myHostName); - } - if (!ToSend.HasField("Content-Length")) - { - std::ostringstream Out; - Out << ToSend.myBody.size(); - ToSend.SetField("Content-Length", Out.str()); - } - - // Prepare the response - Response Received; - - // Connect the socket to the host - if (myConnection.Connect(myPort, myHost, Timeout) == Socket::Done) - { - // Convert the request to string and send it through the connected socket - std::string RequestStr = ToSend.ToString(); - - if (!RequestStr.empty()) - { - // Send it through the socket - if (myConnection.Send(RequestStr.c_str(), RequestStr.size()) == sf::Socket::Done) - { - // Wait for the server's response - std::string ReceivedStr; - std::size_t Size = 0; - char Buffer[1024]; - while (myConnection.Receive(Buffer, sizeof(Buffer), Size) == sf::Socket::Done) - { - ReceivedStr.append(Buffer, Buffer + Size); - } - - // Build the Response object from the received data - Received.FromString(ReceivedStr); - } - } - - // Close the connection - myConnection.Close(); - } - - return Received; -} - -} // namespace sf diff --git a/dependencies/SFML/src/SFML/Network/IPAddress.cpp b/dependencies/SFML/src/SFML/Network/IPAddress.cpp deleted file mode 100644 index 9d51f240..00000000 --- a/dependencies/SFML/src/SFML/Network/IPAddress.cpp +++ /dev/null @@ -1,298 +0,0 @@ -//////////////////////////////////////////////////////////// -// -// SFML - Simple and Fast Multimedia Library -// Copyright (C) 2007-2009 Laurent Gomila (laurent.gom@gmail.com) -// -// This software is provided 'as-is', without any express or implied warranty. -// In no event will the authors be held liable for any damages arising from the use of this software. -// -// Permission is granted to anyone to use this software for any purpose, -// including commercial applications, and to alter it and redistribute it freely, -// subject to the following restrictions: -// -// 1. The origin of this software must not be misrepresented; -// you must not claim that you wrote the original software. -// If you use this software in a product, an acknowledgment -// in the product documentation would be appreciated but is not required. -// -// 2. Altered source versions must be plainly marked as such, -// and must not be misrepresented as being the original software. -// -// 3. This notice may not be removed or altered from any source distribution. -// -//////////////////////////////////////////////////////////// - -//////////////////////////////////////////////////////////// -// Headers -//////////////////////////////////////////////////////////// -#include -#include -#include -#include - - -namespace sf -{ -//////////////////////////////////////////////////////////// -/// Static member data -//////////////////////////////////////////////////////////// -const IPAddress IPAddress::LocalHost("127.0.0.1"); - - -//////////////////////////////////////////////////////////// -/// Default constructor -//////////////////////////////////////////////////////////// -IPAddress::IPAddress() : -myAddress(INADDR_NONE) -{ - -} - - -//////////////////////////////////////////////////////////// -/// Construct the address from a string -//////////////////////////////////////////////////////////// -IPAddress::IPAddress(const std::string& Address) -{ - // First try to convert it as a byte representation ("xxx.xxx.xxx.xxx") - myAddress = inet_addr(Address.c_str()); - - // If not successful, try to convert it as a host name - if (!IsValid()) - { - hostent* Host = gethostbyname(Address.c_str()); - if (Host) - { - // Host found, extract its IP address - myAddress = reinterpret_cast(Host->h_addr)->s_addr; - } - else - { - // Host name not found on the network - myAddress = INADDR_NONE; - } - } -} - - -//////////////////////////////////////////////////////////// -/// Construct the address from a C-style string ; -/// Needed for implicit conversions from literal strings to IPAddress to work -//////////////////////////////////////////////////////////// -IPAddress::IPAddress(const char* Address) -{ - // First try to convert it as a byte representation ("xxx.xxx.xxx.xxx") - myAddress = inet_addr(Address); - - // If not successful, try to convert it as a host name - if (!IsValid()) - { - hostent* Host = gethostbyname(Address); - if (Host) - { - // Host found, extract its IP address - myAddress = reinterpret_cast(Host->h_addr)->s_addr; - } - else - { - // Host name not found on the network - myAddress = INADDR_NONE; - } - } -} - - -//////////////////////////////////////////////////////////// -/// Construct the address from 4 bytes -//////////////////////////////////////////////////////////// -IPAddress::IPAddress(Uint8 Byte0, Uint8 Byte1, Uint8 Byte2, Uint8 Byte3) -{ - myAddress = htonl((Byte0 << 24) | (Byte1 << 16) | (Byte2 << 8) | Byte3); -} - - -//////////////////////////////////////////////////////////// -/// Construct the address from a 32-bits integer -//////////////////////////////////////////////////////////// -IPAddress::IPAddress(Uint32 Address) -{ - myAddress = htonl(Address); -} - - -//////////////////////////////////////////////////////////// -/// Tell if the address is a valid one -//////////////////////////////////////////////////////////// -bool IPAddress::IsValid() const -{ - return myAddress != INADDR_NONE; -} - - -//////////////////////////////////////////////////////////// -/// Get a string representation of the address -//////////////////////////////////////////////////////////// -std::string IPAddress::ToString() const -{ - in_addr InAddr; - InAddr.s_addr = myAddress; - - return inet_ntoa(InAddr); -} - - -//////////////////////////////////////////////////////////// -/// Get an integer representation of the address -//////////////////////////////////////////////////////////// -Uint32 IPAddress::ToInteger() const -{ - return ntohl(myAddress); -} - - -//////////////////////////////////////////////////////////// -/// Get the computer's local IP address (from the LAN point of view) -//////////////////////////////////////////////////////////// -IPAddress IPAddress::GetLocalAddress() -{ - // The method here is to connect a UDP socket to anyone (here to localhost), - // and get the local socket address with the getsockname function. - // UDP connection will not send anything to the network, so this function won't cause any overhead. - - IPAddress LocalAddress; - - // Create the socket - SocketHelper::SocketType Socket = socket(PF_INET, SOCK_DGRAM, 0); - if (Socket == SocketHelper::InvalidSocket()) - return LocalAddress; - - // Build the host address (use a random port) - sockaddr_in SockAddr; - memset(SockAddr.sin_zero, 0, sizeof(SockAddr.sin_zero)); - SockAddr.sin_addr.s_addr = INADDR_LOOPBACK; - SockAddr.sin_family = AF_INET; - SockAddr.sin_port = htons(4567); - - // Connect the socket - if (connect(Socket, reinterpret_cast(&SockAddr), sizeof(SockAddr)) == -1) - { - SocketHelper::Close(Socket); - return LocalAddress; - } - - // Get the local address of the socket connection - SocketHelper::LengthType Size = sizeof(SockAddr); - if (getsockname(Socket, reinterpret_cast(&SockAddr), &Size) == -1) - { - SocketHelper::Close(Socket); - return LocalAddress; - } - - // Close the socket - SocketHelper::Close(Socket); - - // Finally build the IP address - LocalAddress.myAddress = SockAddr.sin_addr.s_addr; - - return LocalAddress; -} - - -//////////////////////////////////////////////////////////// -/// Get the computer's public IP address (from the web point of view) -//////////////////////////////////////////////////////////// -IPAddress IPAddress::GetPublicAddress(float Timeout) -{ - // The trick here is more complicated, because the only way - // to get our public IP address is to get it from a distant computer. - // Here we get the web page from http://www.sfml-dev.org/ip-provider.php - // and parse the result to extract our IP address - // (not very hard : the web page contains only our IP address). - - Http Server("www.sfml-dev.org"); - Http::Request Request(Http::Request::Get, "/ip-provider.php"); - Http::Response Page = Server.SendRequest(Request, Timeout); - if (Page.GetStatus() == Http::Response::Ok) - return IPAddress(Page.GetBody()); - - // Something failed: return an invalid address - return IPAddress(); -} - - -//////////////////////////////////////////////////////////// -/// Comparison operator == -//////////////////////////////////////////////////////////// -bool IPAddress::operator ==(const IPAddress& Other) const -{ - return myAddress == Other.myAddress; -} - - -//////////////////////////////////////////////////////////// -/// Comparison operator != -//////////////////////////////////////////////////////////// -bool IPAddress::operator !=(const IPAddress& Other) const -{ - return myAddress != Other.myAddress; -} - - -//////////////////////////////////////////////////////////// -/// Comparison operator < -//////////////////////////////////////////////////////////// -bool IPAddress::operator <(const IPAddress& Other) const -{ - return myAddress < Other.myAddress; -} - - -//////////////////////////////////////////////////////////// -/// Comparison operator > -//////////////////////////////////////////////////////////// -bool IPAddress::operator >(const IPAddress& Other) const -{ - return myAddress > Other.myAddress; -} - - -//////////////////////////////////////////////////////////// -/// Comparison operator <= -//////////////////////////////////////////////////////////// -bool IPAddress::operator <=(const IPAddress& Other) const -{ - return myAddress <= Other.myAddress; -} - - -//////////////////////////////////////////////////////////// -/// Comparison operator >= -//////////////////////////////////////////////////////////// -bool IPAddress::operator >=(const IPAddress& Other) const -{ - return myAddress >= Other.myAddress; -} - - -//////////////////////////////////////////////////////////// -/// Operator >> overload to extract an address from an input stream -//////////////////////////////////////////////////////////// -std::istream& operator >>(std::istream& Stream, IPAddress& Address) -{ - std::string Str; - Stream >> Str; - Address = IPAddress(Str); - - return Stream; -} - - -//////////////////////////////////////////////////////////// -/// Operator << overload to print an address to an output stream -//////////////////////////////////////////////////////////// -std::ostream& operator <<(std::ostream& Stream, const IPAddress& Address) -{ - return Stream << Address.ToString(); -} - -} // namespace sf diff --git a/dependencies/SFML/src/SFML/Network/Packet.cpp b/dependencies/SFML/src/SFML/Network/Packet.cpp deleted file mode 100644 index 7eaea501..00000000 --- a/dependencies/SFML/src/SFML/Network/Packet.cpp +++ /dev/null @@ -1,426 +0,0 @@ -//////////////////////////////////////////////////////////// -// -// SFML - Simple and Fast Multimedia Library -// Copyright (C) 2007-2009 Laurent Gomila (laurent.gom@gmail.com) -// -// This software is provided 'as-is', without any express or implied warranty. -// In no event will the authors be held liable for any damages arising from the use of this software. -// -// Permission is granted to anyone to use this software for any purpose, -// including commercial applications, and to alter it and redistribute it freely, -// subject to the following restrictions: -// -// 1. The origin of this software must not be misrepresented; -// you must not claim that you wrote the original software. -// If you use this software in a product, an acknowledgment -// in the product documentation would be appreciated but is not required. -// -// 2. Altered source versions must be plainly marked as such, -// and must not be misrepresented as being the original software. -// -// 3. This notice may not be removed or altered from any source distribution. -// -//////////////////////////////////////////////////////////// - -//////////////////////////////////////////////////////////// -// Headers -//////////////////////////////////////////////////////////// -#include -#include -#include - - -namespace sf -{ -//////////////////////////////////////////////////////////// -/// Default constructor -//////////////////////////////////////////////////////////// -Packet::Packet() : -myReadPos(0), -myIsValid(true) -{ - -} - - -//////////////////////////////////////////////////////////// -/// Virtual destructor -//////////////////////////////////////////////////////////// -Packet::~Packet() -{ - -} - - -//////////////////////////////////////////////////////////// -/// Append data to the end of the packet -//////////////////////////////////////////////////////////// -void Packet::Append(const void* Data, std::size_t SizeInBytes) -{ - if (Data && (SizeInBytes > 0)) - { - std::size_t Start = myData.size(); - myData.resize(Start + SizeInBytes); - memcpy(&myData[Start], Data, SizeInBytes); - } -} - - -//////////////////////////////////////////////////////////// -/// Clear the packet data -//////////////////////////////////////////////////////////// -void Packet::Clear() -{ - myData.clear(); - myReadPos = 0; - myIsValid = true; -} - - -//////////////////////////////////////////////////////////// -/// Get a pointer to the data contained in the packet -/// Warning : the returned pointer may be invalid after you -/// append data to the packet -//////////////////////////////////////////////////////////// -const char* Packet::GetData() const -{ - return !myData.empty() ? &myData[0] : NULL; -} - - -//////////////////////////////////////////////////////////// -/// Get the size of the data contained in the packet -//////////////////////////////////////////////////////////// -std::size_t Packet::GetDataSize() const -{ - return myData.size(); -} - - -//////////////////////////////////////////////////////////// -/// Tell if the reading position has reached the end of the packet -//////////////////////////////////////////////////////////// -bool Packet::EndOfPacket() const -{ - return myReadPos >= myData.size(); -} - - -//////////////////////////////////////////////////////////// -/// Tell if the packet is valid for reading -//////////////////////////////////////////////////////////// -Packet::operator bool() const -{ - return myIsValid; -} - - -//////////////////////////////////////////////////////////// -/// Operator >> overloads to extract data from the packet -//////////////////////////////////////////////////////////// -Packet& Packet::operator >>(bool& Data) -{ - Uint8 Value; - if (*this >> Value) - Data = (Value != 0); - - return *this; -} -Packet& Packet::operator >>(Int8& Data) -{ - if (CheckSize(sizeof(Data))) - { - Data = *reinterpret_cast(GetData() + myReadPos); - myReadPos += sizeof(Data); - } - - return *this; -} -Packet& Packet::operator >>(Uint8& Data) -{ - if (CheckSize(sizeof(Data))) - { - Data = *reinterpret_cast(GetData() + myReadPos); - myReadPos += sizeof(Data); - } - - return *this; -} -Packet& Packet::operator >>(Int16& Data) -{ - if (CheckSize(sizeof(Data))) - { - Data = ntohs(*reinterpret_cast(GetData() + myReadPos)); - myReadPos += sizeof(Data); - } - - return *this; -} -Packet& Packet::operator >>(Uint16& Data) -{ - if (CheckSize(sizeof(Data))) - { - Data = ntohs(*reinterpret_cast(GetData() + myReadPos)); - myReadPos += sizeof(Data); - } - - return *this; -} -Packet& Packet::operator >>(Int32& Data) -{ - if (CheckSize(sizeof(Data))) - { - Data = ntohl(*reinterpret_cast(GetData() + myReadPos)); - myReadPos += sizeof(Data); - } - - return *this; -} -Packet& Packet::operator >>(Uint32& Data) -{ - if (CheckSize(sizeof(Data))) - { - Data = ntohl(*reinterpret_cast(GetData() + myReadPos)); - myReadPos += sizeof(Data); - } - - return *this; -} -Packet& Packet::operator >>(float& Data) -{ - if (CheckSize(sizeof(Data))) - { - Data = *reinterpret_cast(GetData() + myReadPos); - myReadPos += sizeof(Data); - } - - return *this; -} -Packet& Packet::operator >>(double& Data) -{ - if (CheckSize(sizeof(Data))) - { - Data = *reinterpret_cast(GetData() + myReadPos); - myReadPos += sizeof(Data); - } - - return *this; -} -Packet& Packet::operator >>(char* Data) -{ - // First extract string length - Uint32 Length; - *this >> Length; - - if ((Length > 0) && CheckSize(Length)) - { - // Then extract characters - memcpy(Data, GetData() + myReadPos, Length); - Data[Length] = '\0'; - - // Update reading position - myReadPos += Length; - } - - return *this; -} -Packet& Packet::operator >>(std::string& Data) -{ - // First extract string length - Uint32 Length; - *this >> Length; - - Data.clear(); - if ((Length > 0) && CheckSize(Length)) - { - // Then extract characters - Data.assign(GetData() + myReadPos, Length); - - // Update reading position - myReadPos += Length; - } - - return *this; -} -Packet& Packet::operator >>(wchar_t* Data) -{ - // First extract string length - Uint32 Length; - *this >> Length; - - if ((Length > 0) && CheckSize(Length * sizeof(Int32))) - { - // Then extract characters - for (Uint32 i = 0; i < Length; ++i) - { - Uint32 c; - *this >> c; - Data[i] = static_cast(c); - } - Data[Length] = L'\0'; - } - - return *this; -} -Packet& Packet::operator >>(std::wstring& Data) -{ - // First extract string length - Uint32 Length; - *this >> Length; - - Data.clear(); - if ((Length > 0) && CheckSize(Length * sizeof(Int32))) - { - // Then extract characters - for (Uint32 i = 0; i < Length; ++i) - { - Uint32 c; - *this >> c; - Data += static_cast(c); - } - } - - return *this; -} - - -//////////////////////////////////////////////////////////// -/// Operator << overloads to put data into the packet -//////////////////////////////////////////////////////////// -Packet& Packet::operator <<(bool Data) -{ - *this << static_cast(Data); - return *this; -} -Packet& Packet::operator <<(Int8 Data) -{ - Append(&Data, sizeof(Data)); - return *this; -} -Packet& Packet::operator <<(Uint8 Data) -{ - Append(&Data, sizeof(Data)); - return *this; -} -Packet& Packet::operator <<(Int16 Data) -{ - Int16 ToWrite = htons(Data); - Append(&ToWrite, sizeof(ToWrite)); - return *this; -} -Packet& Packet::operator <<(Uint16 Data) -{ - Uint16 ToWrite = htons(Data); - Append(&ToWrite, sizeof(ToWrite)); - return *this; -} -Packet& Packet::operator <<(Int32 Data) -{ - Int32 ToWrite = htonl(Data); - Append(&ToWrite, sizeof(ToWrite)); - return *this; -} -Packet& Packet::operator <<(Uint32 Data) -{ - Uint32 ToWrite = htonl(Data); - Append(&ToWrite, sizeof(ToWrite)); - return *this; -} -Packet& Packet::operator <<(float Data) -{ - Append(&Data, sizeof(Data)); - return *this; -} -Packet& Packet::operator <<(double Data) -{ - Append(&Data, sizeof(Data)); - return *this; -} -Packet& Packet::operator <<(const char* Data) -{ - // First insert string length - Uint32 Length = 0; - for (const char* c = Data; *c != '\0'; ++c) - ++Length; - *this << Length; - - // Then insert characters - Append(Data, Length * sizeof(char)); - - return *this; -} -Packet& Packet::operator <<(const std::string& Data) -{ - // First insert string length - Uint32 Length = static_cast(Data.size()); - *this << Length; - - // Then insert characters - if (Length > 0) - { - Append(Data.c_str(), Length * sizeof(std::string::value_type)); - } - - return *this; -} -Packet& Packet::operator <<(const wchar_t* Data) -{ - // First insert string length - Uint32 Length = 0; - for (const wchar_t* c = Data; *c != L'\0'; ++c) - ++Length; - *this << Length; - - // Then insert characters - for (const wchar_t* c = Data; *c != L'\0'; ++c) - *this << static_cast(*c); - - return *this; -} -Packet& Packet::operator <<(const std::wstring& Data) -{ - // First insert string length - Uint32 Length = static_cast(Data.size()); - *this << Length; - - // Then insert characters - if (Length > 0) - { - for (std::wstring::const_iterator c = Data.begin(); c != Data.end(); ++c) - *this << static_cast(*c); - } - - return *this; -} - - -//////////////////////////////////////////////////////////// -/// Check if the packet can extract a given size of bytes -//////////////////////////////////////////////////////////// -bool Packet::CheckSize(std::size_t Size) -{ - myIsValid = myIsValid && (myReadPos + Size <= myData.size()); - - return myIsValid; -} - - -//////////////////////////////////////////////////////////// -/// Called before the packet is sent to the network -//////////////////////////////////////////////////////////// -const char* Packet::OnSend(std::size_t& DataSize) -{ - DataSize = GetDataSize(); - return GetData(); -} - - -//////////////////////////////////////////////////////////// -/// Called after the packet has been received from the network -//////////////////////////////////////////////////////////// -void Packet::OnReceive(const char* Data, std::size_t DataSize) -{ - Append(Data, DataSize); -} - -} // namespace sf diff --git a/dependencies/SFML/src/SFML/Network/SelectorBase.cpp b/dependencies/SFML/src/SFML/Network/SelectorBase.cpp deleted file mode 100644 index eeca707d..00000000 --- a/dependencies/SFML/src/SFML/Network/SelectorBase.cpp +++ /dev/null @@ -1,132 +0,0 @@ -//////////////////////////////////////////////////////////// -// -// SFML - Simple and Fast Multimedia Library -// Copyright (C) 2007-2009 Laurent Gomila (laurent.gom@gmail.com) -// -// This software is provided 'as-is', without any express or implied warranty. -// In no event will the authors be held liable for any damages arising from the use of this software. -// -// Permission is granted to anyone to use this software for any purpose, -// including commercial applications, and to alter it and redistribute it freely, -// subject to the following restrictions: -// -// 1. The origin of this software must not be misrepresented; -// you must not claim that you wrote the original software. -// If you use this software in a product, an acknowledgment -// in the product documentation would be appreciated but is not required. -// -// 2. Altered source versions must be plainly marked as such, -// and must not be misrepresented as being the original software. -// -// 3. This notice may not be removed or altered from any source distribution. -// -//////////////////////////////////////////////////////////// - -#ifdef _MSC_VER - #pragma warning(disable : 4127) // "conditional expression is constant" generated by the FD_SET macro -#endif - -//////////////////////////////////////////////////////////// -// Headers -//////////////////////////////////////////////////////////// -#include - - -namespace sf -{ -//////////////////////////////////////////////////////////// -/// Default constructor -//////////////////////////////////////////////////////////// -SelectorBase::SelectorBase() : -myMaxSocket(0) -{ - Clear(); -} - - -//////////////////////////////////////////////////////////// -/// Add a socket to watch -//////////////////////////////////////////////////////////// -void SelectorBase::Add(SocketHelper::SocketType Socket) -{ - FD_SET(Socket, &mySet); - - int Size = static_cast(Socket); - if (Size > myMaxSocket) - myMaxSocket = Size; -} - - -//////////////////////////////////////////////////////////// -/// Remove a socket -//////////////////////////////////////////////////////////// -void SelectorBase::Remove(SocketHelper::SocketType Socket) -{ - FD_CLR(Socket, &mySet); -} - - -//////////////////////////////////////////////////////////// -/// Remove all sockets -//////////////////////////////////////////////////////////// -void SelectorBase::Clear() -{ - FD_ZERO(&mySet); - FD_ZERO(&mySetReady); - - myMaxSocket = 0; -} - - -//////////////////////////////////////////////////////////// -/// Wait and collect sockets which are ready for reading. -/// This functions will return either when at least one socket -/// is ready, or when the given time is out -//////////////////////////////////////////////////////////// -unsigned int SelectorBase::Wait(float Timeout) -{ - // Setup the timeout structure - timeval Time; - Time.tv_sec = static_cast(Timeout); - Time.tv_usec = (static_cast(Timeout * 1000) % 1000) * 1000; - - // Prepare the set of sockets to return - mySetReady = mySet; - - // Wait until one of the sockets is ready for reading, or timeout is reached - int NbSockets = select(myMaxSocket + 1, &mySetReady, NULL, NULL, Timeout > 0 ? &Time : NULL); - - return NbSockets >= 0 ? static_cast(NbSockets) : 0; -} - - -//////////////////////////////////////////////////////////// -/// After a call to Wait(), get the Index-th socket which is -/// ready for reading. The total number of sockets ready -/// is the integer returned by the previous call to Wait() -//////////////////////////////////////////////////////////// -SocketHelper::SocketType SelectorBase::GetSocketReady(unsigned int Index) -{ - // The standard FD_xxx interface doesn't define a direct access, - // so we must go through the whole set to find the socket we're looking for - for (int i = 0; i < myMaxSocket + 1; ++i) - { - if (FD_ISSET(i, &mySetReady)) - { - // Current socket is ready, but is it the Index-th one ? - if (Index > 0) - { - Index--; - } - else - { - return static_cast(i); - } - } - } - - // Invalid index : return an invalid socket - return SocketHelper::InvalidSocket(); -} - -} // namespace sf diff --git a/dependencies/SFML/src/SFML/Network/SocketTCP.cpp b/dependencies/SFML/src/SFML/Network/SocketTCP.cpp deleted file mode 100644 index d1a3c5d1..00000000 --- a/dependencies/SFML/src/SFML/Network/SocketTCP.cpp +++ /dev/null @@ -1,501 +0,0 @@ -//////////////////////////////////////////////////////////// -// -// SFML - Simple and Fast Multimedia Library -// Copyright (C) 2007-2009 Laurent Gomila (laurent.gom@gmail.com) -// -// This software is provided 'as-is', without any express or implied warranty. -// In no event will the authors be held liable for any damages arising from the use of this software. -// -// Permission is granted to anyone to use this software for any purpose, -// including commercial applications, and to alter it and redistribute it freely, -// subject to the following restrictions: -// -// 1. The origin of this software must not be misrepresented; -// you must not claim that you wrote the original software. -// If you use this software in a product, an acknowledgment -// in the product documentation would be appreciated but is not required. -// -// 2. Altered source versions must be plainly marked as such, -// and must not be misrepresented as being the original software. -// -// 3. This notice may not be removed or altered from any source distribution. -// -//////////////////////////////////////////////////////////// - -//////////////////////////////////////////////////////////// -// Headers -//////////////////////////////////////////////////////////// -#include -#include -#include -#include -#include -#include -#include - - -#ifdef _MSC_VER - #pragma warning(disable : 4127) // "conditional expression is constant" generated by the FD_SET macro -#endif - - -namespace sf -{ -//////////////////////////////////////////////////////////// -/// Default constructor -//////////////////////////////////////////////////////////// -SocketTCP::SocketTCP() -{ - Create(SocketHelper::InvalidSocket()); -} - - -//////////////////////////////////////////////////////////// -/// Change the blocking state of the socket -//////////////////////////////////////////////////////////// -void SocketTCP::SetBlocking(bool Blocking) -{ - // Make sure our socket is valid - if (!IsValid()) - Create(); - - SocketHelper::SetBlocking(mySocket, Blocking); - myIsBlocking = Blocking; -} - - -//////////////////////////////////////////////////////////// -/// Connect to another computer on a specified port -//////////////////////////////////////////////////////////// -Socket::Status SocketTCP::Connect(unsigned short Port, const IPAddress& HostAddress, float Timeout) -{ - // Make sure our socket is valid - if (!IsValid()) - Create(); - - // Build the host address - sockaddr_in SockAddr; - memset(SockAddr.sin_zero, 0, sizeof(SockAddr.sin_zero)); - SockAddr.sin_addr.s_addr = inet_addr(HostAddress.ToString().c_str()); - SockAddr.sin_family = AF_INET; - SockAddr.sin_port = htons(Port); - - if (Timeout <= 0) - { - // ----- We're not using a timeout : just try to connect ----- - - if (connect(mySocket, reinterpret_cast(&SockAddr), sizeof(SockAddr)) == -1) - { - // Failed to connect - return SocketHelper::GetErrorStatus(); - } - - // Connection succeeded - return Socket::Done; - } - else - { - // ----- We're using a timeout : we'll need a few tricks to make it work ----- - - // Save the previous blocking state - bool IsBlocking = myIsBlocking; - - // Switch to non-blocking to enable our connection timeout - if (IsBlocking) - SetBlocking(false); - - // Try to connect to host - if (connect(mySocket, reinterpret_cast(&SockAddr), sizeof(SockAddr)) >= 0) - { - // We got instantly connected! (it may no happen a lot...) - return Socket::Done; - } - - // Get the error status - Socket::Status Status = SocketHelper::GetErrorStatus(); - - // If we were in non-blocking mode, return immediatly - if (!IsBlocking) - return Status; - - // Otherwise, wait until something happens to our socket (success, timeout or error) - if (Status == Socket::NotReady) - { - // Setup the selector - fd_set Selector; - FD_ZERO(&Selector); - FD_SET(mySocket, &Selector); - - // Setup the timeout - timeval Time; - Time.tv_sec = static_cast(Timeout); - Time.tv_usec = (static_cast(Timeout * 1000) % 1000) * 1000; - - // Wait for something to write on our socket (which means that the connection request has returned) - if (select(static_cast(mySocket + 1), NULL, &Selector, NULL, &Time) > 0) - { - // At this point the connection may have been either accepted or refused. - // To know whether it's a success or a failure, we try to retrieve the name of the connected peer - SocketHelper::LengthType Size = sizeof(SockAddr); - if (getpeername(mySocket, reinterpret_cast(&SockAddr), &Size) != -1) - { - // Connection accepted - Status = Socket::Done; - } - else - { - // Connection failed - Status = SocketHelper::GetErrorStatus(); - } - } - else - { - // Failed to connect before timeout is over - Status = SocketHelper::GetErrorStatus(); - } - } - - // Switch back to blocking mode - SetBlocking(true); - - return Status; - } -} - - -//////////////////////////////////////////////////////////// -/// Listen to a specified port for incoming data or connections -//////////////////////////////////////////////////////////// -bool SocketTCP::Listen(unsigned short Port) -{ - // Make sure our socket is valid - if (!IsValid()) - Create(); - - // Build the address - sockaddr_in SockAddr; - memset(SockAddr.sin_zero, 0, sizeof(SockAddr.sin_zero)); - SockAddr.sin_addr.s_addr = htonl(INADDR_ANY); - SockAddr.sin_family = AF_INET; - SockAddr.sin_port = htons(Port); - - // Bind the socket to the specified port - if (bind(mySocket, reinterpret_cast(&SockAddr), sizeof(SockAddr)) == -1) - { - // Not likely to happen, but... - std::cerr << "Failed to bind socket to port " << Port << std::endl; - return false; - } - - // Listen to the bound port - if (listen(mySocket, 0) == -1) - { - // Oops, socket is deaf - std::cerr << "Failed to listen to port " << Port << std::endl; - return false; - } - - return true; -} - - -//////////////////////////////////////////////////////////// -/// Wait for a connection (must be listening to a port). -/// This function will block if the socket is blocking -//////////////////////////////////////////////////////////// -Socket::Status SocketTCP::Accept(SocketTCP& Connected, IPAddress* Address) -{ - // Address that will be filled with client informations - sockaddr_in ClientAddress; - SocketHelper::LengthType Length = sizeof(ClientAddress); - - // Accept a new connection - Connected = accept(mySocket, reinterpret_cast(&ClientAddress), &Length); - - // Check errors - if (!Connected.IsValid()) - { - if (Address) - *Address = IPAddress(); - - return SocketHelper::GetErrorStatus(); - } - - // Fill address if requested - if (Address) - *Address = IPAddress(inet_ntoa(ClientAddress.sin_addr)); - - return Socket::Done; -} - - -//////////////////////////////////////////////////////////// -/// Send an array of bytes to the host (must be connected first) -//////////////////////////////////////////////////////////// -Socket::Status SocketTCP::Send(const char* Data, std::size_t Size) -{ - // First check that socket is valid - if (!IsValid()) - return Socket::Error; - - // Check parameters - if (Data && Size) - { - // Loop until every byte has been sent - int Sent = 0; - int SizeToSend = static_cast(Size); - for (int Length = 0; Length < SizeToSend; Length += Sent) - { - // Send a chunk of data - Sent = send(mySocket, Data + Length, SizeToSend - Length, 0); - - // Check if an error occured - if (Sent <= 0) - return SocketHelper::GetErrorStatus(); - } - - return Socket::Done; - } - else - { - // Error... - std::cerr << "Cannot send data over the network (invalid parameters)" << std::endl; - return Socket::Error; - } -} - - -//////////////////////////////////////////////////////////// -/// Receive an array of bytes from the host (must be connected first). -/// This function will block if the socket is blocking -//////////////////////////////////////////////////////////// -Socket::Status SocketTCP::Receive(char* Data, std::size_t MaxSize, std::size_t& SizeReceived) -{ - // First clear the size received - SizeReceived = 0; - - // Check that socket is valid - if (!IsValid()) - return Socket::Error; - - // Check parameters - if (Data && MaxSize) - { - // Receive a chunk of bytes - int Received = recv(mySocket, Data, static_cast(MaxSize), 0); - - // Check the number of bytes received - if (Received > 0) - { - SizeReceived = static_cast(Received); - return Socket::Done; - } - else if (Received == 0) - { - return Socket::Disconnected; - } - else - { - return SocketHelper::GetErrorStatus(); - } - } - else - { - // Error... - std::cerr << "Cannot receive data from the network (invalid parameters)" << std::endl; - return Socket::Error; - } -} - - -//////////////////////////////////////////////////////////// -/// Send a packet of data to the host (must be connected first) -//////////////////////////////////////////////////////////// -Socket::Status SocketTCP::Send(Packet& PacketToSend) -{ - // Get the data to send from the packet - std::size_t DataSize = 0; - const char* Data = PacketToSend.OnSend(DataSize); - - // Send the packet size - Uint32 PacketSize = htonl(static_cast(DataSize)); - Send(reinterpret_cast(&PacketSize), sizeof(PacketSize)); - - // Send the packet data - if (PacketSize > 0) - { - return Send(Data, DataSize); - } - else - { - return Socket::Done; - } -} - - -//////////////////////////////////////////////////////////// -/// Receive a packet from the host (must be connected first). -/// This function will block if the socket is blocking -//////////////////////////////////////////////////////////// -Socket::Status SocketTCP::Receive(Packet& PacketToReceive) -{ - // We start by getting the size of the incoming packet - Uint32 PacketSize = 0; - std::size_t Received = 0; - if (myPendingPacketSize < 0) - { - Socket::Status Status = Receive(reinterpret_cast(&PacketSize), sizeof(PacketSize), Received); - if (Status != Socket::Done) - return Status; - - PacketSize = ntohl(PacketSize); - } - else - { - // There is a pending packet : we already know its size - PacketSize = myPendingPacketSize; - } - - // Then loop until we receive all the packet data - char Buffer[1024]; - while (myPendingPacket.size() < PacketSize) - { - // Receive a chunk of data - std::size_t SizeToGet = std::min(static_cast(PacketSize - myPendingPacket.size()), sizeof(Buffer)); - Socket::Status Status = Receive(Buffer, SizeToGet, Received); - if (Status != Socket::Done) - { - // We must save the size of the pending packet until we can receive its content - if (Status == Socket::NotReady) - myPendingPacketSize = PacketSize; - return Status; - } - - // Append it into the packet - if (Received > 0) - { - myPendingPacket.resize(myPendingPacket.size() + Received); - char* Begin = &myPendingPacket[0] + myPendingPacket.size() - Received; - memcpy(Begin, Buffer, Received); - } - } - - // We have received all the datas : we can copy it to the user packet, and clear our internal packet - PacketToReceive.Clear(); - if (!myPendingPacket.empty()) - PacketToReceive.OnReceive(&myPendingPacket[0], myPendingPacket.size()); - myPendingPacket.clear(); - myPendingPacketSize = -1; - - return Socket::Done; -} - - -//////////////////////////////////////////////////////////// -/// Close the socket -//////////////////////////////////////////////////////////// -bool SocketTCP::Close() -{ - if (IsValid()) - { - if (!SocketHelper::Close(mySocket)) - { - std::cerr << "Failed to close socket" << std::endl; - return false; - } - - mySocket = SocketHelper::InvalidSocket(); - } - - myIsBlocking = true; - - return true; -} - - -//////////////////////////////////////////////////////////// -/// Check if the socket is in a valid state ; this function -/// can be called any time to check if the socket is OK -//////////////////////////////////////////////////////////// -bool SocketTCP::IsValid() const -{ - return mySocket != SocketHelper::InvalidSocket(); -} - - -//////////////////////////////////////////////////////////// -/// Comparison operator == -//////////////////////////////////////////////////////////// -bool SocketTCP::operator ==(const SocketTCP& Other) const -{ - return mySocket == Other.mySocket; -} - - -//////////////////////////////////////////////////////////// -/// Comparison operator != -//////////////////////////////////////////////////////////// -bool SocketTCP::operator !=(const SocketTCP& Other) const -{ - return mySocket != Other.mySocket; -} - - -//////////////////////////////////////////////////////////// -/// Comparison operator <. -/// Provided for compatibility with standard containers, as -/// comparing two sockets doesn't make much sense... -//////////////////////////////////////////////////////////// -bool SocketTCP::operator <(const SocketTCP& Other) const -{ - return mySocket < Other.mySocket; -} - - -//////////////////////////////////////////////////////////// -/// Construct the socket from a socket descriptor -/// (for internal use only) -//////////////////////////////////////////////////////////// -SocketTCP::SocketTCP(SocketHelper::SocketType Descriptor) -{ - Create(Descriptor); -} - - -//////////////////////////////////////////////////////////// -/// Create the socket -//////////////////////////////////////////////////////////// -void SocketTCP::Create(SocketHelper::SocketType Descriptor) -{ - // Use the given socket descriptor, or get a new one - mySocket = Descriptor ? Descriptor : socket(PF_INET, SOCK_STREAM, 0); - myIsBlocking = true; - - // Reset the pending packet - myPendingPacket.clear(); - myPendingPacketSize = -1; - - // Setup default options - if (IsValid()) - { - // To avoid the "Address already in use" error message when trying to bind to the same port - int Yes = 1; - if (setsockopt(mySocket, SOL_SOCKET, SO_REUSEADDR, reinterpret_cast(&Yes), sizeof(Yes)) == -1) - { - std::cerr << "Failed to set socket option \"SO_REUSEADDR\" ; " - << "binding to a same port may fail if too fast" << std::endl; - } - - // Disable the Nagle algorithm (ie. removes buffering of TCP packets) - if (setsockopt(mySocket, IPPROTO_TCP, TCP_NODELAY, reinterpret_cast(&Yes), sizeof(Yes)) == -1) - { - std::cerr << "Failed to set socket option \"TCP_NODELAY\" ; " - << "all your TCP packets will be buffered" << std::endl; - } - - // Set blocking by default (should always be the case anyway) - SetBlocking(true); - } -} - -} // namespace sf diff --git a/dependencies/SFML/src/SFML/Network/SocketUDP.cpp b/dependencies/SFML/src/SFML/Network/SocketUDP.cpp deleted file mode 100644 index 0c977cdc..00000000 --- a/dependencies/SFML/src/SFML/Network/SocketUDP.cpp +++ /dev/null @@ -1,430 +0,0 @@ -//////////////////////////////////////////////////////////// -// -// SFML - Simple and Fast Multimedia Library -// Copyright (C) 2007-2009 Laurent Gomila (laurent.gom@gmail.com) -// -// This software is provided 'as-is', without any express or implied warranty. -// In no event will the authors be held liable for any damages arising from the use of this software. -// -// Permission is granted to anyone to use this software for any purpose, -// including commercial applications, and to alter it and redistribute it freely, -// subject to the following restrictions: -// -// 1. The origin of this software must not be misrepresented; -// you must not claim that you wrote the original software. -// If you use this software in a product, an acknowledgment -// in the product documentation would be appreciated but is not required. -// -// 2. Altered source versions must be plainly marked as such, -// and must not be misrepresented as being the original software. -// -// 3. This notice may not be removed or altered from any source distribution. -// -//////////////////////////////////////////////////////////// - -//////////////////////////////////////////////////////////// -// Headers -//////////////////////////////////////////////////////////// -#include -#include -#include -#include -#include -#include - - -namespace sf -{ -//////////////////////////////////////////////////////////// -/// Default constructor -//////////////////////////////////////////////////////////// -SocketUDP::SocketUDP() -{ - Create(); -} - - -//////////////////////////////////////////////////////////// -/// Change the blocking state of the socket -//////////////////////////////////////////////////////////// -void SocketUDP::SetBlocking(bool Blocking) -{ - // Make sure our socket is valid - if (!IsValid()) - Create(); - - SocketHelper::SetBlocking(mySocket, Blocking); - myIsBlocking = Blocking; -} - - -//////////////////////////////////////////////////////////// -/// Bind the socket to a specific port -//////////////////////////////////////////////////////////// -bool SocketUDP::Bind(unsigned short Port) -{ - // Check if the socket is already bound to the specified port - if (myPort != Port) - { - // If the socket was previously bound to another port, we need to unbind it first - Unbind(); - - if (Port != 0) - { - // Build an address with the specified port - sockaddr_in Addr; - Addr.sin_family = AF_INET; - Addr.sin_port = htons(Port); - Addr.sin_addr.s_addr = INADDR_ANY; - memset(Addr.sin_zero, 0, sizeof(Addr.sin_zero)); - - // Bind the socket to the port - if (bind(mySocket, reinterpret_cast(&Addr), sizeof(Addr)) == -1) - { - std::cerr << "Failed to bind the socket to port " << Port << std::endl; - myPort = 0; - return false; - } - } - - // Save the new port - myPort = Port; - } - - return true; -} - - -//////////////////////////////////////////////////////////// -/// Unbind the socket to its previous port -//////////////////////////////////////////////////////////// -bool SocketUDP::Unbind() -{ - // To unbind the socket, we just recreate it - if (myPort != 0) - { - Close(); - Create(); - myPort = 0; - } - - return true; -} - - -//////////////////////////////////////////////////////////// -/// Send an array of bytes -//////////////////////////////////////////////////////////// -Socket::Status SocketUDP::Send(const char* Data, std::size_t Size, const IPAddress& Address, unsigned short Port) -{ - // Make sure the socket is valid - if (!IsValid()) - Create(); - - // Check parameters - if (Data && Size) - { - // Build the target address - sockaddr_in Target; - Target.sin_family = AF_INET; - Target.sin_port = htons(Port); - Target.sin_addr.s_addr = inet_addr(Address.ToString().c_str()); - memset(Target.sin_zero, 0, sizeof(Target.sin_zero)); - - // Loop until every byte has been sent - int Sent = 0; - int SizeToSend = static_cast(Size); - for (int Length = 0; Length < SizeToSend; Length += Sent) - { - // Send a chunk of data - Sent = sendto(mySocket, Data + Length, SizeToSend - Length, 0, reinterpret_cast(&Target), sizeof(Target)); - - // Check errors - if (Sent <= 0) - return SocketHelper::GetErrorStatus(); - } - - return Socket::Done; - } - else - { - // Error... - std::cerr << "Cannot send data over the network (invalid parameters)" << std::endl; - return Socket::Error; - } -} - - -//////////////////////////////////////////////////////////// -/// Receive an array of bytes. -/// This function will block if the socket is blocking -//////////////////////////////////////////////////////////// -Socket::Status SocketUDP::Receive(char* Data, std::size_t MaxSize, std::size_t& SizeReceived, IPAddress& Address, unsigned short& Port) -{ - // First clear the size received - SizeReceived = 0; - - // Make sure the socket is bound to a port - if (myPort == 0) - { - std::cerr << "Failed to receive data ; the UDP socket first needs to be bound to a port" << std::endl; - return Socket::Error; - } - - // Make sure the socket is valid - if (!IsValid()) - Create(); - - // Check parameters - if (Data && MaxSize) - { - // Data that will be filled with the other computer's address - sockaddr_in Sender; - Sender.sin_family = AF_INET; - Sender.sin_port = 0; - Sender.sin_addr.s_addr = INADDR_ANY; - memset(Sender.sin_zero, 0, sizeof(Sender.sin_zero)); - SocketHelper::LengthType SenderSize = sizeof(Sender); - - // Receive a chunk of bytes - int Received = recvfrom(mySocket, Data, static_cast(MaxSize), 0, reinterpret_cast(&Sender), &SenderSize); - - // Check the number of bytes received - if (Received > 0) - { - Address = IPAddress(inet_ntoa(Sender.sin_addr)); - Port = ntohs(Sender.sin_port); - SizeReceived = static_cast(Received); - return Socket::Done; - } - else - { - Address = IPAddress(); - Port = 0; - return Received == 0 ? Socket::Disconnected : SocketHelper::GetErrorStatus(); - } - } - else - { - // Error... - std::cerr << "Cannot receive data from the network (invalid parameters)" << std::endl; - return Socket::Error; - } -} - - -//////////////////////////////////////////////////////////// -/// Send a packet of data -//////////////////////////////////////////////////////////// -Socket::Status SocketUDP::Send(Packet& PacketToSend, const IPAddress& Address, unsigned short Port) -{ - // Get the data to send from the packet - std::size_t DataSize = 0; - const char* Data = PacketToSend.OnSend(DataSize); - - // Send the packet size - Uint32 PacketSize = htonl(static_cast(DataSize)); - Send(reinterpret_cast(&PacketSize), sizeof(PacketSize), Address, Port); - - // Send the packet data - if (PacketSize > 0) - { - return Send(Data, DataSize, Address, Port); - } - else - { - return Socket::Done; - } -} - - -//////////////////////////////////////////////////////////// -/// Receive a packet. -/// This function will block if the socket is blocking -//////////////////////////////////////////////////////////// -Socket::Status SocketUDP::Receive(Packet& PacketToReceive, IPAddress& Address, unsigned short& Port) -{ - // This is not safe at all, as data can be lost, duplicated, or arrive in a different order. - // So if a packet is split into more than one chunk, nobody knows what could happen... - // Conclusion : we shouldn't use packets with UDP, unless we build a more complex protocol on top of it. - - // We start by getting the size of the incoming packet - Uint32 PacketSize = 0; - std::size_t Received = 0; - if (myPendingPacketSize < 0) - { - Socket::Status Status = Receive(reinterpret_cast(&PacketSize), sizeof(PacketSize), Received, Address, Port); - if (Status != Socket::Done) - return Status; - - PacketSize = ntohl(PacketSize); - } - else - { - // There is a pending packet : we already know its size - PacketSize = myPendingPacketSize; - } - - // Clear the user packet - PacketToReceive.Clear(); - - // Use another address instance for receiving the packet data ; - // chunks of data coming from a different sender will be discarded (and lost...) - IPAddress Sender; - unsigned short SenderPort; - - // Then loop until we receive all the packet data - char Buffer[1024]; - while (myPendingPacket.size() < PacketSize) - { - // Receive a chunk of data - std::size_t SizeToGet = std::min(static_cast(PacketSize - myPendingPacket.size()), sizeof(Buffer)); - Socket::Status Status = Receive(Buffer, SizeToGet, Received, Sender, SenderPort); - if (Status != Socket::Done) - { - // We must save the size of the pending packet until we can receive its content - if (Status == Socket::NotReady) - myPendingPacketSize = PacketSize; - return Status; - } - - // Append it into the packet - if ((Sender == Address) && (SenderPort == Port) && (Received > 0)) - { - myPendingPacket.resize(myPendingPacket.size() + Received); - char* Begin = &myPendingPacket[0] + myPendingPacket.size() - Received; - memcpy(Begin, Buffer, Received); - } - } - - // We have received all the datas : we can copy it to the user packet, and clear our internal packet - PacketToReceive.Clear(); - if (!myPendingPacket.empty()) - PacketToReceive.OnReceive(&myPendingPacket[0], myPendingPacket.size()); - myPendingPacket.clear(); - myPendingPacketSize = -1; - - return Socket::Done; -} - - -//////////////////////////////////////////////////////////// -/// Close the socket -//////////////////////////////////////////////////////////// -bool SocketUDP::Close() -{ - if (IsValid()) - { - if (!SocketHelper::Close(mySocket)) - { - std::cerr << "Failed to close socket" << std::endl; - return false; - } - - mySocket = SocketHelper::InvalidSocket(); - } - - myPort = 0; - myIsBlocking = true; - - return true; -} - - -//////////////////////////////////////////////////////////// -/// Check if the socket is in a valid state ; this function -/// can be called any time to check if the socket is OK -//////////////////////////////////////////////////////////// -bool SocketUDP::IsValid() const -{ - return mySocket != SocketHelper::InvalidSocket(); -} - - -//////////////////////////////////////////////////////////// -/// Get the port the socket is currently bound to -//////////////////////////////////////////////////////////// -unsigned short SocketUDP::GetPort() const -{ - return myPort; -} - - -//////////////////////////////////////////////////////////// -/// Comparison operator == -//////////////////////////////////////////////////////////// -bool SocketUDP::operator ==(const SocketUDP& Other) const -{ - return mySocket == Other.mySocket; -} - - -//////////////////////////////////////////////////////////// -/// Comparison operator != -//////////////////////////////////////////////////////////// -bool SocketUDP::operator !=(const SocketUDP& Other) const -{ - return mySocket != Other.mySocket; -} - - -//////////////////////////////////////////////////////////// -/// Comparison operator <. -/// Provided for compatibility with standard containers, as -/// comparing two sockets doesn't make much sense... -//////////////////////////////////////////////////////////// -bool SocketUDP::operator <(const SocketUDP& Other) const -{ - return mySocket < Other.mySocket; -} - - -//////////////////////////////////////////////////////////// -/// Construct the socket from a socket descriptor -/// (for internal use only) -//////////////////////////////////////////////////////////// -SocketUDP::SocketUDP(SocketHelper::SocketType Descriptor) -{ - Create(Descriptor); -} - - -//////////////////////////////////////////////////////////// -/// Create the socket -//////////////////////////////////////////////////////////// -void SocketUDP::Create(SocketHelper::SocketType Descriptor) -{ - // Use the given socket descriptor, or get a new one - mySocket = Descriptor ? Descriptor : socket(PF_INET, SOCK_DGRAM, 0); - myIsBlocking = true; - - // Clear the last port used - myPort = 0; - - // Reset the pending packet - myPendingPacket.clear(); - myPendingPacketSize = -1; - - // Setup default options - if (IsValid()) - { - // To avoid the "Address already in use" error message when trying to bind to the same port - int Yes = 1; - if (setsockopt(mySocket, SOL_SOCKET, SO_REUSEADDR, reinterpret_cast(&Yes), sizeof(Yes)) == -1) - { - std::cerr << "Failed to set socket option \"reuse address\" ; " - << "binding to a same port may fail if too fast" << std::endl; - } - - // Enable broadcast by default - if (setsockopt(mySocket, SOL_SOCKET, SO_BROADCAST, reinterpret_cast(&Yes), sizeof(Yes)) == -1) - { - std::cerr << "Failed to enable broadcast on UDP socket" << std::endl; - } - - // Set blocking by default (should always be the case anyway) - SetBlocking(true); - } -} - -} // namespace sf diff --git a/dependencies/SFML/src/SFML/Network/Unix/SocketHelper.cpp b/dependencies/SFML/src/SFML/Network/Unix/SocketHelper.cpp deleted file mode 100644 index 1fc4e68d..00000000 --- a/dependencies/SFML/src/SFML/Network/Unix/SocketHelper.cpp +++ /dev/null @@ -1,89 +0,0 @@ -//////////////////////////////////////////////////////////// -// -// SFML - Simple and Fast Multimedia Library -// Copyright (C) 2007-2009 Laurent Gomila (laurent.gom@gmail.com) -// -// This software is provided 'as-is', without any express or implied warranty. -// In no event will the authors be held liable for any damages arising from the use of this software. -// -// Permission is granted to anyone to use this software for any purpose, -// including commercial applications, and to alter it and redistribute it freely, -// subject to the following restrictions: -// -// 1. The origin of this software must not be misrepresented; -// you must not claim that you wrote the original software. -// If you use this software in a product, an acknowledgment -// in the product documentation would be appreciated but is not required. -// -// 2. Altered source versions must be plainly marked as such, -// and must not be misrepresented as being the original software. -// -// 3. This notice may not be removed or altered from any source distribution. -// -//////////////////////////////////////////////////////////// - -//////////////////////////////////////////////////////////// -// Headers -//////////////////////////////////////////////////////////// -#include -#include -#include - - -namespace sf -{ -//////////////////////////////////////////////////////////// -/// Return the value of the invalid socket -//////////////////////////////////////////////////////////// -SocketHelper::SocketType SocketHelper::InvalidSocket() -{ - return -1; -} - - -//////////////////////////////////////////////////////////// -/// Close / destroy a socket -//////////////////////////////////////////////////////////// -bool SocketHelper::Close(SocketHelper::SocketType Socket) -{ - return close(Socket) != -1; -} - - -//////////////////////////////////////////////////////////// -/// Set a socket as blocking or non-blocking -//////////////////////////////////////////////////////////// -void SocketHelper::SetBlocking(SocketHelper::SocketType Socket, bool Block) -{ - int Status = fcntl(Socket, F_GETFL); - if (Block) - fcntl(Socket, F_SETFL, Status & ~O_NONBLOCK); - else - fcntl(Socket, F_SETFL, Status | O_NONBLOCK); -} - - -//////////////////////////////////////////////////////////// -/// Get the last socket error status -//////////////////////////////////////////////////////////// -Socket::Status SocketHelper::GetErrorStatus() -{ - // The followings are sometimes equal to EWOULDBLOCK, - // so we have to make a special case for them in order - // to avoid having double values in the switch case - if ((errno == EAGAIN) || (errno == EINPROGRESS)) - return Socket::NotReady; - - switch (errno) - { - case EWOULDBLOCK : return Socket::NotReady; - case ECONNABORTED : return Socket::Disconnected; - case ECONNRESET : return Socket::Disconnected; - case ETIMEDOUT : return Socket::Disconnected; - case ENETRESET : return Socket::Disconnected; - case ENOTCONN : return Socket::Disconnected; - default : return Socket::Error; - } -} - -} // namespace sf diff --git a/dependencies/SFML/src/SFML/Network/Win32/SocketHelper.cpp b/dependencies/SFML/src/SFML/Network/Win32/SocketHelper.cpp deleted file mode 100644 index 2d904a73..00000000 --- a/dependencies/SFML/src/SFML/Network/Win32/SocketHelper.cpp +++ /dev/null @@ -1,100 +0,0 @@ -//////////////////////////////////////////////////////////// -// -// SFML - Simple and Fast Multimedia Library -// Copyright (C) 2007-2009 Laurent Gomila (laurent.gom@gmail.com) -// -// This software is provided 'as-is', without any express or implied warranty. -// In no event will the authors be held liable for any damages arising from the use of this software. -// -// Permission is granted to anyone to use this software for any purpose, -// including commercial applications, and to alter it and redistribute it freely, -// subject to the following restrictions: -// -// 1. The origin of this software must not be misrepresented; -// you must not claim that you wrote the original software. -// If you use this software in a product, an acknowledgment -// in the product documentation would be appreciated but is not required. -// -// 2. Altered source versions must be plainly marked as such, -// and must not be misrepresented as being the original software. -// -// 3. This notice may not be removed or altered from any source distribution. -// -//////////////////////////////////////////////////////////// - -//////////////////////////////////////////////////////////// -// Headers -//////////////////////////////////////////////////////////// -#include - - -namespace sf -{ -//////////////////////////////////////////////////////////// -/// Return the value of the invalid socket -//////////////////////////////////////////////////////////// -SocketHelper::SocketType SocketHelper::InvalidSocket() -{ - return INVALID_SOCKET; -} - - -//////////////////////////////////////////////////////////// -/// Close / destroy a socket -//////////////////////////////////////////////////////////// -bool SocketHelper::Close(SocketHelper::SocketType Socket) -{ - return closesocket(Socket) != -1; -} - - -//////////////////////////////////////////////////////////// -/// Set a socket as blocking or non-blocking -//////////////////////////////////////////////////////////// -void SocketHelper::SetBlocking(SocketHelper::SocketType Socket, bool Block) -{ - unsigned long Blocking = Block ? 0 : 1; - ioctlsocket(Socket, FIONBIO, &Blocking); -} - - -//////////////////////////////////////////////////////////// -/// Get the last socket error status -//////////////////////////////////////////////////////////// -Socket::Status SocketHelper::GetErrorStatus() -{ - switch (WSAGetLastError()) - { - case WSAEWOULDBLOCK : return Socket::NotReady; - case WSAECONNABORTED : return Socket::Disconnected; - case WSAECONNRESET : return Socket::Disconnected; - case WSAETIMEDOUT : return Socket::Disconnected; - case WSAENETRESET : return Socket::Disconnected; - case WSAENOTCONN : return Socket::Disconnected; - default : return Socket::Error; - } -} - - -//////////////////////////////////////////////////////////// -// Windows needs some initialization and cleanup to get -// sockets working properly... so let's create a class that will -// do it automatically -//////////////////////////////////////////////////////////// -struct SocketInitializer -{ - SocketInitializer() - { - WSADATA InitData; - WSAStartup(MAKEWORD(2,2), &InitData); - } - - ~SocketInitializer() - { - WSACleanup(); - } -}; - -SocketInitializer GlobalInitializer; - -} // namespace sf diff --git a/dependencies/libpng/include/png.h b/dependencies/libpng/include/png.h deleted file mode 100644 index e0cec0c2..00000000 --- a/dependencies/libpng/include/png.h +++ /dev/null @@ -1,3569 +0,0 @@ -/* png.h - header file for PNG reference library - * - * libpng version 1.2.29 - May 8, 2008 - * Copyright (c) 1998-2008 Glenn Randers-Pehrson - * (Version 0.96 Copyright (c) 1996, 1997 Andreas Dilger) - * (Version 0.88 Copyright (c) 1995, 1996 Guy Eric Schalnat, Group 42, Inc.) - * - * Authors and maintainers: - * libpng versions 0.71, May 1995, through 0.88, January 1996: Guy Schalnat - * libpng versions 0.89c, June 1996, through 0.96, May 1997: Andreas Dilger - * libpng versions 0.97, January 1998, through 1.2.29 - May 8, 2008: Glenn - * See also "Contributing Authors", below. - * - * Note about libpng version numbers: - * - * Due to various miscommunications, unforeseen code incompatibilities - * and occasional factors outside the authors' control, version numbering - * on the library has not always been consistent and straightforward. - * The following table summarizes matters since version 0.89c, which was - * the first widely used release: - * - * source png.h png.h shared-lib - * version string int version - * ------- ------ ----- ---------- - * 0.89c "1.0 beta 3" 0.89 89 1.0.89 - * 0.90 "1.0 beta 4" 0.90 90 0.90 [should have been 2.0.90] - * 0.95 "1.0 beta 5" 0.95 95 0.95 [should have been 2.0.95] - * 0.96 "1.0 beta 6" 0.96 96 0.96 [should have been 2.0.96] - * 0.97b "1.00.97 beta 7" 1.00.97 97 1.0.1 [should have been 2.0.97] - * 0.97c 0.97 97 2.0.97 - * 0.98 0.98 98 2.0.98 - * 0.99 0.99 98 2.0.99 - * 0.99a-m 0.99 99 2.0.99 - * 1.00 1.00 100 2.1.0 [100 should be 10000] - * 1.0.0 (from here on, the 100 2.1.0 [100 should be 10000] - * 1.0.1 png.h string is 10001 2.1.0 - * 1.0.1a-e identical to the 10002 from here on, the shared library - * 1.0.2 source version) 10002 is 2.V where V is the source code - * 1.0.2a-b 10003 version, except as noted. - * 1.0.3 10003 - * 1.0.3a-d 10004 - * 1.0.4 10004 - * 1.0.4a-f 10005 - * 1.0.5 (+ 2 patches) 10005 - * 1.0.5a-d 10006 - * 1.0.5e-r 10100 (not source compatible) - * 1.0.5s-v 10006 (not binary compatible) - * 1.0.6 (+ 3 patches) 10006 (still binary incompatible) - * 1.0.6d-f 10007 (still binary incompatible) - * 1.0.6g 10007 - * 1.0.6h 10007 10.6h (testing xy.z so-numbering) - * 1.0.6i 10007 10.6i - * 1.0.6j 10007 2.1.0.6j (incompatible with 1.0.0) - * 1.0.7beta11-14 DLLNUM 10007 2.1.0.7beta11-14 (binary compatible) - * 1.0.7beta15-18 1 10007 2.1.0.7beta15-18 (binary compatible) - * 1.0.7rc1-2 1 10007 2.1.0.7rc1-2 (binary compatible) - * 1.0.7 1 10007 (still compatible) - * 1.0.8beta1-4 1 10008 2.1.0.8beta1-4 - * 1.0.8rc1 1 10008 2.1.0.8rc1 - * 1.0.8 1 10008 2.1.0.8 - * 1.0.9beta1-6 1 10009 2.1.0.9beta1-6 - * 1.0.9rc1 1 10009 2.1.0.9rc1 - * 1.0.9beta7-10 1 10009 2.1.0.9beta7-10 - * 1.0.9rc2 1 10009 2.1.0.9rc2 - * 1.0.9 1 10009 2.1.0.9 - * 1.0.10beta1 1 10010 2.1.0.10beta1 - * 1.0.10rc1 1 10010 2.1.0.10rc1 - * 1.0.10 1 10010 2.1.0.10 - * 1.0.11beta1-3 1 10011 2.1.0.11beta1-3 - * 1.0.11rc1 1 10011 2.1.0.11rc1 - * 1.0.11 1 10011 2.1.0.11 - * 1.0.12beta1-2 2 10012 2.1.0.12beta1-2 - * 1.0.12rc1 2 10012 2.1.0.12rc1 - * 1.0.12 2 10012 2.1.0.12 - * 1.1.0a-f - 10100 2.1.1.0a-f (branch abandoned) - * 1.2.0beta1-2 2 10200 2.1.2.0beta1-2 - * 1.2.0beta3-5 3 10200 3.1.2.0beta3-5 - * 1.2.0rc1 3 10200 3.1.2.0rc1 - * 1.2.0 3 10200 3.1.2.0 - * 1.2.1beta1-4 3 10201 3.1.2.1beta1-4 - * 1.2.1rc1-2 3 10201 3.1.2.1rc1-2 - * 1.2.1 3 10201 3.1.2.1 - * 1.2.2beta1-6 12 10202 12.so.0.1.2.2beta1-6 - * 1.0.13beta1 10 10013 10.so.0.1.0.13beta1 - * 1.0.13rc1 10 10013 10.so.0.1.0.13rc1 - * 1.2.2rc1 12 10202 12.so.0.1.2.2rc1 - * 1.0.13 10 10013 10.so.0.1.0.13 - * 1.2.2 12 10202 12.so.0.1.2.2 - * 1.2.3rc1-6 12 10203 12.so.0.1.2.3rc1-6 - * 1.2.3 12 10203 12.so.0.1.2.3 - * 1.2.4beta1-3 13 10204 12.so.0.1.2.4beta1-3 - * 1.0.14rc1 13 10014 10.so.0.1.0.14rc1 - * 1.2.4rc1 13 10204 12.so.0.1.2.4rc1 - * 1.0.14 10 10014 10.so.0.1.0.14 - * 1.2.4 13 10204 12.so.0.1.2.4 - * 1.2.5beta1-2 13 10205 12.so.0.1.2.5beta1-2 - * 1.0.15rc1-3 10 10015 10.so.0.1.0.15rc1-3 - * 1.2.5rc1-3 13 10205 12.so.0.1.2.5rc1-3 - * 1.0.15 10 10015 10.so.0.1.0.15 - * 1.2.5 13 10205 12.so.0.1.2.5 - * 1.2.6beta1-4 13 10206 12.so.0.1.2.6beta1-4 - * 1.0.16 10 10016 10.so.0.1.0.16 - * 1.2.6 13 10206 12.so.0.1.2.6 - * 1.2.7beta1-2 13 10207 12.so.0.1.2.7beta1-2 - * 1.0.17rc1 10 10017 10.so.0.1.0.17rc1 - * 1.2.7rc1 13 10207 12.so.0.1.2.7rc1 - * 1.0.17 10 10017 10.so.0.1.0.17 - * 1.2.7 13 10207 12.so.0.1.2.7 - * 1.2.8beta1-5 13 10208 12.so.0.1.2.8beta1-5 - * 1.0.18rc1-5 10 10018 10.so.0.1.0.18rc1-5 - * 1.2.8rc1-5 13 10208 12.so.0.1.2.8rc1-5 - * 1.0.18 10 10018 10.so.0.1.0.18 - * 1.2.8 13 10208 12.so.0.1.2.8 - * 1.2.9beta1-3 13 10209 12.so.0.1.2.9beta1-3 - * 1.2.9beta4-11 13 10209 12.so.0.9[.0] - * 1.2.9rc1 13 10209 12.so.0.9[.0] - * 1.2.9 13 10209 12.so.0.9[.0] - * 1.2.10beta1-8 13 10210 12.so.0.10[.0] - * 1.2.10rc1-3 13 10210 12.so.0.10[.0] - * 1.2.10 13 10210 12.so.0.10[.0] - * 1.2.11beta1-4 13 10211 12.so.0.11[.0] - * 1.0.19rc1-5 10 10019 10.so.0.19[.0] - * 1.2.11rc1-5 13 10211 12.so.0.11[.0] - * 1.0.19 10 10019 10.so.0.19[.0] - * 1.2.11 13 10211 12.so.0.11[.0] - * 1.0.20 10 10020 10.so.0.20[.0] - * 1.2.12 13 10212 12.so.0.12[.0] - * 1.2.13beta1 13 10213 12.so.0.13[.0] - * 1.0.21 10 10021 10.so.0.21[.0] - * 1.2.13 13 10213 12.so.0.13[.0] - * 1.2.14beta1-2 13 10214 12.so.0.14[.0] - * 1.0.22rc1 10 10022 10.so.0.22[.0] - * 1.2.14rc1 13 10214 12.so.0.14[.0] - * 1.0.22 10 10022 10.so.0.22[.0] - * 1.2.14 13 10214 12.so.0.14[.0] - * 1.2.15beta1-6 13 10215 12.so.0.15[.0] - * 1.0.23rc1-5 10 10023 10.so.0.23[.0] - * 1.2.15rc1-5 13 10215 12.so.0.15[.0] - * 1.0.23 10 10023 10.so.0.23[.0] - * 1.2.15 13 10215 12.so.0.15[.0] - * 1.2.16beta1-2 13 10216 12.so.0.16[.0] - * 1.2.16rc1 13 10216 12.so.0.16[.0] - * 1.0.24 10 10024 10.so.0.24[.0] - * 1.2.16 13 10216 12.so.0.16[.0] - * 1.2.17beta1-2 13 10217 12.so.0.17[.0] - * 1.0.25rc1 10 10025 10.so.0.25[.0] - * 1.2.17rc1-3 13 10217 12.so.0.17[.0] - * 1.0.25 10 10025 10.so.0.25[.0] - * 1.2.17 13 10217 12.so.0.17[.0] - * 1.0.26 10 10026 10.so.0.26[.0] - * 1.2.18 13 10218 12.so.0.18[.0] - * 1.2.19beta1-31 13 10219 12.so.0.19[.0] - * 1.0.27rc1-6 10 10027 10.so.0.27[.0] - * 1.2.19rc1-6 13 10219 12.so.0.19[.0] - * 1.0.27 10 10027 10.so.0.27[.0] - * 1.2.19 13 10219 12.so.0.19[.0] - * 1.2.20beta01-04 13 10220 12.so.0.20[.0] - * 1.0.28rc1-6 10 10028 10.so.0.28[.0] - * 1.2.20rc1-6 13 10220 12.so.0.20[.0] - * 1.0.28 10 10028 10.so.0.28[.0] - * 1.2.20 13 10220 12.so.0.20[.0] - * 1.2.21beta1-2 13 10221 12.so.0.21[.0] - * 1.2.21rc1-3 13 10221 12.so.0.21[.0] - * 1.0.29 10 10029 10.so.0.29[.0] - * 1.2.21 13 10221 12.so.0.21[.0] - * 1.2.22beta1-4 13 10222 12.so.0.22[.0] - * 1.0.30rc1 10 10030 10.so.0.30[.0] - * 1.2.22rc1 13 10222 12.so.0.22[.0] - * 1.0.30 10 10030 10.so.0.30[.0] - * 1.2.22 13 10222 12.so.0.22[.0] - * 1.2.23beta01-05 13 10223 12.so.0.23[.0] - * 1.2.23rc01 13 10223 12.so.0.23[.0] - * 1.2.23 13 10223 12.so.0.23[.0] - * 1.2.24beta01-02 13 10224 12.so.0.24[.0] - * 1.2.24rc01 13 10224 12.so.0.24[.0] - * 1.2.24 13 10224 12.so.0.24[.0] - * 1.2.25beta01-06 13 10225 12.so.0.25[.0] - * 1.2.25rc01-02 13 10225 12.so.0.25[.0] - * 1.0.31 10 10031 10.so.0.31[.0] - * 1.2.25 13 10225 12.so.0.25[.0] - * 1.2.26beta01-06 13 10226 12.so.0.26[.0] - * 1.2.26rc01 13 10226 12.so.0.26[.0] - * 1.2.26 13 10226 12.so.0.26[.0] - * 1.0.32 10 10032 10.so.0.32[.0] - * 1.2.27beta01-06 13 10227 12.so.0.27[.0] - * 1.2.27rc01 13 10227 12.so.0.27[.0] - * 1.0.33 10 10033 10.so.0.33[.0] - * 1.2.27 13 10227 12.so.0.27[.0] - * 1.0.34 10 10034 10.so.0.34[.0] - * 1.2.28 13 10228 12.so.0.28[.0] - * 1.2.29beta01-03 13 10229 12.so.0.29[.0] - * 1.2.29rc01 13 10229 12.so.0.29[.0] - * 1.0.35 10 10035 10.so.0.35[.0] - * 1.2.29 13 10229 12.so.0.29[.0] - * - * Henceforth the source version will match the shared-library major - * and minor numbers; the shared-library major version number will be - * used for changes in backward compatibility, as it is intended. The - * PNG_LIBPNG_VER macro, which is not used within libpng but is available - * for applications, is an unsigned integer of the form xyyzz corresponding - * to the source version x.y.z (leading zeros in y and z). Beta versions - * were given the previous public release number plus a letter, until - * version 1.0.6j; from then on they were given the upcoming public - * release number plus "betaNN" or "rcNN". - * - * Binary incompatibility exists only when applications make direct access - * to the info_ptr or png_ptr members through png.h, and the compiled - * application is loaded with a different version of the library. - * - * DLLNUM will change each time there are forward or backward changes - * in binary compatibility (e.g., when a new feature is added). - * - * See libpng.txt or libpng.3 for more information. The PNG specification - * is available as a W3C Recommendation and as an ISO Specification, - * defines should NOT be changed. - */ -#define PNG_INFO_gAMA 0x0001 -#define PNG_INFO_sBIT 0x0002 -#define PNG_INFO_cHRM 0x0004 -#define PNG_INFO_PLTE 0x0008 -#define PNG_INFO_tRNS 0x0010 -#define PNG_INFO_bKGD 0x0020 -#define PNG_INFO_hIST 0x0040 -#define PNG_INFO_pHYs 0x0080 -#define PNG_INFO_oFFs 0x0100 -#define PNG_INFO_tIME 0x0200 -#define PNG_INFO_pCAL 0x0400 -#define PNG_INFO_sRGB 0x0800 /* GR-P, 0.96a */ -#define PNG_INFO_iCCP 0x1000 /* ESR, 1.0.6 */ -#define PNG_INFO_sPLT 0x2000 /* ESR, 1.0.6 */ -#define PNG_INFO_sCAL 0x4000 /* ESR, 1.0.6 */ -#define PNG_INFO_IDAT 0x8000L /* ESR, 1.0.6 */ - -/* This is used for the transformation routines, as some of them - * change these values for the row. It also should enable using - * the routines for other purposes. - */ -typedef struct png_row_info_struct -{ - png_uint_32 width; /* width of row */ - png_uint_32 rowbytes; /* number of bytes in row */ - png_byte color_type; /* color type of row */ - png_byte bit_depth; /* bit depth of row */ - png_byte channels; /* number of channels (1, 2, 3, or 4) */ - png_byte pixel_depth; /* bits per pixel (depth * channels) */ -} png_row_info; - -typedef png_row_info FAR * png_row_infop; -typedef png_row_info FAR * FAR * png_row_infopp; - -/* These are the function types for the I/O functions and for the functions - * that allow the user to override the default I/O functions with his or her - * own. The png_error_ptr type should match that of user-supplied warning - * and error functions, while the png_rw_ptr type should match that of the - * user read/write data functions. - */ -typedef struct png_struct_def png_struct; -typedef png_struct FAR * png_structp; - -typedef void (PNGAPI *png_error_ptr) PNGARG((png_structp, png_const_charp)); -typedef void (PNGAPI *png_rw_ptr) PNGARG((png_structp, png_bytep, png_size_t)); -typedef void (PNGAPI *png_flush_ptr) PNGARG((png_structp)); -typedef void (PNGAPI *png_read_status_ptr) PNGARG((png_structp, png_uint_32, - int)); -typedef void (PNGAPI *png_write_status_ptr) PNGARG((png_structp, png_uint_32, - int)); - -#ifdef PNG_PROGRESSIVE_READ_SUPPORTED -typedef void (PNGAPI *png_progressive_info_ptr) PNGARG((png_structp, png_infop)); -typedef void (PNGAPI *png_progressive_end_ptr) PNGARG((png_structp, png_infop)); -typedef void (PNGAPI *png_progressive_row_ptr) PNGARG((png_structp, png_bytep, - png_uint_32, int)); -#endif - -#if defined(PNG_READ_USER_TRANSFORM_SUPPORTED) || \ - defined(PNG_WRITE_USER_TRANSFORM_SUPPORTED) || \ - defined(PNG_LEGACY_SUPPORTED) -typedef void (PNGAPI *png_user_transform_ptr) PNGARG((png_structp, - png_row_infop, png_bytep)); -#endif - -#if defined(PNG_USER_CHUNKS_SUPPORTED) -typedef int (PNGAPI *png_user_chunk_ptr) PNGARG((png_structp, png_unknown_chunkp)); -#endif -#if defined(PNG_UNKNOWN_CHUNKS_SUPPORTED) -typedef void (PNGAPI *png_unknown_chunk_ptr) PNGARG((png_structp)); -#endif - -/* Transform masks for the high-level interface */ -#define PNG_TRANSFORM_IDENTITY 0x0000 /* read and write */ -#define PNG_TRANSFORM_STRIP_16 0x0001 /* read only */ -#define PNG_TRANSFORM_STRIP_ALPHA 0x0002 /* read only */ -#define PNG_TRANSFORM_PACKING 0x0004 /* read and write */ -#define PNG_TRANSFORM_PACKSWAP 0x0008 /* read and write */ -#define PNG_TRANSFORM_EXPAND 0x0010 /* read only */ -#define PNG_TRANSFORM_INVERT_MONO 0x0020 /* read and write */ -#define PNG_TRANSFORM_SHIFT 0x0040 /* read and write */ -#define PNG_TRANSFORM_BGR 0x0080 /* read and write */ -#define PNG_TRANSFORM_SWAP_ALPHA 0x0100 /* read and write */ -#define PNG_TRANSFORM_SWAP_ENDIAN 0x0200 /* read and write */ -#define PNG_TRANSFORM_INVERT_ALPHA 0x0400 /* read and write */ -#define PNG_TRANSFORM_STRIP_FILLER 0x0800 /* WRITE only */ - -/* Flags for MNG supported features */ -#define PNG_FLAG_MNG_EMPTY_PLTE 0x01 -#define PNG_FLAG_MNG_FILTER_64 0x04 -#define PNG_ALL_MNG_FEATURES 0x05 - -typedef png_voidp (*png_malloc_ptr) PNGARG((png_structp, png_size_t)); -typedef void (*png_free_ptr) PNGARG((png_structp, png_voidp)); - -/* The structure that holds the information to read and write PNG files. - * The only people who need to care about what is inside of this are the - * people who will be modifying the library for their own special needs. - * It should NOT be accessed directly by an application, except to store - * the jmp_buf. - */ - -struct png_struct_def -{ -#ifdef PNG_SETJMP_SUPPORTED - jmp_buf jmpbuf; /* used in png_error */ -#endif - png_error_ptr error_fn; /* function for printing errors and aborting */ - png_error_ptr warning_fn; /* function for printing warnings */ - png_voidp error_ptr; /* user supplied struct for error functions */ - png_rw_ptr write_data_fn; /* function for writing output data */ - png_rw_ptr read_data_fn; /* function for reading input data */ - png_voidp io_ptr; /* ptr to application struct for I/O functions */ - -#if defined(PNG_READ_USER_TRANSFORM_SUPPORTED) - png_user_transform_ptr read_user_transform_fn; /* user read transform */ -#endif - -#if defined(PNG_WRITE_USER_TRANSFORM_SUPPORTED) - png_user_transform_ptr write_user_transform_fn; /* user write transform */ -#endif - -/* These were added in libpng-1.0.2 */ -#if defined(PNG_USER_TRANSFORM_PTR_SUPPORTED) -#if defined(PNG_READ_USER_TRANSFORM_SUPPORTED) || \ - defined(PNG_WRITE_USER_TRANSFORM_SUPPORTED) - png_voidp user_transform_ptr; /* user supplied struct for user transform */ - png_byte user_transform_depth; /* bit depth of user transformed pixels */ - png_byte user_transform_channels; /* channels in user transformed pixels */ -#endif -#endif - - png_uint_32 mode; /* tells us where we are in the PNG file */ - png_uint_32 flags; /* flags indicating various things to libpng */ - png_uint_32 transformations; /* which transformations to perform */ - - z_stream zstream; /* pointer to decompression structure (below) */ - png_bytep zbuf; /* buffer for zlib */ - png_size_t zbuf_size; /* size of zbuf */ - int zlib_level; /* holds zlib compression level */ - int zlib_method; /* holds zlib compression method */ - int zlib_window_bits; /* holds zlib compression window bits */ - int zlib_mem_level; /* holds zlib compression memory level */ - int zlib_strategy; /* holds zlib compression strategy */ - - png_uint_32 width; /* width of image in pixels */ - png_uint_32 height; /* height of image in pixels */ - png_uint_32 num_rows; /* number of rows in current pass */ - png_uint_32 usr_width; /* width of row at start of write */ - png_uint_32 rowbytes; /* size of row in bytes */ - png_uint_32 irowbytes; /* size of current interlaced row in bytes */ - png_uint_32 iwidth; /* width of current interlaced row in pixels */ - png_uint_32 row_number; /* current row in interlace pass */ - png_bytep prev_row; /* buffer to save previous (unfiltered) row */ - png_bytep row_buf; /* buffer to save current (unfiltered) row */ -#ifndef PNG_NO_WRITE_FILTERING - png_bytep sub_row; /* buffer to save "sub" row when filtering */ - png_bytep up_row; /* buffer to save "up" row when filtering */ - png_bytep avg_row; /* buffer to save "avg" row when filtering */ - png_bytep paeth_row; /* buffer to save "Paeth" row when filtering */ -#endif - png_row_info row_info; /* used for transformation routines */ - - png_uint_32 idat_size; /* current IDAT size for read */ - png_uint_32 crc; /* current chunk CRC value */ - png_colorp palette; /* palette from the input file */ - png_uint_16 num_palette; /* number of color entries in palette */ - png_uint_16 num_trans; /* number of transparency values */ - png_byte chunk_name[5]; /* null-terminated name of current chunk */ - png_byte compression; /* file compression type (always 0) */ - png_byte filter; /* file filter type (always 0) */ - png_byte interlaced; /* PNG_INTERLACE_NONE, PNG_INTERLACE_ADAM7 */ - png_byte pass; /* current interlace pass (0 - 6) */ - png_byte do_filter; /* row filter flags (see PNG_FILTER_ below ) */ - png_byte color_type; /* color type of file */ - png_byte bit_depth; /* bit depth of file */ - png_byte usr_bit_depth; /* bit depth of users row */ - png_byte pixel_depth; /* number of bits per pixel */ - png_byte channels; /* number of channels in file */ - png_byte usr_channels; /* channels at start of write */ - png_byte sig_bytes; /* magic bytes read/written from start of file */ - -#if defined(PNG_READ_FILLER_SUPPORTED) || defined(PNG_WRITE_FILLER_SUPPORTED) -#ifdef PNG_LEGACY_SUPPORTED - png_byte filler; /* filler byte for pixel expansion */ -#else - png_uint_16 filler; /* filler bytes for pixel expansion */ -#endif -#endif - -#if defined(PNG_bKGD_SUPPORTED) - png_byte background_gamma_type; -# ifdef PNG_FLOATING_POINT_SUPPORTED - float background_gamma; -# endif - png_color_16 background; /* background color in screen gamma space */ -#if defined(PNG_READ_GAMMA_SUPPORTED) - png_color_16 background_1; /* background normalized to gamma 1.0 */ -#endif -#endif /* PNG_bKGD_SUPPORTED */ - -#if defined(PNG_WRITE_FLUSH_SUPPORTED) - png_flush_ptr output_flush_fn;/* Function for flushing output */ - png_uint_32 flush_dist; /* how many rows apart to flush, 0 - no flush */ - png_uint_32 flush_rows; /* number of rows written since last flush */ -#endif - -#if defined(PNG_READ_GAMMA_SUPPORTED) || defined(PNG_READ_BACKGROUND_SUPPORTED) - int gamma_shift; /* number of "insignificant" bits 16-bit gamma */ -#ifdef PNG_FLOATING_POINT_SUPPORTED - float gamma; /* file gamma value */ - float screen_gamma; /* screen gamma value (display_exponent) */ -#endif -#endif - -#if defined(PNG_READ_GAMMA_SUPPORTED) || defined(PNG_READ_BACKGROUND_SUPPORTED) - png_bytep gamma_table; /* gamma table for 8-bit depth files */ - png_bytep gamma_from_1; /* converts from 1.0 to screen */ - png_bytep gamma_to_1; /* converts from file to 1.0 */ - png_uint_16pp gamma_16_table; /* gamma table for 16-bit depth files */ - png_uint_16pp gamma_16_from_1; /* converts from 1.0 to screen */ - png_uint_16pp gamma_16_to_1; /* converts from file to 1.0 */ -#endif - -#if defined(PNG_READ_GAMMA_SUPPORTED) || defined(PNG_sBIT_SUPPORTED) - png_color_8 sig_bit; /* significant bits in each available channel */ -#endif - -#if defined(PNG_READ_SHIFT_SUPPORTED) || defined(PNG_WRITE_SHIFT_SUPPORTED) - png_color_8 shift; /* shift for significant bit tranformation */ -#endif - -#if defined(PNG_tRNS_SUPPORTED) || defined(PNG_READ_BACKGROUND_SUPPORTED) \ - || defined(PNG_READ_EXPAND_SUPPORTED) || defined(PNG_READ_BACKGROUND_SUPPORTED) - png_bytep trans; /* transparency values for paletted files */ - png_color_16 trans_values; /* transparency values for non-paletted files */ -#endif - - png_read_status_ptr read_row_fn; /* called after each row is decoded */ - png_write_status_ptr write_row_fn; /* called after each row is encoded */ -#ifdef PNG_PROGRESSIVE_READ_SUPPORTED - png_progressive_info_ptr info_fn; /* called after header data fully read */ - png_progressive_row_ptr row_fn; /* called after each prog. row is decoded */ - png_progressive_end_ptr end_fn; /* called after image is complete */ - png_bytep save_buffer_ptr; /* current location in save_buffer */ - png_bytep save_buffer; /* buffer for previously read data */ - png_bytep current_buffer_ptr; /* current location in current_buffer */ - png_bytep current_buffer; /* buffer for recently used data */ - png_uint_32 push_length; /* size of current input chunk */ - png_uint_32 skip_length; /* bytes to skip in input data */ - png_size_t save_buffer_size; /* amount of data now in save_buffer */ - png_size_t save_buffer_max; /* total size of save_buffer */ - png_size_t buffer_size; /* total amount of available input data */ - png_size_t current_buffer_size; /* amount of data now in current_buffer */ - int process_mode; /* what push library is currently doing */ - int cur_palette; /* current push library palette index */ - -# if defined(PNG_TEXT_SUPPORTED) - png_size_t current_text_size; /* current size of text input data */ - png_size_t current_text_left; /* how much text left to read in input */ - png_charp current_text; /* current text chunk buffer */ - png_charp current_text_ptr; /* current location in current_text */ -# endif /* PNG_TEXT_SUPPORTED */ -#endif /* PNG_PROGRESSIVE_READ_SUPPORTED */ - -#if defined(__TURBOC__) && !defined(_Windows) && !defined(__FLAT__) -/* for the Borland special 64K segment handler */ - png_bytepp offset_table_ptr; - png_bytep offset_table; - png_uint_16 offset_table_number; - png_uint_16 offset_table_count; - png_uint_16 offset_table_count_free; -#endif - -#if defined(PNG_READ_DITHER_SUPPORTED) - png_bytep palette_lookup; /* lookup table for dithering */ - png_bytep dither_index; /* index translation for palette files */ -#endif - -#if defined(PNG_READ_DITHER_SUPPORTED) || defined(PNG_hIST_SUPPORTED) - png_uint_16p hist; /* histogram */ -#endif - -#if defined(PNG_WRITE_WEIGHTED_FILTER_SUPPORTED) - png_byte heuristic_method; /* heuristic for row filter selection */ - png_byte num_prev_filters; /* number of weights for previous rows */ - png_bytep prev_filters; /* filter type(s) of previous row(s) */ - png_uint_16p filter_weights; /* weight(s) for previous line(s) */ - png_uint_16p inv_filter_weights; /* 1/weight(s) for previous line(s) */ - png_uint_16p filter_costs; /* relative filter calculation cost */ - png_uint_16p inv_filter_costs; /* 1/relative filter calculation cost */ -#endif - -#if defined(PNG_TIME_RFC1123_SUPPORTED) - png_charp time_buffer; /* String to hold RFC 1123 time text */ -#endif - -/* New members added in libpng-1.0.6 */ - -#ifdef PNG_FREE_ME_SUPPORTED - png_uint_32 free_me; /* flags items libpng is responsible for freeing */ -#endif - -#if defined(PNG_USER_CHUNKS_SUPPORTED) - png_voidp user_chunk_ptr; - png_user_chunk_ptr read_user_chunk_fn; /* user read chunk handler */ -#endif - -#if defined(PNG_UNKNOWN_CHUNKS_SUPPORTED) - int num_chunk_list; - png_bytep chunk_list; -#endif - -/* New members added in libpng-1.0.3 */ -#if defined(PNG_READ_RGB_TO_GRAY_SUPPORTED) - png_byte rgb_to_gray_status; - /* These were changed from png_byte in libpng-1.0.6 */ - png_uint_16 rgb_to_gray_red_coeff; - png_uint_16 rgb_to_gray_green_coeff; - png_uint_16 rgb_to_gray_blue_coeff; -#endif - -/* New member added in libpng-1.0.4 (renamed in 1.0.9) */ -#if defined(PNG_MNG_FEATURES_SUPPORTED) || \ - defined(PNG_READ_EMPTY_PLTE_SUPPORTED) || \ - defined(PNG_WRITE_EMPTY_PLTE_SUPPORTED) -/* changed from png_byte to png_uint_32 at version 1.2.0 */ -#ifdef PNG_1_0_X - png_byte mng_features_permitted; -#else - png_uint_32 mng_features_permitted; -#endif /* PNG_1_0_X */ -#endif - -/* New member added in libpng-1.0.7 */ -#if defined(PNG_READ_GAMMA_SUPPORTED) || defined(PNG_READ_BACKGROUND_SUPPORTED) - png_fixed_point int_gamma; -#endif - -/* New member added in libpng-1.0.9, ifdef'ed out in 1.0.12, enabled in 1.2.0 */ -#if defined(PNG_MNG_FEATURES_SUPPORTED) - png_byte filter_type; -#endif - -#if defined(PNG_1_0_X) -/* New member added in libpng-1.0.10, ifdef'ed out in 1.2.0 */ - png_uint_32 row_buf_size; -#endif - -/* New members added in libpng-1.2.0 */ -#if defined(PNG_ASSEMBLER_CODE_SUPPORTED) -# if !defined(PNG_1_0_X) -# if defined(PNG_MMX_CODE_SUPPORTED) - png_byte mmx_bitdepth_threshold; - png_uint_32 mmx_rowbytes_threshold; -# endif - png_uint_32 asm_flags; -# endif -#endif - -/* New members added in libpng-1.0.2 but first enabled by default in 1.2.0 */ -#ifdef PNG_USER_MEM_SUPPORTED - png_voidp mem_ptr; /* user supplied struct for mem functions */ - png_malloc_ptr malloc_fn; /* function for allocating memory */ - png_free_ptr free_fn; /* function for freeing memory */ -#endif - -/* New member added in libpng-1.0.13 and 1.2.0 */ - png_bytep big_row_buf; /* buffer to save current (unfiltered) row */ - -#if defined(PNG_READ_DITHER_SUPPORTED) -/* The following three members were added at version 1.0.14 and 1.2.4 */ - png_bytep dither_sort; /* working sort array */ - png_bytep index_to_palette; /* where the original index currently is */ - /* in the palette */ - png_bytep palette_to_index; /* which original index points to this */ - /* palette color */ -#endif - -/* New members added in libpng-1.0.16 and 1.2.6 */ - png_byte compression_type; - -#ifdef PNG_SET_USER_LIMITS_SUPPORTED - png_uint_32 user_width_max; - png_uint_32 user_height_max; -#endif - -/* New member added in libpng-1.0.25 and 1.2.17 */ -#if defined(PNG_UNKNOWN_CHUNKS_SUPPORTED) - /* storage for unknown chunk that the library doesn't recognize. */ - png_unknown_chunk unknown_chunk; -#endif - -/* New members added in libpng-1.2.26 */ - png_uint_32 old_big_row_buf_size, old_prev_row_size; -}; - - -/* This triggers a compiler error in png.c, if png.c and png.h - * do not agree upon the version number. - */ -typedef png_structp version_1_2_29; - -typedef png_struct FAR * FAR * png_structpp; - -/* Here are the function definitions most commonly used. This is not - * the place to find out how to use libpng. See libpng.txt for the - * full explanation, see example.c for the summary. This just provides - * a simple one line description of the use of each function. - */ - -/* Returns the version number of the library */ -extern PNG_EXPORT(png_uint_32,png_access_version_number) PNGARG((void)); - -/* Tell lib we have already handled the first magic bytes. - * Handling more than 8 bytes from the beginning of the file is an error. - */ -extern PNG_EXPORT(void,png_set_sig_bytes) PNGARG((png_structp png_ptr, - int num_bytes)); - -/* Check sig[start] through sig[start + num_to_check - 1] to see if it's a - * PNG file. Returns zero if the supplied bytes match the 8-byte PNG - * signature, and non-zero otherwise. Having num_to_check == 0 or - * start > 7 will always fail (ie return non-zero). - */ -extern PNG_EXPORT(int,png_sig_cmp) PNGARG((png_bytep sig, png_size_t start, - png_size_t num_to_check)); - -/* Simple signature checking function. This is the same as calling - * png_check_sig(sig, n) := !png_sig_cmp(sig, 0, n). - */ -extern PNG_EXPORT(int,png_check_sig) PNGARG((png_bytep sig, int num)); - -/* Allocate and initialize png_ptr struct for reading, and any other memory. */ -extern PNG_EXPORT(png_structp,png_create_read_struct) - PNGARG((png_const_charp user_png_ver, png_voidp error_ptr, - png_error_ptr error_fn, png_error_ptr warn_fn)); - -/* Allocate and initialize png_ptr struct for writing, and any other memory */ -extern PNG_EXPORT(png_structp,png_create_write_struct) - PNGARG((png_const_charp user_png_ver, png_voidp error_ptr, - png_error_ptr error_fn, png_error_ptr warn_fn)); - -#ifdef PNG_WRITE_SUPPORTED -extern PNG_EXPORT(png_uint_32,png_get_compression_buffer_size) - PNGARG((png_structp png_ptr)); -#endif - -#ifdef PNG_WRITE_SUPPORTED -extern PNG_EXPORT(void,png_set_compression_buffer_size) - PNGARG((png_structp png_ptr, png_uint_32 size)); -#endif - -/* Reset the compression stream */ -extern PNG_EXPORT(int,png_reset_zstream) PNGARG((png_structp png_ptr)); - -/* New functions added in libpng-1.0.2 (not enabled by default until 1.2.0) */ -#ifdef PNG_USER_MEM_SUPPORTED -extern PNG_EXPORT(png_structp,png_create_read_struct_2) - PNGARG((png_const_charp user_png_ver, png_voidp error_ptr, - png_error_ptr error_fn, png_error_ptr warn_fn, png_voidp mem_ptr, - png_malloc_ptr malloc_fn, png_free_ptr free_fn)); -extern PNG_EXPORT(png_structp,png_create_write_struct_2) - PNGARG((png_const_charp user_png_ver, png_voidp error_ptr, - png_error_ptr error_fn, png_error_ptr warn_fn, png_voidp mem_ptr, - png_malloc_ptr malloc_fn, png_free_ptr free_fn)); -#endif - -/* Write a PNG chunk - size, type, (optional) data, CRC. */ -extern PNG_EXPORT(void,png_write_chunk) PNGARG((png_structp png_ptr, - png_bytep chunk_name, png_bytep data, png_size_t length)); - -/* Write the start of a PNG chunk - length and chunk name. */ -extern PNG_EXPORT(void,png_write_chunk_start) PNGARG((png_structp png_ptr, - png_bytep chunk_name, png_uint_32 length)); - -/* Write the data of a PNG chunk started with png_write_chunk_start(). */ -extern PNG_EXPORT(void,png_write_chunk_data) PNGARG((png_structp png_ptr, - png_bytep data, png_size_t length)); - -/* Finish a chunk started with png_write_chunk_start() (includes CRC). */ -extern PNG_EXPORT(void,png_write_chunk_end) PNGARG((png_structp png_ptr)); - -/* Allocate and initialize the info structure */ -extern PNG_EXPORT(png_infop,png_create_info_struct) - PNGARG((png_structp png_ptr)); - -#if defined(PNG_1_0_X) || defined (PNG_1_2_X) -/* Initialize the info structure (old interface - DEPRECATED) */ -extern PNG_EXPORT(void,png_info_init) PNGARG((png_infop info_ptr)); -#undef png_info_init -#define png_info_init(info_ptr) png_info_init_3(&info_ptr,\ - png_sizeof(png_info)); -#endif - -extern PNG_EXPORT(void,png_info_init_3) PNGARG((png_infopp info_ptr, - png_size_t png_info_struct_size)); - -/* Writes all the PNG information before the image. */ -extern PNG_EXPORT(void,png_write_info_before_PLTE) PNGARG((png_structp png_ptr, - png_infop info_ptr)); -extern PNG_EXPORT(void,png_write_info) PNGARG((png_structp png_ptr, - png_infop info_ptr)); - -#ifndef PNG_NO_SEQUENTIAL_READ_SUPPORTED -/* read the information before the actual image data. */ -extern PNG_EXPORT(void,png_read_info) PNGARG((png_structp png_ptr, - png_infop info_ptr)); -#endif - -#if defined(PNG_TIME_RFC1123_SUPPORTED) -extern PNG_EXPORT(png_charp,png_convert_to_rfc1123) - PNGARG((png_structp png_ptr, png_timep ptime)); -#endif - -#if !defined(_WIN32_WCE) -/* "time.h" functions are not supported on WindowsCE */ -#if defined(PNG_WRITE_tIME_SUPPORTED) -/* convert from a struct tm to png_time */ -extern PNG_EXPORT(void,png_convert_from_struct_tm) PNGARG((png_timep ptime, - struct tm FAR * ttime)); - -/* convert from time_t to png_time. Uses gmtime() */ -extern PNG_EXPORT(void,png_convert_from_time_t) PNGARG((png_timep ptime, - time_t ttime)); -#endif /* PNG_WRITE_tIME_SUPPORTED */ -#endif /* _WIN32_WCE */ - -#if defined(PNG_READ_EXPAND_SUPPORTED) -/* Expand data to 24-bit RGB, or 8-bit grayscale, with alpha if available. */ -extern PNG_EXPORT(void,png_set_expand) PNGARG((png_structp png_ptr)); -#if !defined(PNG_1_0_X) -extern PNG_EXPORT(void,png_set_expand_gray_1_2_4_to_8) PNGARG((png_structp - png_ptr)); -#endif -extern PNG_EXPORT(void,png_set_palette_to_rgb) PNGARG((png_structp png_ptr)); -extern PNG_EXPORT(void,png_set_tRNS_to_alpha) PNGARG((png_structp png_ptr)); -#if defined(PNG_1_0_X) || defined (PNG_1_2_X) -/* Deprecated */ -extern PNG_EXPORT(void,png_set_gray_1_2_4_to_8) PNGARG((png_structp png_ptr)); -#endif -#endif - -#if defined(PNG_READ_BGR_SUPPORTED) || defined(PNG_WRITE_BGR_SUPPORTED) -/* Use blue, green, red order for pixels. */ -extern PNG_EXPORT(void,png_set_bgr) PNGARG((png_structp png_ptr)); -#endif - -#if defined(PNG_READ_GRAY_TO_RGB_SUPPORTED) -/* Expand the grayscale to 24-bit RGB if necessary. */ -extern PNG_EXPORT(void,png_set_gray_to_rgb) PNGARG((png_structp png_ptr)); -#endif - -#if defined(PNG_READ_RGB_TO_GRAY_SUPPORTED) -/* Reduce RGB to grayscale. */ -#ifdef PNG_FLOATING_POINT_SUPPORTED -extern PNG_EXPORT(void,png_set_rgb_to_gray) PNGARG((png_structp png_ptr, - int error_action, double red, double green )); -#endif -extern PNG_EXPORT(void,png_set_rgb_to_gray_fixed) PNGARG((png_structp png_ptr, - int error_action, png_fixed_point red, png_fixed_point green )); -extern PNG_EXPORT(png_byte,png_get_rgb_to_gray_status) PNGARG((png_structp - png_ptr)); -#endif - -extern PNG_EXPORT(void,png_build_grayscale_palette) PNGARG((int bit_depth, - png_colorp palette)); - -#if defined(PNG_READ_STRIP_ALPHA_SUPPORTED) -extern PNG_EXPORT(void,png_set_strip_alpha) PNGARG((png_structp png_ptr)); -#endif - -#if defined(PNG_READ_SWAP_ALPHA_SUPPORTED) || \ - defined(PNG_WRITE_SWAP_ALPHA_SUPPORTED) -extern PNG_EXPORT(void,png_set_swap_alpha) PNGARG((png_structp png_ptr)); -#endif - -#if defined(PNG_READ_INVERT_ALPHA_SUPPORTED) || \ - defined(PNG_WRITE_INVERT_ALPHA_SUPPORTED) -extern PNG_EXPORT(void,png_set_invert_alpha) PNGARG((png_structp png_ptr)); -#endif - -#if defined(PNG_READ_FILLER_SUPPORTED) || defined(PNG_WRITE_FILLER_SUPPORTED) -/* Add a filler byte to 8-bit Gray or 24-bit RGB images. */ -extern PNG_EXPORT(void,png_set_filler) PNGARG((png_structp png_ptr, - png_uint_32 filler, int flags)); -/* The values of the PNG_FILLER_ defines should NOT be changed */ -#define PNG_FILLER_BEFORE 0 -#define PNG_FILLER_AFTER 1 -/* Add an alpha byte to 8-bit Gray or 24-bit RGB images. */ -#if !defined(PNG_1_0_X) -extern PNG_EXPORT(void,png_set_add_alpha) PNGARG((png_structp png_ptr, - png_uint_32 filler, int flags)); -#endif -#endif /* PNG_READ_FILLER_SUPPORTED || PNG_WRITE_FILLER_SUPPORTED */ - -#if defined(PNG_READ_SWAP_SUPPORTED) || defined(PNG_WRITE_SWAP_SUPPORTED) -/* Swap bytes in 16-bit depth files. */ -extern PNG_EXPORT(void,png_set_swap) PNGARG((png_structp png_ptr)); -#endif - -#if defined(PNG_READ_PACK_SUPPORTED) || defined(PNG_WRITE_PACK_SUPPORTED) -/* Use 1 byte per pixel in 1, 2, or 4-bit depth files. */ -extern PNG_EXPORT(void,png_set_packing) PNGARG((png_structp png_ptr)); -#endif - -#if defined(PNG_READ_PACKSWAP_SUPPORTED) || defined(PNG_WRITE_PACKSWAP_SUPPORTED) -/* Swap packing order of pixels in bytes. */ -extern PNG_EXPORT(void,png_set_packswap) PNGARG((png_structp png_ptr)); -#endif - -#if defined(PNG_READ_SHIFT_SUPPORTED) || defined(PNG_WRITE_SHIFT_SUPPORTED) -/* Converts files to legal bit depths. */ -extern PNG_EXPORT(void,png_set_shift) PNGARG((png_structp png_ptr, - png_color_8p true_bits)); -#endif - -#if defined(PNG_READ_INTERLACING_SUPPORTED) || \ - defined(PNG_WRITE_INTERLACING_SUPPORTED) -/* Have the code handle the interlacing. Returns the number of passes. */ -extern PNG_EXPORT(int,png_set_interlace_handling) PNGARG((png_structp png_ptr)); -#endif - -#if defined(PNG_READ_INVERT_SUPPORTED) || defined(PNG_WRITE_INVERT_SUPPORTED) -/* Invert monochrome files */ -extern PNG_EXPORT(void,png_set_invert_mono) PNGARG((png_structp png_ptr)); -#endif - -#if defined(PNG_READ_BACKGROUND_SUPPORTED) -/* Handle alpha and tRNS by replacing with a background color. */ -#ifdef PNG_FLOATING_POINT_SUPPORTED -extern PNG_EXPORT(void,png_set_background) PNGARG((png_structp png_ptr, - png_color_16p background_color, int background_gamma_code, - int need_expand, double background_gamma)); -#endif -#define PNG_BACKGROUND_GAMMA_UNKNOWN 0 -#define PNG_BACKGROUND_GAMMA_SCREEN 1 -#define PNG_BACKGROUND_GAMMA_FILE 2 -#define PNG_BACKGROUND_GAMMA_UNIQUE 3 -#endif - -#if defined(PNG_READ_16_TO_8_SUPPORTED) -/* strip the second byte of information from a 16-bit depth file. */ -extern PNG_EXPORT(void,png_set_strip_16) PNGARG((png_structp png_ptr)); -#endif - -#if defined(PNG_READ_DITHER_SUPPORTED) -/* Turn on dithering, and reduce the palette to the number of colors available. */ -extern PNG_EXPORT(void,png_set_dither) PNGARG((png_structp png_ptr, - png_colorp palette, int num_palette, int maximum_colors, - png_uint_16p histogram, int full_dither)); -#endif - -#if defined(PNG_READ_GAMMA_SUPPORTED) -/* Handle gamma correction. Screen_gamma=(display_exponent) */ -#ifdef PNG_FLOATING_POINT_SUPPORTED -extern PNG_EXPORT(void,png_set_gamma) PNGARG((png_structp png_ptr, - double screen_gamma, double default_file_gamma)); -#endif -#endif - -#if defined(PNG_1_0_X) || defined (PNG_1_2_X) -#if defined(PNG_READ_EMPTY_PLTE_SUPPORTED) || \ - defined(PNG_WRITE_EMPTY_PLTE_SUPPORTED) -/* Permit or disallow empty PLTE (0: not permitted, 1: permitted) */ -/* Deprecated and will be removed. Use png_permit_mng_features() instead. */ -extern PNG_EXPORT(void,png_permit_empty_plte) PNGARG((png_structp png_ptr, - int empty_plte_permitted)); -#endif -#endif - -#if defined(PNG_WRITE_FLUSH_SUPPORTED) -/* Set how many lines between output flushes - 0 for no flushing */ -extern PNG_EXPORT(void,png_set_flush) PNGARG((png_structp png_ptr, int nrows)); -/* Flush the current PNG output buffer */ -extern PNG_EXPORT(void,png_write_flush) PNGARG((png_structp png_ptr)); -#endif - -/* optional update palette with requested transformations */ -extern PNG_EXPORT(void,png_start_read_image) PNGARG((png_structp png_ptr)); - -/* optional call to update the users info structure */ -extern PNG_EXPORT(void,png_read_update_info) PNGARG((png_structp png_ptr, - png_infop info_ptr)); - -#ifndef PNG_NO_SEQUENTIAL_READ_SUPPORTED -/* read one or more rows of image data. */ -extern PNG_EXPORT(void,png_read_rows) PNGARG((png_structp png_ptr, - png_bytepp row, png_bytepp display_row, png_uint_32 num_rows)); -#endif - -#ifndef PNG_NO_SEQUENTIAL_READ_SUPPORTED -/* read a row of data. */ -extern PNG_EXPORT(void,png_read_row) PNGARG((png_structp png_ptr, - png_bytep row, - png_bytep display_row)); -#endif - -#ifndef PNG_NO_SEQUENTIAL_READ_SUPPORTED -/* read the whole image into memory at once. */ -extern PNG_EXPORT(void,png_read_image) PNGARG((png_structp png_ptr, - png_bytepp image)); -#endif - -/* write a row of image data */ -extern PNG_EXPORT(void,png_write_row) PNGARG((png_structp png_ptr, - png_bytep row)); - -/* write a few rows of image data */ -extern PNG_EXPORT(void,png_write_rows) PNGARG((png_structp png_ptr, - png_bytepp row, png_uint_32 num_rows)); - -/* write the image data */ -extern PNG_EXPORT(void,png_write_image) PNGARG((png_structp png_ptr, - png_bytepp image)); - -/* writes the end of the PNG file. */ -extern PNG_EXPORT(void,png_write_end) PNGARG((png_structp png_ptr, - png_infop info_ptr)); - -#ifndef PNG_NO_SEQUENTIAL_READ_SUPPORTED -/* read the end of the PNG file. */ -extern PNG_EXPORT(void,png_read_end) PNGARG((png_structp png_ptr, - png_infop info_ptr)); -#endif - -/* free any memory associated with the png_info_struct */ -extern PNG_EXPORT(void,png_destroy_info_struct) PNGARG((png_structp png_ptr, - png_infopp info_ptr_ptr)); - -/* free any memory associated with the png_struct and the png_info_structs */ -extern PNG_EXPORT(void,png_destroy_read_struct) PNGARG((png_structpp - png_ptr_ptr, png_infopp info_ptr_ptr, png_infopp end_info_ptr_ptr)); - -/* free all memory used by the read (old method - NOT DLL EXPORTED) */ -extern void png_read_destroy PNGARG((png_structp png_ptr, png_infop info_ptr, - png_infop end_info_ptr)); - -/* free any memory associated with the png_struct and the png_info_structs */ -extern PNG_EXPORT(void,png_destroy_write_struct) - PNGARG((png_structpp png_ptr_ptr, png_infopp info_ptr_ptr)); - -/* free any memory used in png_ptr struct (old method - NOT DLL EXPORTED) */ -extern void png_write_destroy PNGARG((png_structp png_ptr)); - -/* set the libpng method of handling chunk CRC errors */ -extern PNG_EXPORT(void,png_set_crc_action) PNGARG((png_structp png_ptr, - int crit_action, int ancil_action)); - -/* Values for png_set_crc_action() to say how to handle CRC errors in - * ancillary and critical chunks, and whether to use the data contained - * therein. Note that it is impossible to "discard" data in a critical - * chunk. For versions prior to 0.90, the action was always error/quit, - * whereas in version 0.90 and later, the action for CRC errors in ancillary - * chunks is warn/discard. These values should NOT be changed. - * - * value action:critical action:ancillary - */ -#define PNG_CRC_DEFAULT 0 /* error/quit warn/discard data */ -#define PNG_CRC_ERROR_QUIT 1 /* error/quit error/quit */ -#define PNG_CRC_WARN_DISCARD 2 /* (INVALID) warn/discard data */ -#define PNG_CRC_WARN_USE 3 /* warn/use data warn/use data */ -#define PNG_CRC_QUIET_USE 4 /* quiet/use data quiet/use data */ -#define PNG_CRC_NO_CHANGE 5 /* use current value use current value */ - -/* These functions give the user control over the scan-line filtering in - * libpng and the compression methods used by zlib. These functions are - * mainly useful for testing, as the defaults should work with most users. - * Those users who are tight on memory or want faster performance at the - * expense of compression can modify them. See the compression library - * header file (zlib.h) for an explination of the compression functions. - */ - -/* set the filtering method(s) used by libpng. Currently, the only valid - * value for "method" is 0. - */ -extern PNG_EXPORT(void,png_set_filter) PNGARG((png_structp png_ptr, int method, - int filters)); - -/* Flags for png_set_filter() to say which filters to use. The flags - * are chosen so that they don't conflict with real filter types - * below, in case they are supplied instead of the #defined constants. - * These values should NOT be changed. - */ -#define PNG_NO_FILTERS 0x00 -#define PNG_FILTER_NONE 0x08 -#define PNG_FILTER_SUB 0x10 -#define PNG_FILTER_UP 0x20 -#define PNG_FILTER_AVG 0x40 -#define PNG_FILTER_PAETH 0x80 -#define PNG_ALL_FILTERS (PNG_FILTER_NONE | PNG_FILTER_SUB | PNG_FILTER_UP | \ - PNG_FILTER_AVG | PNG_FILTER_PAETH) - -/* Filter values (not flags) - used in pngwrite.c, pngwutil.c for now. - * These defines should NOT be changed. - */ -#define PNG_FILTER_VALUE_NONE 0 -#define PNG_FILTER_VALUE_SUB 1 -#define PNG_FILTER_VALUE_UP 2 -#define PNG_FILTER_VALUE_AVG 3 -#define PNG_FILTER_VALUE_PAETH 4 -#define PNG_FILTER_VALUE_LAST 5 - -#if defined(PNG_WRITE_WEIGHTED_FILTER_SUPPORTED) /* EXPERIMENTAL */ -/* The "heuristic_method" is given by one of the PNG_FILTER_HEURISTIC_ - * defines, either the default (minimum-sum-of-absolute-differences), or - * the experimental method (weighted-minimum-sum-of-absolute-differences). - * - * Weights are factors >= 1.0, indicating how important it is to keep the - * filter type consistent between rows. Larger numbers mean the current - * filter is that many times as likely to be the same as the "num_weights" - * previous filters. This is cumulative for each previous row with a weight. - * There needs to be "num_weights" values in "filter_weights", or it can be - * NULL if the weights aren't being specified. Weights have no influence on - * the selection of the first row filter. Well chosen weights can (in theory) - * improve the compression for a given image. - * - * Costs are factors >= 1.0 indicating the relative decoding costs of a - * filter type. Higher costs indicate more decoding expense, and are - * therefore less likely to be selected over a filter with lower computational - * costs. There needs to be a value in "filter_costs" for each valid filter - * type (given by PNG_FILTER_VALUE_LAST), or it can be NULL if you aren't - * setting the costs. Costs try to improve the speed of decompression without - * unduly increasing the compressed image size. - * - * A negative weight or cost indicates the default value is to be used, and - * values in the range [0.0, 1.0) indicate the value is to remain unchanged. - * The default values for both weights and costs are currently 1.0, but may - * change if good general weighting/cost heuristics can be found. If both - * the weights and costs are set to 1.0, this degenerates the WEIGHTED method - * to the UNWEIGHTED method, but with added encoding time/computation. - */ -#ifdef PNG_FLOATING_POINT_SUPPORTED -extern PNG_EXPORT(void,png_set_filter_heuristics) PNGARG((png_structp png_ptr, - int heuristic_method, int num_weights, png_doublep filter_weights, - png_doublep filter_costs)); -#endif -#endif /* PNG_WRITE_WEIGHTED_FILTER_SUPPORTED */ - -/* Heuristic used for row filter selection. These defines should NOT be - * changed. - */ -#define PNG_FILTER_HEURISTIC_DEFAULT 0 /* Currently "UNWEIGHTED" */ -#define PNG_FILTER_HEURISTIC_UNWEIGHTED 1 /* Used by libpng < 0.95 */ -#define PNG_FILTER_HEURISTIC_WEIGHTED 2 /* Experimental feature */ -#define PNG_FILTER_HEURISTIC_LAST 3 /* Not a valid value */ - -/* Set the library compression level. Currently, valid values range from - * 0 - 9, corresponding directly to the zlib compression levels 0 - 9 - * (0 - no compression, 9 - "maximal" compression). Note that tests have - * shown that zlib compression levels 3-6 usually perform as well as level 9 - * for PNG images, and do considerably fewer caclulations. In the future, - * these values may not correspond directly to the zlib compression levels. - */ -extern PNG_EXPORT(void,png_set_compression_level) PNGARG((png_structp png_ptr, - int level)); - -extern PNG_EXPORT(void,png_set_compression_mem_level) - PNGARG((png_structp png_ptr, int mem_level)); - -extern PNG_EXPORT(void,png_set_compression_strategy) - PNGARG((png_structp png_ptr, int strategy)); - -extern PNG_EXPORT(void,png_set_compression_window_bits) - PNGARG((png_structp png_ptr, int window_bits)); - -extern PNG_EXPORT(void,png_set_compression_method) PNGARG((png_structp png_ptr, - int method)); - -/* These next functions are called for input/output, memory, and error - * handling. They are in the file pngrio.c, pngwio.c, and pngerror.c, - * and call standard C I/O routines such as fread(), fwrite(), and - * fprintf(). These functions can be made to use other I/O routines - * at run time for those applications that need to handle I/O in a - * different manner by calling png_set_???_fn(). See libpng.txt for - * more information. - */ - -#if !defined(PNG_NO_STDIO) -/* Initialize the input/output for the PNG file to the default functions. */ -extern PNG_EXPORT(void,png_init_io) PNGARG((png_structp png_ptr, png_FILE_p fp)); -#endif - -/* Replace the (error and abort), and warning functions with user - * supplied functions. If no messages are to be printed you must still - * write and use replacement functions. The replacement error_fn should - * still do a longjmp to the last setjmp location if you are using this - * method of error handling. If error_fn or warning_fn is NULL, the - * default function will be used. - */ - -extern PNG_EXPORT(void,png_set_error_fn) PNGARG((png_structp png_ptr, - png_voidp error_ptr, png_error_ptr error_fn, png_error_ptr warning_fn)); - -/* Return the user pointer associated with the error functions */ -extern PNG_EXPORT(png_voidp,png_get_error_ptr) PNGARG((png_structp png_ptr)); - -/* Replace the default data output functions with a user supplied one(s). - * If buffered output is not used, then output_flush_fn can be set to NULL. - * If PNG_WRITE_FLUSH_SUPPORTED is not defined at libpng compile time - * output_flush_fn will be ignored (and thus can be NULL). - */ -extern PNG_EXPORT(void,png_set_write_fn) PNGARG((png_structp png_ptr, - png_voidp io_ptr, png_rw_ptr write_data_fn, png_flush_ptr output_flush_fn)); - -/* Replace the default data input function with a user supplied one. */ -extern PNG_EXPORT(void,png_set_read_fn) PNGARG((png_structp png_ptr, - png_voidp io_ptr, png_rw_ptr read_data_fn)); - -/* Return the user pointer associated with the I/O functions */ -extern PNG_EXPORT(png_voidp,png_get_io_ptr) PNGARG((png_structp png_ptr)); - -extern PNG_EXPORT(void,png_set_read_status_fn) PNGARG((png_structp png_ptr, - png_read_status_ptr read_row_fn)); - -extern PNG_EXPORT(void,png_set_write_status_fn) PNGARG((png_structp png_ptr, - png_write_status_ptr write_row_fn)); - -#ifdef PNG_USER_MEM_SUPPORTED -/* Replace the default memory allocation functions with user supplied one(s). */ -extern PNG_EXPORT(void,png_set_mem_fn) PNGARG((png_structp png_ptr, - png_voidp mem_ptr, png_malloc_ptr malloc_fn, png_free_ptr free_fn)); -/* Return the user pointer associated with the memory functions */ -extern PNG_EXPORT(png_voidp,png_get_mem_ptr) PNGARG((png_structp png_ptr)); -#endif - -#if defined(PNG_READ_USER_TRANSFORM_SUPPORTED) || \ - defined(PNG_LEGACY_SUPPORTED) -extern PNG_EXPORT(void,png_set_read_user_transform_fn) PNGARG((png_structp - png_ptr, png_user_transform_ptr read_user_transform_fn)); -#endif - -#if defined(PNG_WRITE_USER_TRANSFORM_SUPPORTED) || \ - defined(PNG_LEGACY_SUPPORTED) -extern PNG_EXPORT(void,png_set_write_user_transform_fn) PNGARG((png_structp - png_ptr, png_user_transform_ptr write_user_transform_fn)); -#endif - -#if defined(PNG_READ_USER_TRANSFORM_SUPPORTED) || \ - defined(PNG_WRITE_USER_TRANSFORM_SUPPORTED) || \ - defined(PNG_LEGACY_SUPPORTED) -extern PNG_EXPORT(void,png_set_user_transform_info) PNGARG((png_structp - png_ptr, png_voidp user_transform_ptr, int user_transform_depth, - int user_transform_channels)); -/* Return the user pointer associated with the user transform functions */ -extern PNG_EXPORT(png_voidp,png_get_user_transform_ptr) - PNGARG((png_structp png_ptr)); -#endif - -#ifdef PNG_USER_CHUNKS_SUPPORTED -extern PNG_EXPORT(void,png_set_read_user_chunk_fn) PNGARG((png_structp png_ptr, - png_voidp user_chunk_ptr, png_user_chunk_ptr read_user_chunk_fn)); -extern PNG_EXPORT(png_voidp,png_get_user_chunk_ptr) PNGARG((png_structp - png_ptr)); -#endif - -#ifdef PNG_PROGRESSIVE_READ_SUPPORTED -/* Sets the function callbacks for the push reader, and a pointer to a - * user-defined structure available to the callback functions. - */ -extern PNG_EXPORT(void,png_set_progressive_read_fn) PNGARG((png_structp png_ptr, - png_voidp progressive_ptr, - png_progressive_info_ptr info_fn, png_progressive_row_ptr row_fn, - png_progressive_end_ptr end_fn)); - -/* returns the user pointer associated with the push read functions */ -extern PNG_EXPORT(png_voidp,png_get_progressive_ptr) - PNGARG((png_structp png_ptr)); - -/* function to be called when data becomes available */ -extern PNG_EXPORT(void,png_process_data) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_bytep buffer, png_size_t buffer_size)); - -/* function that combines rows. Not very much different than the - * png_combine_row() call. Is this even used????? - */ -extern PNG_EXPORT(void,png_progressive_combine_row) PNGARG((png_structp png_ptr, - png_bytep old_row, png_bytep new_row)); -#endif /* PNG_PROGRESSIVE_READ_SUPPORTED */ - -extern PNG_EXPORT(png_voidp,png_malloc) PNGARG((png_structp png_ptr, - png_uint_32 size)); - -#if defined(PNG_1_0_X) -# define png_malloc_warn png_malloc -#else -/* Added at libpng version 1.2.4 */ -extern PNG_EXPORT(png_voidp,png_malloc_warn) PNGARG((png_structp png_ptr, - png_uint_32 size)); -#endif - -/* frees a pointer allocated by png_malloc() */ -extern PNG_EXPORT(void,png_free) PNGARG((png_structp png_ptr, png_voidp ptr)); - -#if defined(PNG_1_0_X) -/* Function to allocate memory for zlib. */ -extern PNG_EXPORT(voidpf,png_zalloc) PNGARG((voidpf png_ptr, uInt items, - uInt size)); - -/* Function to free memory for zlib */ -extern PNG_EXPORT(void,png_zfree) PNGARG((voidpf png_ptr, voidpf ptr)); -#endif - -/* Free data that was allocated internally */ -extern PNG_EXPORT(void,png_free_data) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_uint_32 free_me, int num)); -#ifdef PNG_FREE_ME_SUPPORTED -/* Reassign responsibility for freeing existing data, whether allocated - * by libpng or by the application */ -extern PNG_EXPORT(void,png_data_freer) PNGARG((png_structp png_ptr, - png_infop info_ptr, int freer, png_uint_32 mask)); -#endif -/* assignments for png_data_freer */ -#define PNG_DESTROY_WILL_FREE_DATA 1 -#define PNG_SET_WILL_FREE_DATA 1 -#define PNG_USER_WILL_FREE_DATA 2 -/* Flags for png_ptr->free_me and info_ptr->free_me */ -#define PNG_FREE_HIST 0x0008 -#define PNG_FREE_ICCP 0x0010 -#define PNG_FREE_SPLT 0x0020 -#define PNG_FREE_ROWS 0x0040 -#define PNG_FREE_PCAL 0x0080 -#define PNG_FREE_SCAL 0x0100 -#define PNG_FREE_UNKN 0x0200 -#define PNG_FREE_LIST 0x0400 -#define PNG_FREE_PLTE 0x1000 -#define PNG_FREE_TRNS 0x2000 -#define PNG_FREE_TEXT 0x4000 -#define PNG_FREE_ALL 0x7fff -#define PNG_FREE_MUL 0x4220 /* PNG_FREE_SPLT|PNG_FREE_TEXT|PNG_FREE_UNKN */ - -#ifdef PNG_USER_MEM_SUPPORTED -extern PNG_EXPORT(png_voidp,png_malloc_default) PNGARG((png_structp png_ptr, - png_uint_32 size)); -extern PNG_EXPORT(void,png_free_default) PNGARG((png_structp png_ptr, - png_voidp ptr)); -#endif - -extern PNG_EXPORT(png_voidp,png_memcpy_check) PNGARG((png_structp png_ptr, - png_voidp s1, png_voidp s2, png_uint_32 size)); - -extern PNG_EXPORT(png_voidp,png_memset_check) PNGARG((png_structp png_ptr, - png_voidp s1, int value, png_uint_32 size)); - -#if defined(USE_FAR_KEYWORD) /* memory model conversion function */ -extern void *png_far_to_near PNGARG((png_structp png_ptr,png_voidp ptr, - int check)); -#endif /* USE_FAR_KEYWORD */ - -#ifndef PNG_NO_ERROR_TEXT -/* Fatal error in PNG image of libpng - can't continue */ -extern PNG_EXPORT(void,png_error) PNGARG((png_structp png_ptr, - png_const_charp error_message)); - -/* The same, but the chunk name is prepended to the error string. */ -extern PNG_EXPORT(void,png_chunk_error) PNGARG((png_structp png_ptr, - png_const_charp error_message)); -#else -/* Fatal error in PNG image of libpng - can't continue */ -extern PNG_EXPORT(void,png_err) PNGARG((png_structp png_ptr)); -#endif - -#ifndef PNG_NO_WARNINGS -/* Non-fatal error in libpng. Can continue, but may have a problem. */ -extern PNG_EXPORT(void,png_warning) PNGARG((png_structp png_ptr, - png_const_charp warning_message)); - -#ifdef PNG_READ_SUPPORTED -/* Non-fatal error in libpng, chunk name is prepended to message. */ -extern PNG_EXPORT(void,png_chunk_warning) PNGARG((png_structp png_ptr, - png_const_charp warning_message)); -#endif /* PNG_READ_SUPPORTED */ -#endif /* PNG_NO_WARNINGS */ - -/* The png_set_ functions are for storing values in the png_info_struct. - * Similarly, the png_get_ calls are used to read values from the - * png_info_struct, either storing the parameters in the passed variables, or - * setting pointers into the png_info_struct where the data is stored. The - * png_get_ functions return a non-zero value if the data was available - * in info_ptr, or return zero and do not change any of the parameters if the - * data was not available. - * - * These functions should be used instead of directly accessing png_info - * to avoid problems with future changes in the size and internal layout of - * png_info_struct. - */ -/* Returns "flag" if chunk data is valid in info_ptr. */ -extern PNG_EXPORT(png_uint_32,png_get_valid) PNGARG((png_structp png_ptr, -png_infop info_ptr, png_uint_32 flag)); - -/* Returns number of bytes needed to hold a transformed row. */ -extern PNG_EXPORT(png_uint_32,png_get_rowbytes) PNGARG((png_structp png_ptr, -png_infop info_ptr)); - -#if defined(PNG_INFO_IMAGE_SUPPORTED) -/* Returns row_pointers, which is an array of pointers to scanlines that was -returned from png_read_png(). */ -extern PNG_EXPORT(png_bytepp,png_get_rows) PNGARG((png_structp png_ptr, -png_infop info_ptr)); -/* Set row_pointers, which is an array of pointers to scanlines for use -by png_write_png(). */ -extern PNG_EXPORT(void,png_set_rows) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_bytepp row_pointers)); -#endif - -/* Returns number of color channels in image. */ -extern PNG_EXPORT(png_byte,png_get_channels) PNGARG((png_structp png_ptr, -png_infop info_ptr)); - -#ifdef PNG_EASY_ACCESS_SUPPORTED -/* Returns image width in pixels. */ -extern PNG_EXPORT(png_uint_32, png_get_image_width) PNGARG((png_structp -png_ptr, png_infop info_ptr)); - -/* Returns image height in pixels. */ -extern PNG_EXPORT(png_uint_32, png_get_image_height) PNGARG((png_structp -png_ptr, png_infop info_ptr)); - -/* Returns image bit_depth. */ -extern PNG_EXPORT(png_byte, png_get_bit_depth) PNGARG((png_structp -png_ptr, png_infop info_ptr)); - -/* Returns image color_type. */ -extern PNG_EXPORT(png_byte, png_get_color_type) PNGARG((png_structp -png_ptr, png_infop info_ptr)); - -/* Returns image filter_type. */ -extern PNG_EXPORT(png_byte, png_get_filter_type) PNGARG((png_structp -png_ptr, png_infop info_ptr)); - -/* Returns image interlace_type. */ -extern PNG_EXPORT(png_byte, png_get_interlace_type) PNGARG((png_structp -png_ptr, png_infop info_ptr)); - -/* Returns image compression_type. */ -extern PNG_EXPORT(png_byte, png_get_compression_type) PNGARG((png_structp -png_ptr, png_infop info_ptr)); - -/* Returns image resolution in pixels per meter, from pHYs chunk data. */ -extern PNG_EXPORT(png_uint_32, png_get_pixels_per_meter) PNGARG((png_structp -png_ptr, png_infop info_ptr)); -extern PNG_EXPORT(png_uint_32, png_get_x_pixels_per_meter) PNGARG((png_structp -png_ptr, png_infop info_ptr)); -extern PNG_EXPORT(png_uint_32, png_get_y_pixels_per_meter) PNGARG((png_structp -png_ptr, png_infop info_ptr)); - -/* Returns pixel aspect ratio, computed from pHYs chunk data. */ -#ifdef PNG_FLOATING_POINT_SUPPORTED -extern PNG_EXPORT(float, png_get_pixel_aspect_ratio) PNGARG((png_structp -png_ptr, png_infop info_ptr)); -#endif - -/* Returns image x, y offset in pixels or microns, from oFFs chunk data. */ -extern PNG_EXPORT(png_int_32, png_get_x_offset_pixels) PNGARG((png_structp -png_ptr, png_infop info_ptr)); -extern PNG_EXPORT(png_int_32, png_get_y_offset_pixels) PNGARG((png_structp -png_ptr, png_infop info_ptr)); -extern PNG_EXPORT(png_int_32, png_get_x_offset_microns) PNGARG((png_structp -png_ptr, png_infop info_ptr)); -extern PNG_EXPORT(png_int_32, png_get_y_offset_microns) PNGARG((png_structp -png_ptr, png_infop info_ptr)); - -#endif /* PNG_EASY_ACCESS_SUPPORTED */ - -/* Returns pointer to signature string read from PNG header */ -extern PNG_EXPORT(png_bytep,png_get_signature) PNGARG((png_structp png_ptr, -png_infop info_ptr)); - -#if defined(PNG_bKGD_SUPPORTED) -extern PNG_EXPORT(png_uint_32,png_get_bKGD) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_color_16p *background)); -#endif - -#if defined(PNG_bKGD_SUPPORTED) -extern PNG_EXPORT(void,png_set_bKGD) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_color_16p background)); -#endif - -#if defined(PNG_cHRM_SUPPORTED) -#ifdef PNG_FLOATING_POINT_SUPPORTED -extern PNG_EXPORT(png_uint_32,png_get_cHRM) PNGARG((png_structp png_ptr, - png_infop info_ptr, double *white_x, double *white_y, double *red_x, - double *red_y, double *green_x, double *green_y, double *blue_x, - double *blue_y)); -#endif -#ifdef PNG_FIXED_POINT_SUPPORTED -extern PNG_EXPORT(png_uint_32,png_get_cHRM_fixed) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_fixed_point *int_white_x, png_fixed_point - *int_white_y, png_fixed_point *int_red_x, png_fixed_point *int_red_y, - png_fixed_point *int_green_x, png_fixed_point *int_green_y, png_fixed_point - *int_blue_x, png_fixed_point *int_blue_y)); -#endif -#endif - -#if defined(PNG_cHRM_SUPPORTED) -#ifdef PNG_FLOATING_POINT_SUPPORTED -extern PNG_EXPORT(void,png_set_cHRM) PNGARG((png_structp png_ptr, - png_infop info_ptr, double white_x, double white_y, double red_x, - double red_y, double green_x, double green_y, double blue_x, double blue_y)); -#endif -#ifdef PNG_FIXED_POINT_SUPPORTED -extern PNG_EXPORT(void,png_set_cHRM_fixed) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_fixed_point int_white_x, png_fixed_point int_white_y, - png_fixed_point int_red_x, png_fixed_point int_red_y, png_fixed_point - int_green_x, png_fixed_point int_green_y, png_fixed_point int_blue_x, - png_fixed_point int_blue_y)); -#endif -#endif - -#if defined(PNG_gAMA_SUPPORTED) -#ifdef PNG_FLOATING_POINT_SUPPORTED -extern PNG_EXPORT(png_uint_32,png_get_gAMA) PNGARG((png_structp png_ptr, - png_infop info_ptr, double *file_gamma)); -#endif -extern PNG_EXPORT(png_uint_32,png_get_gAMA_fixed) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_fixed_point *int_file_gamma)); -#endif - -#if defined(PNG_gAMA_SUPPORTED) -#ifdef PNG_FLOATING_POINT_SUPPORTED -extern PNG_EXPORT(void,png_set_gAMA) PNGARG((png_structp png_ptr, - png_infop info_ptr, double file_gamma)); -#endif -extern PNG_EXPORT(void,png_set_gAMA_fixed) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_fixed_point int_file_gamma)); -#endif - -#if defined(PNG_hIST_SUPPORTED) -extern PNG_EXPORT(png_uint_32,png_get_hIST) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_uint_16p *hist)); -#endif - -#if defined(PNG_hIST_SUPPORTED) -extern PNG_EXPORT(void,png_set_hIST) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_uint_16p hist)); -#endif - -extern PNG_EXPORT(png_uint_32,png_get_IHDR) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_uint_32 *width, png_uint_32 *height, - int *bit_depth, int *color_type, int *interlace_method, - int *compression_method, int *filter_method)); - -extern PNG_EXPORT(void,png_set_IHDR) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_uint_32 width, png_uint_32 height, int bit_depth, - int color_type, int interlace_method, int compression_method, - int filter_method)); - -#if defined(PNG_oFFs_SUPPORTED) -extern PNG_EXPORT(png_uint_32,png_get_oFFs) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_int_32 *offset_x, png_int_32 *offset_y, - int *unit_type)); -#endif - -#if defined(PNG_oFFs_SUPPORTED) -extern PNG_EXPORT(void,png_set_oFFs) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_int_32 offset_x, png_int_32 offset_y, - int unit_type)); -#endif - -#if defined(PNG_pCAL_SUPPORTED) -extern PNG_EXPORT(png_uint_32,png_get_pCAL) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_charp *purpose, png_int_32 *X0, png_int_32 *X1, - int *type, int *nparams, png_charp *units, png_charpp *params)); -#endif - -#if defined(PNG_pCAL_SUPPORTED) -extern PNG_EXPORT(void,png_set_pCAL) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_charp purpose, png_int_32 X0, png_int_32 X1, - int type, int nparams, png_charp units, png_charpp params)); -#endif - -#if defined(PNG_pHYs_SUPPORTED) -extern PNG_EXPORT(png_uint_32,png_get_pHYs) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_uint_32 *res_x, png_uint_32 *res_y, int *unit_type)); -#endif - -#if defined(PNG_pHYs_SUPPORTED) -extern PNG_EXPORT(void,png_set_pHYs) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_uint_32 res_x, png_uint_32 res_y, int unit_type)); -#endif - -extern PNG_EXPORT(png_uint_32,png_get_PLTE) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_colorp *palette, int *num_palette)); - -extern PNG_EXPORT(void,png_set_PLTE) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_colorp palette, int num_palette)); - -#if defined(PNG_sBIT_SUPPORTED) -extern PNG_EXPORT(png_uint_32,png_get_sBIT) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_color_8p *sig_bit)); -#endif - -#if defined(PNG_sBIT_SUPPORTED) -extern PNG_EXPORT(void,png_set_sBIT) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_color_8p sig_bit)); -#endif - -#if defined(PNG_sRGB_SUPPORTED) -extern PNG_EXPORT(png_uint_32,png_get_sRGB) PNGARG((png_structp png_ptr, - png_infop info_ptr, int *intent)); -#endif - -#if defined(PNG_sRGB_SUPPORTED) -extern PNG_EXPORT(void,png_set_sRGB) PNGARG((png_structp png_ptr, - png_infop info_ptr, int intent)); -extern PNG_EXPORT(void,png_set_sRGB_gAMA_and_cHRM) PNGARG((png_structp png_ptr, - png_infop info_ptr, int intent)); -#endif - -#if defined(PNG_iCCP_SUPPORTED) -extern PNG_EXPORT(png_uint_32,png_get_iCCP) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_charpp name, int *compression_type, - png_charpp profile, png_uint_32 *proflen)); - /* Note to maintainer: profile should be png_bytepp */ -#endif - -#if defined(PNG_iCCP_SUPPORTED) -extern PNG_EXPORT(void,png_set_iCCP) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_charp name, int compression_type, - png_charp profile, png_uint_32 proflen)); - /* Note to maintainer: profile should be png_bytep */ -#endif - -#if defined(PNG_sPLT_SUPPORTED) -extern PNG_EXPORT(png_uint_32,png_get_sPLT) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_sPLT_tpp entries)); -#endif - -#if defined(PNG_sPLT_SUPPORTED) -extern PNG_EXPORT(void,png_set_sPLT) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_sPLT_tp entries, int nentries)); -#endif - -#if defined(PNG_TEXT_SUPPORTED) -/* png_get_text also returns the number of text chunks in *num_text */ -extern PNG_EXPORT(png_uint_32,png_get_text) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_textp *text_ptr, int *num_text)); -#endif - -/* - * Note while png_set_text() will accept a structure whose text, - * language, and translated keywords are NULL pointers, the structure - * returned by png_get_text will always contain regular - * zero-terminated C strings. They might be empty strings but - * they will never be NULL pointers. - */ - -#if defined(PNG_TEXT_SUPPORTED) -extern PNG_EXPORT(void,png_set_text) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_textp text_ptr, int num_text)); -#endif - -#if defined(PNG_tIME_SUPPORTED) -extern PNG_EXPORT(png_uint_32,png_get_tIME) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_timep *mod_time)); -#endif - -#if defined(PNG_tIME_SUPPORTED) -extern PNG_EXPORT(void,png_set_tIME) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_timep mod_time)); -#endif - -#if defined(PNG_tRNS_SUPPORTED) -extern PNG_EXPORT(png_uint_32,png_get_tRNS) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_bytep *trans, int *num_trans, - png_color_16p *trans_values)); -#endif - -#if defined(PNG_tRNS_SUPPORTED) -extern PNG_EXPORT(void,png_set_tRNS) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_bytep trans, int num_trans, - png_color_16p trans_values)); -#endif - -#if defined(PNG_tRNS_SUPPORTED) -#endif - -#if defined(PNG_sCAL_SUPPORTED) -#ifdef PNG_FLOATING_POINT_SUPPORTED -extern PNG_EXPORT(png_uint_32,png_get_sCAL) PNGARG((png_structp png_ptr, - png_infop info_ptr, int *unit, double *width, double *height)); -#else -#ifdef PNG_FIXED_POINT_SUPPORTED -extern PNG_EXPORT(png_uint_32,png_get_sCAL_s) PNGARG((png_structp png_ptr, - png_infop info_ptr, int *unit, png_charpp swidth, png_charpp sheight)); -#endif -#endif -#endif /* PNG_sCAL_SUPPORTED */ - -#if defined(PNG_sCAL_SUPPORTED) -#ifdef PNG_FLOATING_POINT_SUPPORTED -extern PNG_EXPORT(void,png_set_sCAL) PNGARG((png_structp png_ptr, - png_infop info_ptr, int unit, double width, double height)); -#else -#ifdef PNG_FIXED_POINT_SUPPORTED -extern PNG_EXPORT(void,png_set_sCAL_s) PNGARG((png_structp png_ptr, - png_infop info_ptr, int unit, png_charp swidth, png_charp sheight)); -#endif -#endif -#endif /* PNG_sCAL_SUPPORTED || PNG_WRITE_sCAL_SUPPORTED */ - -#if defined(PNG_UNKNOWN_CHUNKS_SUPPORTED) -/* provide a list of chunks and how they are to be handled, if the built-in - handling or default unknown chunk handling is not desired. Any chunks not - listed will be handled in the default manner. The IHDR and IEND chunks - must not be listed. - keep = 0: follow default behaviour - = 1: do not keep - = 2: keep only if safe-to-copy - = 3: keep even if unsafe-to-copy -*/ -extern PNG_EXPORT(void, png_set_keep_unknown_chunks) PNGARG((png_structp - png_ptr, int keep, png_bytep chunk_list, int num_chunks)); -extern PNG_EXPORT(void, png_set_unknown_chunks) PNGARG((png_structp png_ptr, - png_infop info_ptr, png_unknown_chunkp unknowns, int num_unknowns)); -extern PNG_EXPORT(void, png_set_unknown_chunk_location) - PNGARG((png_structp png_ptr, png_infop info_ptr, int chunk, int location)); -extern PNG_EXPORT(png_uint_32,png_get_unknown_chunks) PNGARG((png_structp - png_ptr, png_infop info_ptr, png_unknown_chunkpp entries)); -#endif -#ifdef PNG_HANDLE_AS_UNKNOWN_SUPPORTED -PNG_EXPORT(int,png_handle_as_unknown) PNGARG((png_structp png_ptr, png_bytep - chunk_name)); -#endif - -/* Png_free_data() will turn off the "valid" flag for anything it frees. - If you need to turn it off for a chunk that your application has freed, - you can use png_set_invalid(png_ptr, info_ptr, PNG_INFO_CHNK); */ -extern PNG_EXPORT(void, png_set_invalid) PNGARG((png_structp png_ptr, - png_infop info_ptr, int mask)); - -#if defined(PNG_INFO_IMAGE_SUPPORTED) -/* The "params" pointer is currently not used and is for future expansion. */ -extern PNG_EXPORT(void, png_read_png) PNGARG((png_structp png_ptr, - png_infop info_ptr, - int transforms, - png_voidp params)); -extern PNG_EXPORT(void, png_write_png) PNGARG((png_structp png_ptr, - png_infop info_ptr, - int transforms, - png_voidp params)); -#endif - -/* Define PNG_DEBUG at compile time for debugging information. Higher - * numbers for PNG_DEBUG mean more debugging information. This has - * only been added since version 0.95 so it is not implemented throughout - * libpng yet, but more support will be added as needed. - */ -#ifdef PNG_DEBUG -#if (PNG_DEBUG > 0) -#if !defined(PNG_DEBUG_FILE) && defined(_MSC_VER) -#include -#if (PNG_DEBUG > 1) -#define png_debug(l,m) _RPT0(_CRT_WARN,m) -#define png_debug1(l,m,p1) _RPT1(_CRT_WARN,m,p1) -#define png_debug2(l,m,p1,p2) _RPT2(_CRT_WARN,m,p1,p2) -#endif -#else /* PNG_DEBUG_FILE || !_MSC_VER */ -#ifndef PNG_DEBUG_FILE -#define PNG_DEBUG_FILE stderr -#endif /* PNG_DEBUG_FILE */ -#if (PNG_DEBUG > 1) -#define png_debug(l,m) \ -{ \ - int num_tabs=l; \ - fprintf(PNG_DEBUG_FILE,"%s"m,(num_tabs==1 ? "\t" : \ - (num_tabs==2 ? "\t\t":(num_tabs>2 ? "\t\t\t":"")))); \ -} -#define png_debug1(l,m,p1) \ -{ \ - int num_tabs=l; \ - fprintf(PNG_DEBUG_FILE,"%s"m,(num_tabs==1 ? "\t" : \ - (num_tabs==2 ? "\t\t":(num_tabs>2 ? "\t\t\t":""))),p1); \ -} -#define png_debug2(l,m,p1,p2) \ -{ \ - int num_tabs=l; \ - fprintf(PNG_DEBUG_FILE,"%s"m,(num_tabs==1 ? "\t" : \ - (num_tabs==2 ? "\t\t":(num_tabs>2 ? "\t\t\t":""))),p1,p2); \ -} -#endif /* (PNG_DEBUG > 1) */ -#endif /* _MSC_VER */ -#endif /* (PNG_DEBUG > 0) */ -#endif /* PNG_DEBUG */ -#ifndef png_debug -#define png_debug(l, m) -#endif -#ifndef png_debug1 -#define png_debug1(l, m, p1) -#endif -#ifndef png_debug2 -#define png_debug2(l, m, p1, p2) -#endif - -extern PNG_EXPORT(png_charp,png_get_copyright) PNGARG((png_structp png_ptr)); -extern PNG_EXPORT(png_charp,png_get_header_ver) PNGARG((png_structp png_ptr)); -extern PNG_EXPORT(png_charp,png_get_header_version) PNGARG((png_structp png_ptr)); -extern PNG_EXPORT(png_charp,png_get_libpng_ver) PNGARG((png_structp png_ptr)); - -#ifdef PNG_MNG_FEATURES_SUPPORTED -extern PNG_EXPORT(png_uint_32,png_permit_mng_features) PNGARG((png_structp - png_ptr, png_uint_32 mng_features_permitted)); -#endif - -/* For use in png_set_keep_unknown, added to version 1.2.6 */ -#define PNG_HANDLE_CHUNK_AS_DEFAULT 0 -#define PNG_HANDLE_CHUNK_NEVER 1 -#define PNG_HANDLE_CHUNK_IF_SAFE 2 -#define PNG_HANDLE_CHUNK_ALWAYS 3 - -/* Added to version 1.2.0 */ -#if defined(PNG_ASSEMBLER_CODE_SUPPORTED) -#if defined(PNG_MMX_CODE_SUPPORTED) -#define PNG_ASM_FLAG_MMX_SUPPORT_COMPILED 0x01 /* not user-settable */ -#define PNG_ASM_FLAG_MMX_SUPPORT_IN_CPU 0x02 /* not user-settable */ -#define PNG_ASM_FLAG_MMX_READ_COMBINE_ROW 0x04 -#define PNG_ASM_FLAG_MMX_READ_INTERLACE 0x08 -#define PNG_ASM_FLAG_MMX_READ_FILTER_SUB 0x10 -#define PNG_ASM_FLAG_MMX_READ_FILTER_UP 0x20 -#define PNG_ASM_FLAG_MMX_READ_FILTER_AVG 0x40 -#define PNG_ASM_FLAG_MMX_READ_FILTER_PAETH 0x80 -#define PNG_ASM_FLAGS_INITIALIZED 0x80000000 /* not user-settable */ - -#define PNG_MMX_READ_FLAGS ( PNG_ASM_FLAG_MMX_READ_COMBINE_ROW \ - | PNG_ASM_FLAG_MMX_READ_INTERLACE \ - | PNG_ASM_FLAG_MMX_READ_FILTER_SUB \ - | PNG_ASM_FLAG_MMX_READ_FILTER_UP \ - | PNG_ASM_FLAG_MMX_READ_FILTER_AVG \ - | PNG_ASM_FLAG_MMX_READ_FILTER_PAETH ) -#define PNG_MMX_WRITE_FLAGS ( 0 ) - -#define PNG_MMX_FLAGS ( PNG_ASM_FLAG_MMX_SUPPORT_COMPILED \ - | PNG_ASM_FLAG_MMX_SUPPORT_IN_CPU \ - | PNG_MMX_READ_FLAGS \ - | PNG_MMX_WRITE_FLAGS ) - -#define PNG_SELECT_READ 1 -#define PNG_SELECT_WRITE 2 -#endif /* PNG_MMX_CODE_SUPPORTED */ - -#if !defined(PNG_1_0_X) -/* pngget.c */ -extern PNG_EXPORT(png_uint_32,png_get_mmx_flagmask) - PNGARG((int flag_select, int *compilerID)); - -/* pngget.c */ -extern PNG_EXPORT(png_uint_32,png_get_asm_flagmask) - PNGARG((int flag_select)); - -/* pngget.c */ -extern PNG_EXPORT(png_uint_32,png_get_asm_flags) - PNGARG((png_structp png_ptr)); - -/* pngget.c */ -extern PNG_EXPORT(png_byte,png_get_mmx_bitdepth_threshold) - PNGARG((png_structp png_ptr)); - -/* pngget.c */ -extern PNG_EXPORT(png_uint_32,png_get_mmx_rowbytes_threshold) - PNGARG((png_structp png_ptr)); - -/* pngset.c */ -extern PNG_EXPORT(void,png_set_asm_flags) - PNGARG((png_structp png_ptr, png_uint_32 asm_flags)); - -/* pngset.c */ -extern PNG_EXPORT(void,png_set_mmx_thresholds) - PNGARG((png_structp png_ptr, png_byte mmx_bitdepth_threshold, - png_uint_32 mmx_rowbytes_threshold)); - -#endif /* PNG_1_0_X */ - -#if !defined(PNG_1_0_X) -/* png.c, pnggccrd.c, or pngvcrd.c */ -extern PNG_EXPORT(int,png_mmx_support) PNGARG((void)); -#endif /* PNG_ASSEMBLER_CODE_SUPPORTED */ - -/* Strip the prepended error numbers ("#nnn ") from error and warning - * messages before passing them to the error or warning handler. */ -#ifdef PNG_ERROR_NUMBERS_SUPPORTED -extern PNG_EXPORT(void,png_set_strip_error_numbers) PNGARG((png_structp - png_ptr, png_uint_32 strip_mode)); -#endif - -#endif /* PNG_1_0_X */ - -/* Added at libpng-1.2.6 */ -#ifdef PNG_SET_USER_LIMITS_SUPPORTED -extern PNG_EXPORT(void,png_set_user_limits) PNGARG((png_structp - png_ptr, png_uint_32 user_width_max, png_uint_32 user_height_max)); -extern PNG_EXPORT(png_uint_32,png_get_user_width_max) PNGARG((png_structp - png_ptr)); -extern PNG_EXPORT(png_uint_32,png_get_user_height_max) PNGARG((png_structp - png_ptr)); -#endif - -/* Maintainer: Put new public prototypes here ^, in libpng.3, and project defs */ - -#ifdef PNG_READ_COMPOSITE_NODIV_SUPPORTED -/* With these routines we avoid an integer divide, which will be slower on - * most machines. However, it does take more operations than the corresponding - * divide method, so it may be slower on a few RISC systems. There are two - * shifts (by 8 or 16 bits) and an addition, versus a single integer divide. - * - * Note that the rounding factors are NOT supposed to be the same! 128 and - * 32768 are correct for the NODIV code; 127 and 32767 are correct for the - * standard method. - * - * [Optimized code by Greg Roelofs and Mark Adler...blame us for bugs. :-) ] - */ - - /* fg and bg should be in `gamma 1.0' space; alpha is the opacity */ - -# define png_composite(composite, fg, alpha, bg) \ - { png_uint_16 temp = (png_uint_16)((png_uint_16)(fg) * (png_uint_16)(alpha) \ - + (png_uint_16)(bg)*(png_uint_16)(255 - \ - (png_uint_16)(alpha)) + (png_uint_16)128); \ - (composite) = (png_byte)((temp + (temp >> 8)) >> 8); } - -# define png_composite_16(composite, fg, alpha, bg) \ - { png_uint_32 temp = (png_uint_32)((png_uint_32)(fg) * (png_uint_32)(alpha) \ - + (png_uint_32)(bg)*(png_uint_32)(65535L - \ - (png_uint_32)(alpha)) + (png_uint_32)32768L); \ - (composite) = (png_uint_16)((temp + (temp >> 16)) >> 16); } - -#else /* standard method using integer division */ - -# define png_composite(composite, fg, alpha, bg) \ - (composite) = (png_byte)(((png_uint_16)(fg) * (png_uint_16)(alpha) + \ - (png_uint_16)(bg) * (png_uint_16)(255 - (png_uint_16)(alpha)) + \ - (png_uint_16)127) / 255) - -# define png_composite_16(composite, fg, alpha, bg) \ - (composite) = (png_uint_16)(((png_uint_32)(fg) * (png_uint_32)(alpha) + \ - (png_uint_32)(bg)*(png_uint_32)(65535L - (png_uint_32)(alpha)) + \ - (png_uint_32)32767) / (png_uint_32)65535L) - -#endif /* PNG_READ_COMPOSITE_NODIV_SUPPORTED */ - -/* Inline macros to do direct reads of bytes from the input buffer. These - * require that you are using an architecture that uses PNG byte ordering - * (MSB first) and supports unaligned data storage. I think that PowerPC - * in big-endian mode and 680x0 are the only ones that will support this. - * The x86 line of processors definitely do not. The png_get_int_32() - * routine also assumes we are using two's complement format for negative - * values, which is almost certainly true. - */ -#if defined(PNG_READ_BIG_ENDIAN_SUPPORTED) -# define png_get_uint_32(buf) ( *((png_uint_32p) (buf))) -# define png_get_uint_16(buf) ( *((png_uint_16p) (buf))) -# define png_get_int_32(buf) ( *((png_int_32p) (buf))) -#else -extern PNG_EXPORT(png_uint_32,png_get_uint_32) PNGARG((png_bytep buf)); -extern PNG_EXPORT(png_uint_16,png_get_uint_16) PNGARG((png_bytep buf)); -extern PNG_EXPORT(png_int_32,png_get_int_32) PNGARG((png_bytep buf)); -#endif /* !PNG_READ_BIG_ENDIAN_SUPPORTED */ -extern PNG_EXPORT(png_uint_32,png_get_uint_31) - PNGARG((png_structp png_ptr, png_bytep buf)); -/* No png_get_int_16 -- may be added if there's a real need for it. */ - -/* Place a 32-bit number into a buffer in PNG byte order (big-endian). - */ -extern PNG_EXPORT(void,png_save_uint_32) - PNGARG((png_bytep buf, png_uint_32 i)); -extern PNG_EXPORT(void,png_save_int_32) - PNGARG((png_bytep buf, png_int_32 i)); - -/* Place a 16-bit number into a buffer in PNG byte order. - * The parameter is declared unsigned int, not png_uint_16, - * just to avoid potential problems on pre-ANSI C compilers. - */ -extern PNG_EXPORT(void,png_save_uint_16) - PNGARG((png_bytep buf, unsigned int i)); -/* No png_save_int_16 -- may be added if there's a real need for it. */ - -/* ************************************************************************* */ - -/* These next functions are used internally in the code. They generally - * shouldn't be used unless you are writing code to add or replace some - * functionality in libpng. More information about most functions can - * be found in the files where the functions are located. - */ - - -/* Various modes of operation, that are visible to applications because - * they are used for unknown chunk location. - */ -#define PNG_HAVE_IHDR 0x01 -#define PNG_HAVE_PLTE 0x02 -#define PNG_HAVE_IDAT 0x04 -#define PNG_AFTER_IDAT 0x08 /* Have complete zlib datastream */ -#define PNG_HAVE_IEND 0x10 - -#if defined(PNG_INTERNAL) - -/* More modes of operation. Note that after an init, mode is set to - * zero automatically when the structure is created. - */ -#define PNG_HAVE_gAMA 0x20 -#define PNG_HAVE_cHRM 0x40 -#define PNG_HAVE_sRGB 0x80 -#define PNG_HAVE_CHUNK_HEADER 0x100 -#define PNG_WROTE_tIME 0x200 -#define PNG_WROTE_INFO_BEFORE_PLTE 0x400 -#define PNG_BACKGROUND_IS_GRAY 0x800 -#define PNG_HAVE_PNG_SIGNATURE 0x1000 -#define PNG_HAVE_CHUNK_AFTER_IDAT 0x2000 /* Have another chunk after IDAT */ - -/* flags for the transformations the PNG library does on the image data */ -#define PNG_BGR 0x0001 -#define PNG_INTERLACE 0x0002 -#define PNG_PACK 0x0004 -#define PNG_SHIFT 0x0008 -#define PNG_SWAP_BYTES 0x0010 -#define PNG_INVERT_MONO 0x0020 -#define PNG_DITHER 0x0040 -#define PNG_BACKGROUND 0x0080 -#define PNG_BACKGROUND_EXPAND 0x0100 - /* 0x0200 unused */ -#define PNG_16_TO_8 0x0400 -#define PNG_RGBA 0x0800 -#define PNG_EXPAND 0x1000 -#define PNG_GAMMA 0x2000 -#define PNG_GRAY_TO_RGB 0x4000 -#define PNG_FILLER 0x8000L -#define PNG_PACKSWAP 0x10000L -#define PNG_SWAP_ALPHA 0x20000L -#define PNG_STRIP_ALPHA 0x40000L -#define PNG_INVERT_ALPHA 0x80000L -#define PNG_USER_TRANSFORM 0x100000L -#define PNG_RGB_TO_GRAY_ERR 0x200000L -#define PNG_RGB_TO_GRAY_WARN 0x400000L -#define PNG_RGB_TO_GRAY 0x600000L /* two bits, RGB_TO_GRAY_ERR|WARN */ - /* 0x800000L Unused */ -#define PNG_ADD_ALPHA 0x1000000L /* Added to libpng-1.2.7 */ -#define PNG_EXPAND_tRNS 0x2000000L /* Added to libpng-1.2.9 */ - /* 0x4000000L unused */ - /* 0x8000000L unused */ - /* 0x10000000L unused */ - /* 0x20000000L unused */ - /* 0x40000000L unused */ - -/* flags for png_create_struct */ -#define PNG_STRUCT_PNG 0x0001 -#define PNG_STRUCT_INFO 0x0002 - -/* Scaling factor for filter heuristic weighting calculations */ -#define PNG_WEIGHT_SHIFT 8 -#define PNG_WEIGHT_FACTOR (1<<(PNG_WEIGHT_SHIFT)) -#define PNG_COST_SHIFT 3 -#define PNG_COST_FACTOR (1<<(PNG_COST_SHIFT)) - -/* flags for the png_ptr->flags rather than declaring a byte for each one */ -#define PNG_FLAG_ZLIB_CUSTOM_STRATEGY 0x0001 -#define PNG_FLAG_ZLIB_CUSTOM_LEVEL 0x0002 -#define PNG_FLAG_ZLIB_CUSTOM_MEM_LEVEL 0x0004 -#define PNG_FLAG_ZLIB_CUSTOM_WINDOW_BITS 0x0008 -#define PNG_FLAG_ZLIB_CUSTOM_METHOD 0x0010 -#define PNG_FLAG_ZLIB_FINISHED 0x0020 -#define PNG_FLAG_ROW_INIT 0x0040 -#define PNG_FLAG_FILLER_AFTER 0x0080 -#define PNG_FLAG_CRC_ANCILLARY_USE 0x0100 -#define PNG_FLAG_CRC_ANCILLARY_NOWARN 0x0200 -#define PNG_FLAG_CRC_CRITICAL_USE 0x0400 -#define PNG_FLAG_CRC_CRITICAL_IGNORE 0x0800 -#define PNG_FLAG_FREE_PLTE 0x1000 -#define PNG_FLAG_FREE_TRNS 0x2000 -#define PNG_FLAG_FREE_HIST 0x4000 -#define PNG_FLAG_KEEP_UNKNOWN_CHUNKS 0x8000L -#define PNG_FLAG_KEEP_UNSAFE_CHUNKS 0x10000L -#define PNG_FLAG_LIBRARY_MISMATCH 0x20000L -#define PNG_FLAG_STRIP_ERROR_NUMBERS 0x40000L -#define PNG_FLAG_STRIP_ERROR_TEXT 0x80000L -#define PNG_FLAG_MALLOC_NULL_MEM_OK 0x100000L -#define PNG_FLAG_ADD_ALPHA 0x200000L /* Added to libpng-1.2.8 */ -#define PNG_FLAG_STRIP_ALPHA 0x400000L /* Added to libpng-1.2.8 */ - /* 0x800000L unused */ - /* 0x1000000L unused */ - /* 0x2000000L unused */ - /* 0x4000000L unused */ - /* 0x8000000L unused */ - /* 0x10000000L unused */ - /* 0x20000000L unused */ - /* 0x40000000L unused */ - -#define PNG_FLAG_CRC_ANCILLARY_MASK (PNG_FLAG_CRC_ANCILLARY_USE | \ - PNG_FLAG_CRC_ANCILLARY_NOWARN) - -#define PNG_FLAG_CRC_CRITICAL_MASK (PNG_FLAG_CRC_CRITICAL_USE | \ - PNG_FLAG_CRC_CRITICAL_IGNORE) - -#define PNG_FLAG_CRC_MASK (PNG_FLAG_CRC_ANCILLARY_MASK | \ - PNG_FLAG_CRC_CRITICAL_MASK) - -/* save typing and make code easier to understand */ - -#define PNG_COLOR_DIST(c1, c2) (abs((int)((c1).red) - (int)((c2).red)) + \ - abs((int)((c1).green) - (int)((c2).green)) + \ - abs((int)((c1).blue) - (int)((c2).blue))) - -/* Added to libpng-1.2.6 JB */ -#define PNG_ROWBYTES(pixel_bits, width) \ - ((pixel_bits) >= 8 ? \ - ((width) * (((png_uint_32)(pixel_bits)) >> 3)) : \ - (( ((width) * ((png_uint_32)(pixel_bits))) + 7) >> 3) ) - -/* PNG_OUT_OF_RANGE returns true if value is outside the range - ideal-delta..ideal+delta. Each argument is evaluated twice. - "ideal" and "delta" should be constants, normally simple - integers, "value" a variable. Added to libpng-1.2.6 JB */ -#define PNG_OUT_OF_RANGE(value, ideal, delta) \ - ( (value) < (ideal)-(delta) || (value) > (ideal)+(delta) ) - -/* variables declared in png.c - only it needs to define PNG_NO_EXTERN */ -#if !defined(PNG_NO_EXTERN) || defined(PNG_ALWAYS_EXTERN) -/* place to hold the signature string for a PNG file. */ -#ifdef PNG_USE_GLOBAL_ARRAYS - PNG_EXPORT_VAR (PNG_CONST png_byte FARDATA) png_sig[8]; -#else -#endif -#endif /* PNG_NO_EXTERN */ - -/* Constant strings for known chunk types. If you need to add a chunk, - * define the name here, and add an invocation of the macro in png.c and - * wherever it's needed. - */ -#define PNG_IHDR png_byte png_IHDR[5] = { 73, 72, 68, 82, '\0'} -#define PNG_IDAT png_byte png_IDAT[5] = { 73, 68, 65, 84, '\0'} -#define PNG_IEND png_byte png_IEND[5] = { 73, 69, 78, 68, '\0'} -#define PNG_PLTE png_byte png_PLTE[5] = { 80, 76, 84, 69, '\0'} -#define PNG_bKGD png_byte png_bKGD[5] = { 98, 75, 71, 68, '\0'} -#define PNG_cHRM png_byte png_cHRM[5] = { 99, 72, 82, 77, '\0'} -#define PNG_gAMA png_byte png_gAMA[5] = {103, 65, 77, 65, '\0'} -#define PNG_hIST png_byte png_hIST[5] = {104, 73, 83, 84, '\0'} -#define PNG_iCCP png_byte png_iCCP[5] = {105, 67, 67, 80, '\0'} -#define PNG_iTXt png_byte png_iTXt[5] = {105, 84, 88, 116, '\0'} -#define PNG_oFFs png_byte png_oFFs[5] = {111, 70, 70, 115, '\0'} -#define PNG_pCAL png_byte png_pCAL[5] = {112, 67, 65, 76, '\0'} -#define PNG_sCAL png_byte png_sCAL[5] = {115, 67, 65, 76, '\0'} -#define PNG_pHYs png_byte png_pHYs[5] = {112, 72, 89, 115, '\0'} -#define PNG_sBIT png_byte png_sBIT[5] = {115, 66, 73, 84, '\0'} -#define PNG_sPLT png_byte png_sPLT[5] = {115, 80, 76, 84, '\0'} -#define PNG_sRGB png_byte png_sRGB[5] = {115, 82, 71, 66, '\0'} -#define PNG_tEXt png_byte png_tEXt[5] = {116, 69, 88, 116, '\0'} -#define PNG_tIME png_byte png_tIME[5] = {116, 73, 77, 69, '\0'} -#define PNG_tRNS png_byte png_tRNS[5] = {116, 82, 78, 83, '\0'} -#define PNG_zTXt png_byte png_zTXt[5] = {122, 84, 88, 116, '\0'} - -#ifdef PNG_USE_GLOBAL_ARRAYS -PNG_EXPORT_VAR (png_byte FARDATA) png_IHDR[5]; -PNG_EXPORT_VAR (png_byte FARDATA) png_IDAT[5]; -PNG_EXPORT_VAR (png_byte FARDATA) png_IEND[5]; -PNG_EXPORT_VAR (png_byte FARDATA) png_PLTE[5]; -PNG_EXPORT_VAR (png_byte FARDATA) png_bKGD[5]; -PNG_EXPORT_VAR (png_byte FARDATA) png_cHRM[5]; -PNG_EXPORT_VAR (png_byte FARDATA) png_gAMA[5]; -PNG_EXPORT_VAR (png_byte FARDATA) png_hIST[5]; -PNG_EXPORT_VAR (png_byte FARDATA) png_iCCP[5]; -PNG_EXPORT_VAR (png_byte FARDATA) png_iTXt[5]; -PNG_EXPORT_VAR (png_byte FARDATA) png_oFFs[5]; -PNG_EXPORT_VAR (png_byte FARDATA) png_pCAL[5]; -PNG_EXPORT_VAR (png_byte FARDATA) png_sCAL[5]; -PNG_EXPORT_VAR (png_byte FARDATA) png_pHYs[5]; -PNG_EXPORT_VAR (png_byte FARDATA) png_sBIT[5]; -PNG_EXPORT_VAR (png_byte FARDATA) png_sPLT[5]; -PNG_EXPORT_VAR (png_byte FARDATA) png_sRGB[5]; -PNG_EXPORT_VAR (png_byte FARDATA) png_tEXt[5]; -PNG_EXPORT_VAR (png_byte FARDATA) png_tIME[5]; -PNG_EXPORT_VAR (png_byte FARDATA) png_tRNS[5]; -PNG_EXPORT_VAR (png_byte FARDATA) png_zTXt[5]; -#endif /* PNG_USE_GLOBAL_ARRAYS */ - -#if defined(PNG_1_0_X) || defined (PNG_1_2_X) -/* Initialize png_ptr struct for reading, and allocate any other memory. - * (old interface - DEPRECATED - use png_create_read_struct instead). - */ -extern PNG_EXPORT(void,png_read_init) PNGARG((png_structp png_ptr)); -#undef png_read_init -#define png_read_init(png_ptr) png_read_init_3(&png_ptr, \ - PNG_LIBPNG_VER_STRING, png_sizeof(png_struct)); -#endif - -extern PNG_EXPORT(void,png_read_init_3) PNGARG((png_structpp ptr_ptr, - png_const_charp user_png_ver, png_size_t png_struct_size)); -#if defined(PNG_1_0_X) || defined (PNG_1_2_X) -extern PNG_EXPORT(void,png_read_init_2) PNGARG((png_structp png_ptr, - png_const_charp user_png_ver, png_size_t png_struct_size, png_size_t - png_info_size)); -#endif - -#if defined(PNG_1_0_X) || defined (PNG_1_2_X) -/* Initialize png_ptr struct for writing, and allocate any other memory. - * (old interface - DEPRECATED - use png_create_write_struct instead). - */ -extern PNG_EXPORT(void,png_write_init) PNGARG((png_structp png_ptr)); -#undef png_write_init -#define png_write_init(png_ptr) png_write_init_3(&png_ptr, \ - PNG_LIBPNG_VER_STRING, png_sizeof(png_struct)); -#endif - -extern PNG_EXPORT(void,png_write_init_3) PNGARG((png_structpp ptr_ptr, - png_const_charp user_png_ver, png_size_t png_struct_size)); -extern PNG_EXPORT(void,png_write_init_2) PNGARG((png_structp png_ptr, - png_const_charp user_png_ver, png_size_t png_struct_size, png_size_t - png_info_size)); - -/* Allocate memory for an internal libpng struct */ -PNG_EXTERN png_voidp png_create_struct PNGARG((int type)); - -/* Free memory from internal libpng struct */ -PNG_EXTERN void png_destroy_struct PNGARG((png_voidp struct_ptr)); - -PNG_EXTERN png_voidp png_create_struct_2 PNGARG((int type, png_malloc_ptr - malloc_fn, png_voidp mem_ptr)); -PNG_EXTERN void png_destroy_struct_2 PNGARG((png_voidp struct_ptr, - png_free_ptr free_fn, png_voidp mem_ptr)); - -/* Free any memory that info_ptr points to and reset struct. */ -PNG_EXTERN void png_info_destroy PNGARG((png_structp png_ptr, - png_infop info_ptr)); - -#ifndef PNG_1_0_X -/* Function to allocate memory for zlib. */ -PNG_EXTERN voidpf png_zalloc PNGARG((voidpf png_ptr, uInt items, uInt size)); - -/* Function to free memory for zlib */ -PNG_EXTERN void png_zfree PNGARG((voidpf png_ptr, voidpf ptr)); - -#ifdef PNG_SIZE_T -/* Function to convert a sizeof an item to png_sizeof item */ - PNG_EXTERN png_size_t PNGAPI png_convert_size PNGARG((size_t size)); -#endif - -/* Next four functions are used internally as callbacks. PNGAPI is required - * but not PNG_EXPORT. PNGAPI added at libpng version 1.2.3. */ - -PNG_EXTERN void PNGAPI png_default_read_data PNGARG((png_structp png_ptr, - png_bytep data, png_size_t length)); - -#ifdef PNG_PROGRESSIVE_READ_SUPPORTED -PNG_EXTERN void PNGAPI png_push_fill_buffer PNGARG((png_structp png_ptr, - png_bytep buffer, png_size_t length)); -#endif - -PNG_EXTERN void PNGAPI png_default_write_data PNGARG((png_structp png_ptr, - png_bytep data, png_size_t length)); - -#if defined(PNG_WRITE_FLUSH_SUPPORTED) -#if !defined(PNG_NO_STDIO) -PNG_EXTERN void PNGAPI png_default_flush PNGARG((png_structp png_ptr)); -#endif -#endif -#else /* PNG_1_0_X */ -#ifdef PNG_PROGRESSIVE_READ_SUPPORTED -PNG_EXTERN void png_push_fill_buffer PNGARG((png_structp png_ptr, - png_bytep buffer, png_size_t length)); -#endif -#endif /* PNG_1_0_X */ - -/* Reset the CRC variable */ -PNG_EXTERN void png_reset_crc PNGARG((png_structp png_ptr)); - -/* Write the "data" buffer to whatever output you are using. */ -PNG_EXTERN void png_write_data PNGARG((png_structp png_ptr, png_bytep data, - png_size_t length)); - -/* Read data from whatever input you are using into the "data" buffer */ -PNG_EXTERN void png_read_data PNGARG((png_structp png_ptr, png_bytep data, - png_size_t length)); - -/* Read bytes into buf, and update png_ptr->crc */ -PNG_EXTERN void png_crc_read PNGARG((png_structp png_ptr, png_bytep buf, - png_size_t length)); - -/* Decompress data in a chunk that uses compression */ -#if defined(PNG_zTXt_SUPPORTED) || defined(PNG_iTXt_SUPPORTED) || \ - defined(PNG_iCCP_SUPPORTED) || defined(PNG_sPLT_SUPPORTED) -PNG_EXTERN png_charp png_decompress_chunk PNGARG((png_structp png_ptr, - int comp_type, png_charp chunkdata, png_size_t chunklength, - png_size_t prefix_length, png_size_t *data_length)); -#endif - -/* Read "skip" bytes, read the file crc, and (optionally) verify png_ptr->crc */ -PNG_EXTERN int png_crc_finish PNGARG((png_structp png_ptr, png_uint_32 skip)); - -/* Read the CRC from the file and compare it to the libpng calculated CRC */ -PNG_EXTERN int png_crc_error PNGARG((png_structp png_ptr)); - -/* Calculate the CRC over a section of data. Note that we are only - * passing a maximum of 64K on systems that have this as a memory limit, - * since this is the maximum buffer size we can specify. - */ -PNG_EXTERN void png_calculate_crc PNGARG((png_structp png_ptr, png_bytep ptr, - png_size_t length)); - -#if defined(PNG_WRITE_FLUSH_SUPPORTED) -PNG_EXTERN void png_flush PNGARG((png_structp png_ptr)); -#endif - -/* simple function to write the signature */ -PNG_EXTERN void png_write_sig PNGARG((png_structp png_ptr)); - -/* write various chunks */ - -/* Write the IHDR chunk, and update the png_struct with the necessary - * information. - */ -PNG_EXTERN void png_write_IHDR PNGARG((png_structp png_ptr, png_uint_32 width, - png_uint_32 height, - int bit_depth, int color_type, int compression_method, int filter_method, - int interlace_method)); - -PNG_EXTERN void png_write_PLTE PNGARG((png_structp png_ptr, png_colorp palette, - png_uint_32 num_pal)); - -PNG_EXTERN void png_write_IDAT PNGARG((png_structp png_ptr, png_bytep data, - png_size_t length)); - -PNG_EXTERN void png_write_IEND PNGARG((png_structp png_ptr)); - -#if defined(PNG_WRITE_gAMA_SUPPORTED) -#ifdef PNG_FLOATING_POINT_SUPPORTED -PNG_EXTERN void png_write_gAMA PNGARG((png_structp png_ptr, double file_gamma)); -#endif -#ifdef PNG_FIXED_POINT_SUPPORTED -PNG_EXTERN void png_write_gAMA_fixed PNGARG((png_structp png_ptr, png_fixed_point - file_gamma)); -#endif -#endif - -#if defined(PNG_WRITE_sBIT_SUPPORTED) -PNG_EXTERN void png_write_sBIT PNGARG((png_structp png_ptr, png_color_8p sbit, - int color_type)); -#endif - -#if defined(PNG_WRITE_cHRM_SUPPORTED) -#ifdef PNG_FLOATING_POINT_SUPPORTED -PNG_EXTERN void png_write_cHRM PNGARG((png_structp png_ptr, - double white_x, double white_y, - double red_x, double red_y, double green_x, double green_y, - double blue_x, double blue_y)); -#endif -#ifdef PNG_FIXED_POINT_SUPPORTED -PNG_EXTERN void png_write_cHRM_fixed PNGARG((png_structp png_ptr, - png_fixed_point int_white_x, png_fixed_point int_white_y, - png_fixed_point int_red_x, png_fixed_point int_red_y, png_fixed_point - int_green_x, png_fixed_point int_green_y, png_fixed_point int_blue_x, - png_fixed_point int_blue_y)); -#endif -#endif - -#if defined(PNG_WRITE_sRGB_SUPPORTED) -PNG_EXTERN void png_write_sRGB PNGARG((png_structp png_ptr, - int intent)); -#endif - -#if defined(PNG_WRITE_iCCP_SUPPORTED) -PNG_EXTERN void png_write_iCCP PNGARG((png_structp png_ptr, - png_charp name, int compression_type, - png_charp profile, int proflen)); - /* Note to maintainer: profile should be png_bytep */ -#endif - -#if defined(PNG_WRITE_sPLT_SUPPORTED) -PNG_EXTERN void png_write_sPLT PNGARG((png_structp png_ptr, - png_sPLT_tp palette)); -#endif - -#if defined(PNG_WRITE_tRNS_SUPPORTED) -PNG_EXTERN void png_write_tRNS PNGARG((png_structp png_ptr, png_bytep trans, - png_color_16p values, int number, int color_type)); -#endif - -#if defined(PNG_WRITE_bKGD_SUPPORTED) -PNG_EXTERN void png_write_bKGD PNGARG((png_structp png_ptr, - png_color_16p values, int color_type)); -#endif - -#if defined(PNG_WRITE_hIST_SUPPORTED) -PNG_EXTERN void png_write_hIST PNGARG((png_structp png_ptr, png_uint_16p hist, - int num_hist)); -#endif - -#if defined(PNG_WRITE_TEXT_SUPPORTED) || defined(PNG_WRITE_pCAL_SUPPORTED) || \ - defined(PNG_WRITE_iCCP_SUPPORTED) || defined(PNG_WRITE_sPLT_SUPPORTED) -PNG_EXTERN png_size_t png_check_keyword PNGARG((png_structp png_ptr, - png_charp key, png_charpp new_key)); -#endif - -#if defined(PNG_WRITE_tEXt_SUPPORTED) -PNG_EXTERN void png_write_tEXt PNGARG((png_structp png_ptr, png_charp key, - png_charp text, png_size_t text_len)); -#endif - -#if defined(PNG_WRITE_zTXt_SUPPORTED) -PNG_EXTERN void png_write_zTXt PNGARG((png_structp png_ptr, png_charp key, - png_charp text, png_size_t text_len, int compression)); -#endif - -#if defined(PNG_WRITE_iTXt_SUPPORTED) -PNG_EXTERN void png_write_iTXt PNGARG((png_structp png_ptr, - int compression, png_charp key, png_charp lang, png_charp lang_key, - png_charp text)); -#endif - -#if defined(PNG_TEXT_SUPPORTED) /* Added at version 1.0.14 and 1.2.4 */ -PNG_EXTERN int png_set_text_2 PNGARG((png_structp png_ptr, - png_infop info_ptr, png_textp text_ptr, int num_text)); -#endif - -#if defined(PNG_WRITE_oFFs_SUPPORTED) -PNG_EXTERN void png_write_oFFs PNGARG((png_structp png_ptr, - png_int_32 x_offset, png_int_32 y_offset, int unit_type)); -#endif - -#if defined(PNG_WRITE_pCAL_SUPPORTED) -PNG_EXTERN void png_write_pCAL PNGARG((png_structp png_ptr, png_charp purpose, - png_int_32 X0, png_int_32 X1, int type, int nparams, - png_charp units, png_charpp params)); -#endif - -#if defined(PNG_WRITE_pHYs_SUPPORTED) -PNG_EXTERN void png_write_pHYs PNGARG((png_structp png_ptr, - png_uint_32 x_pixels_per_unit, png_uint_32 y_pixels_per_unit, - int unit_type)); -#endif - -#if defined(PNG_WRITE_tIME_SUPPORTED) -PNG_EXTERN void png_write_tIME PNGARG((png_structp png_ptr, - png_timep mod_time)); -#endif - -#if defined(PNG_WRITE_sCAL_SUPPORTED) -#if defined(PNG_FLOATING_POINT_SUPPORTED) && !defined(PNG_NO_STDIO) -PNG_EXTERN void png_write_sCAL PNGARG((png_structp png_ptr, - int unit, double width, double height)); -#else -#ifdef PNG_FIXED_POINT_SUPPORTED -PNG_EXTERN void png_write_sCAL_s PNGARG((png_structp png_ptr, - int unit, png_charp width, png_charp height)); -#endif -#endif -#endif - -/* Called when finished processing a row of data */ -PNG_EXTERN void png_write_finish_row PNGARG((png_structp png_ptr)); - -/* Internal use only. Called before first row of data */ -PNG_EXTERN void png_write_start_row PNGARG((png_structp png_ptr)); - -#if defined(PNG_READ_GAMMA_SUPPORTED) -PNG_EXTERN void png_build_gamma_table PNGARG((png_structp png_ptr)); -#endif - -/* combine a row of data, dealing with alpha, etc. if requested */ -PNG_EXTERN void png_combine_row PNGARG((png_structp png_ptr, png_bytep row, - int mask)); - -#if defined(PNG_READ_INTERLACING_SUPPORTED) -/* expand an interlaced row */ -/* OLD pre-1.0.9 interface: -PNG_EXTERN void png_do_read_interlace PNGARG((png_row_infop row_info, - png_bytep row, int pass, png_uint_32 transformations)); - */ -PNG_EXTERN void png_do_read_interlace PNGARG((png_structp png_ptr)); -#endif - -/* GRR TO DO (2.0 or whenever): simplify other internal calling interfaces */ - -#if defined(PNG_WRITE_INTERLACING_SUPPORTED) -/* grab pixels out of a row for an interlaced pass */ -PNG_EXTERN void png_do_write_interlace PNGARG((png_row_infop row_info, - png_bytep row, int pass)); -#endif - -/* unfilter a row */ -PNG_EXTERN void png_read_filter_row PNGARG((png_structp png_ptr, - png_row_infop row_info, png_bytep row, png_bytep prev_row, int filter)); - -/* Choose the best filter to use and filter the row data */ -PNG_EXTERN void png_write_find_filter PNGARG((png_structp png_ptr, - png_row_infop row_info)); - -/* Write out the filtered row. */ -PNG_EXTERN void png_write_filtered_row PNGARG((png_structp png_ptr, - png_bytep filtered_row)); -/* finish a row while reading, dealing with interlacing passes, etc. */ -PNG_EXTERN void png_read_finish_row PNGARG((png_structp png_ptr)); - -/* initialize the row buffers, etc. */ -PNG_EXTERN void png_read_start_row PNGARG((png_structp png_ptr)); -/* optional call to update the users info structure */ -PNG_EXTERN void png_read_transform_info PNGARG((png_structp png_ptr, - png_infop info_ptr)); - -/* these are the functions that do the transformations */ -#if defined(PNG_READ_FILLER_SUPPORTED) -PNG_EXTERN void png_do_read_filler PNGARG((png_row_infop row_info, - png_bytep row, png_uint_32 filler, png_uint_32 flags)); -#endif - -#if defined(PNG_READ_SWAP_ALPHA_SUPPORTED) -PNG_EXTERN void png_do_read_swap_alpha PNGARG((png_row_infop row_info, - png_bytep row)); -#endif - -#if defined(PNG_WRITE_SWAP_ALPHA_SUPPORTED) -PNG_EXTERN void png_do_write_swap_alpha PNGARG((png_row_infop row_info, - png_bytep row)); -#endif - -#if defined(PNG_READ_INVERT_ALPHA_SUPPORTED) -PNG_EXTERN void png_do_read_invert_alpha PNGARG((png_row_infop row_info, - png_bytep row)); -#endif - -#if defined(PNG_WRITE_INVERT_ALPHA_SUPPORTED) -PNG_EXTERN void png_do_write_invert_alpha PNGARG((png_row_infop row_info, - png_bytep row)); -#endif - -#if defined(PNG_WRITE_FILLER_SUPPORTED) || \ - defined(PNG_READ_STRIP_ALPHA_SUPPORTED) -PNG_EXTERN void png_do_strip_filler PNGARG((png_row_infop row_info, - png_bytep row, png_uint_32 flags)); -#endif - -#if defined(PNG_READ_SWAP_SUPPORTED) || defined(PNG_WRITE_SWAP_SUPPORTED) -PNG_EXTERN void png_do_swap PNGARG((png_row_infop row_info, png_bytep row)); -#endif - -#if defined(PNG_READ_PACKSWAP_SUPPORTED) || defined(PNG_WRITE_PACKSWAP_SUPPORTED) -PNG_EXTERN void png_do_packswap PNGARG((png_row_infop row_info, png_bytep row)); -#endif - -#if defined(PNG_READ_RGB_TO_GRAY_SUPPORTED) -PNG_EXTERN int png_do_rgb_to_gray PNGARG((png_structp png_ptr, png_row_infop - row_info, png_bytep row)); -#endif - -#if defined(PNG_READ_GRAY_TO_RGB_SUPPORTED) -PNG_EXTERN void png_do_gray_to_rgb PNGARG((png_row_infop row_info, - png_bytep row)); -#endif - -#if defined(PNG_READ_PACK_SUPPORTED) -PNG_EXTERN void png_do_unpack PNGARG((png_row_infop row_info, png_bytep row)); -#endif - -#if defined(PNG_READ_SHIFT_SUPPORTED) -PNG_EXTERN void png_do_unshift PNGARG((png_row_infop row_info, png_bytep row, - png_color_8p sig_bits)); -#endif - -#if defined(PNG_READ_INVERT_SUPPORTED) || defined(PNG_WRITE_INVERT_SUPPORTED) -PNG_EXTERN void png_do_invert PNGARG((png_row_infop row_info, png_bytep row)); -#endif - -#if defined(PNG_READ_16_TO_8_SUPPORTED) -PNG_EXTERN void png_do_chop PNGARG((png_row_infop row_info, png_bytep row)); -#endif - -#if defined(PNG_READ_DITHER_SUPPORTED) -PNG_EXTERN void png_do_dither PNGARG((png_row_infop row_info, - png_bytep row, png_bytep palette_lookup, png_bytep dither_lookup)); - -# if defined(PNG_CORRECT_PALETTE_SUPPORTED) -PNG_EXTERN void png_correct_palette PNGARG((png_structp png_ptr, - png_colorp palette, int num_palette)); -# endif -#endif - -#if defined(PNG_READ_BGR_SUPPORTED) || defined(PNG_WRITE_BGR_SUPPORTED) -PNG_EXTERN void png_do_bgr PNGARG((png_row_infop row_info, png_bytep row)); -#endif - -#if defined(PNG_WRITE_PACK_SUPPORTED) -PNG_EXTERN void png_do_pack PNGARG((png_row_infop row_info, - png_bytep row, png_uint_32 bit_depth)); -#endif - -#if defined(PNG_WRITE_SHIFT_SUPPORTED) -PNG_EXTERN void png_do_shift PNGARG((png_row_infop row_info, png_bytep row, - png_color_8p bit_depth)); -#endif - -#if defined(PNG_READ_BACKGROUND_SUPPORTED) -#if defined(PNG_READ_GAMMA_SUPPORTED) -PNG_EXTERN void png_do_background PNGARG((png_row_infop row_info, png_bytep row, - png_color_16p trans_values, png_color_16p background, - png_color_16p background_1, - png_bytep gamma_table, png_bytep gamma_from_1, png_bytep gamma_to_1, - png_uint_16pp gamma_16, png_uint_16pp gamma_16_from_1, - png_uint_16pp gamma_16_to_1, int gamma_shift)); -#else -PNG_EXTERN void png_do_background PNGARG((png_row_infop row_info, png_bytep row, - png_color_16p trans_values, png_color_16p background)); -#endif -#endif - -#if defined(PNG_READ_GAMMA_SUPPORTED) -PNG_EXTERN void png_do_gamma PNGARG((png_row_infop row_info, png_bytep row, - png_bytep gamma_table, png_uint_16pp gamma_16_table, - int gamma_shift)); -#endif - -#if defined(PNG_READ_EXPAND_SUPPORTED) -PNG_EXTERN void png_do_expand_palette PNGARG((png_row_infop row_info, - png_bytep row, png_colorp palette, png_bytep trans, int num_trans)); -PNG_EXTERN void png_do_expand PNGARG((png_row_infop row_info, - png_bytep row, png_color_16p trans_value)); -#endif - -/* The following decodes the appropriate chunks, and does error correction, - * then calls the appropriate callback for the chunk if it is valid. - */ - -/* decode the IHDR chunk */ -PNG_EXTERN void png_handle_IHDR PNGARG((png_structp png_ptr, png_infop info_ptr, - png_uint_32 length)); -PNG_EXTERN void png_handle_PLTE PNGARG((png_structp png_ptr, png_infop info_ptr, - png_uint_32 length)); -PNG_EXTERN void png_handle_IEND PNGARG((png_structp png_ptr, png_infop info_ptr, - png_uint_32 length)); - -#if defined(PNG_READ_bKGD_SUPPORTED) -PNG_EXTERN void png_handle_bKGD PNGARG((png_structp png_ptr, png_infop info_ptr, - png_uint_32 length)); -#endif - -#if defined(PNG_READ_cHRM_SUPPORTED) -PNG_EXTERN void png_handle_cHRM PNGARG((png_structp png_ptr, png_infop info_ptr, - png_uint_32 length)); -#endif - -#if defined(PNG_READ_gAMA_SUPPORTED) -PNG_EXTERN void png_handle_gAMA PNGARG((png_structp png_ptr, png_infop info_ptr, - png_uint_32 length)); -#endif - -#if defined(PNG_READ_hIST_SUPPORTED) -PNG_EXTERN void png_handle_hIST PNGARG((png_structp png_ptr, png_infop info_ptr, - png_uint_32 length)); -#endif - -#if defined(PNG_READ_iCCP_SUPPORTED) -extern void png_handle_iCCP PNGARG((png_structp png_ptr, png_infop info_ptr, - png_uint_32 length)); -#endif /* PNG_READ_iCCP_SUPPORTED */ - -#if defined(PNG_READ_iTXt_SUPPORTED) -PNG_EXTERN void png_handle_iTXt PNGARG((png_structp png_ptr, png_infop info_ptr, - png_uint_32 length)); -#endif - -#if defined(PNG_READ_oFFs_SUPPORTED) -PNG_EXTERN void png_handle_oFFs PNGARG((png_structp png_ptr, png_infop info_ptr, - png_uint_32 length)); -#endif - -#if defined(PNG_READ_pCAL_SUPPORTED) -PNG_EXTERN void png_handle_pCAL PNGARG((png_structp png_ptr, png_infop info_ptr, - png_uint_32 length)); -#endif - -#if defined(PNG_READ_pHYs_SUPPORTED) -PNG_EXTERN void png_handle_pHYs PNGARG((png_structp png_ptr, png_infop info_ptr, - png_uint_32 length)); -#endif - -#if defined(PNG_READ_sBIT_SUPPORTED) -PNG_EXTERN void png_handle_sBIT PNGARG((png_structp png_ptr, png_infop info_ptr, - png_uint_32 length)); -#endif - -#if defined(PNG_READ_sCAL_SUPPORTED) -PNG_EXTERN void png_handle_sCAL PNGARG((png_structp png_ptr, png_infop info_ptr, - png_uint_32 length)); -#endif - -#if defined(PNG_READ_sPLT_SUPPORTED) -extern void png_handle_sPLT PNGARG((png_structp png_ptr, png_infop info_ptr, - png_uint_32 length)); -#endif /* PNG_READ_sPLT_SUPPORTED */ - -#if defined(PNG_READ_sRGB_SUPPORTED) -PNG_EXTERN void png_handle_sRGB PNGARG((png_structp png_ptr, png_infop info_ptr, - png_uint_32 length)); -#endif - -#if defined(PNG_READ_tEXt_SUPPORTED) -PNG_EXTERN void png_handle_tEXt PNGARG((png_structp png_ptr, png_infop info_ptr, - png_uint_32 length)); -#endif - -#if defined(PNG_READ_tIME_SUPPORTED) -PNG_EXTERN void png_handle_tIME PNGARG((png_structp png_ptr, png_infop info_ptr, - png_uint_32 length)); -#endif - -#if defined(PNG_READ_tRNS_SUPPORTED) -PNG_EXTERN void png_handle_tRNS PNGARG((png_structp png_ptr, png_infop info_ptr, - png_uint_32 length)); -#endif - -#if defined(PNG_READ_zTXt_SUPPORTED) -PNG_EXTERN void png_handle_zTXt PNGARG((png_structp png_ptr, png_infop info_ptr, - png_uint_32 length)); -#endif - -PNG_EXTERN void png_handle_unknown PNGARG((png_structp png_ptr, - png_infop info_ptr, png_uint_32 length)); - -PNG_EXTERN void png_check_chunk_name PNGARG((png_structp png_ptr, - png_bytep chunk_name)); - -/* handle the transformations for reading and writing */ -PNG_EXTERN void png_do_read_transformations PNGARG((png_structp png_ptr)); -PNG_EXTERN void png_do_write_transformations PNGARG((png_structp png_ptr)); - -PNG_EXTERN void png_init_read_transformations PNGARG((png_structp png_ptr)); - -#ifdef PNG_PROGRESSIVE_READ_SUPPORTED -PNG_EXTERN void png_push_read_chunk PNGARG((png_structp png_ptr, - png_infop info_ptr)); -PNG_EXTERN void png_push_read_sig PNGARG((png_structp png_ptr, - png_infop info_ptr)); -PNG_EXTERN void png_push_check_crc PNGARG((png_structp png_ptr)); -PNG_EXTERN void png_push_crc_skip PNGARG((png_structp png_ptr, - png_uint_32 length)); -PNG_EXTERN void png_push_crc_finish PNGARG((png_structp png_ptr)); -PNG_EXTERN void png_push_save_buffer PNGARG((png_structp png_ptr)); -PNG_EXTERN void png_push_restore_buffer PNGARG((png_structp png_ptr, - png_bytep buffer, png_size_t buffer_length)); -PNG_EXTERN void png_push_read_IDAT PNGARG((png_structp png_ptr)); -PNG_EXTERN void png_process_IDAT_data PNGARG((png_structp png_ptr, - png_bytep buffer, png_size_t buffer_length)); -PNG_EXTERN void png_push_process_row PNGARG((png_structp png_ptr)); -PNG_EXTERN void png_push_handle_unknown PNGARG((png_structp png_ptr, - png_infop info_ptr, png_uint_32 length)); -PNG_EXTERN void png_push_have_info PNGARG((png_structp png_ptr, - png_infop info_ptr)); -PNG_EXTERN void png_push_have_end PNGARG((png_structp png_ptr, - png_infop info_ptr)); -PNG_EXTERN void png_push_have_row PNGARG((png_structp png_ptr, png_bytep row)); -PNG_EXTERN void png_push_read_end PNGARG((png_structp png_ptr, - png_infop info_ptr)); -PNG_EXTERN void png_process_some_data PNGARG((png_structp png_ptr, - png_infop info_ptr)); -PNG_EXTERN void png_read_push_finish_row PNGARG((png_structp png_ptr)); -#if defined(PNG_READ_tEXt_SUPPORTED) -PNG_EXTERN void png_push_handle_tEXt PNGARG((png_structp png_ptr, - png_infop info_ptr, png_uint_32 length)); -PNG_EXTERN void png_push_read_tEXt PNGARG((png_structp png_ptr, - png_infop info_ptr)); -#endif -#if defined(PNG_READ_zTXt_SUPPORTED) -PNG_EXTERN void png_push_handle_zTXt PNGARG((png_structp png_ptr, - png_infop info_ptr, png_uint_32 length)); -PNG_EXTERN void png_push_read_zTXt PNGARG((png_structp png_ptr, - png_infop info_ptr)); -#endif -#if defined(PNG_READ_iTXt_SUPPORTED) -PNG_EXTERN void png_push_handle_iTXt PNGARG((png_structp png_ptr, - png_infop info_ptr, png_uint_32 length)); -PNG_EXTERN void png_push_read_iTXt PNGARG((png_structp png_ptr, - png_infop info_ptr)); -#endif - -#endif /* PNG_PROGRESSIVE_READ_SUPPORTED */ - -#ifdef PNG_MNG_FEATURES_SUPPORTED -PNG_EXTERN void png_do_read_intrapixel PNGARG((png_row_infop row_info, - png_bytep row)); -PNG_EXTERN void png_do_write_intrapixel PNGARG((png_row_infop row_info, - png_bytep row)); -#endif - -#if defined(PNG_ASSEMBLER_CODE_SUPPORTED) -#if defined(PNG_MMX_CODE_SUPPORTED) -/* png.c */ /* PRIVATE */ -PNG_EXTERN void png_init_mmx_flags PNGARG((png_structp png_ptr)); -#endif -#endif - -#if defined(PNG_INCH_CONVERSIONS) && defined(PNG_FLOATING_POINT_SUPPORTED) -PNG_EXTERN png_uint_32 png_get_pixels_per_inch PNGARG((png_structp png_ptr, -png_infop info_ptr)); - -PNG_EXTERN png_uint_32 png_get_x_pixels_per_inch PNGARG((png_structp png_ptr, -png_infop info_ptr)); - -PNG_EXTERN png_uint_32 png_get_y_pixels_per_inch PNGARG((png_structp png_ptr, -png_infop info_ptr)); - -PNG_EXTERN float png_get_x_offset_inches PNGARG((png_structp png_ptr, -png_infop info_ptr)); - -PNG_EXTERN float png_get_y_offset_inches PNGARG((png_structp png_ptr, -png_infop info_ptr)); - -#if defined(PNG_pHYs_SUPPORTED) -PNG_EXTERN png_uint_32 png_get_pHYs_dpi PNGARG((png_structp png_ptr, -png_infop info_ptr, png_uint_32 *res_x, png_uint_32 *res_y, int *unit_type)); -#endif /* PNG_pHYs_SUPPORTED */ -#endif /* PNG_INCH_CONVERSIONS && PNG_FLOATING_POINT_SUPPORTED */ - -/* Maintainer: Put new private prototypes here ^ and in libpngpf.3 */ - -#endif /* PNG_INTERNAL */ - -#ifdef __cplusplus -} -#endif - -#endif /* PNG_VERSION_INFO_ONLY */ -/* do not put anything past this line */ -#endif /* PNG_H */ diff --git a/dependencies/libpng/include/pngconf.h b/dependencies/libpng/include/pngconf.h deleted file mode 100644 index 06a182f2..00000000 --- a/dependencies/libpng/include/pngconf.h +++ /dev/null @@ -1,1481 +0,0 @@ - -/* pngconf.h - machine configurable file for libpng - * - * libpng version 1.2.29 - May 8, 2008 - * For conditions of distribution and use, see copyright notice in png.h - * Copyright (c) 1998-2008 Glenn Randers-Pehrson - * (Version 0.96 Copyright (c) 1996, 1997 Andreas Dilger) - * (Version 0.88 Copyright (c) 1995, 1996 Guy Eric Schalnat, Group 42, Inc.) - */ - -/* Any machine specific code is near the front of this file, so if you - * are configuring libpng for a machine, you may want to read the section - * starting here down to where it starts to typedef png_color, png_text, - * and png_info. - */ - -#ifndef PNGCONF_H -#define PNGCONF_H - -#define PNG_1_2_X - -/* - * PNG_USER_CONFIG has to be defined on the compiler command line. This - * includes the resource compiler for Windows DLL configurations. - */ -#ifdef PNG_USER_CONFIG -# ifndef PNG_USER_PRIVATEBUILD -# define PNG_USER_PRIVATEBUILD -# endif -#include "pngusr.h" -#endif - -/* PNG_CONFIGURE_LIBPNG is set by the "configure" script. */ -#ifdef PNG_CONFIGURE_LIBPNG -#ifdef HAVE_CONFIG_H -#include "config.h" -#endif -#endif - -/* - * Added at libpng-1.2.8 - * - * If you create a private DLL you need to define in "pngusr.h" the followings: - * #define PNG_USER_PRIVATEBUILD - * e.g. #define PNG_USER_PRIVATEBUILD "Build by MyCompany for xyz reasons." - * #define PNG_USER_DLLFNAME_POSTFIX - * e.g. // private DLL "libpng13gx.dll" - * #define PNG_USER_DLLFNAME_POSTFIX "gx" - * - * The following macros are also at your disposal if you want to complete the - * DLL VERSIONINFO structure. - * - PNG_USER_VERSIONINFO_COMMENTS - * - PNG_USER_VERSIONINFO_COMPANYNAME - * - PNG_USER_VERSIONINFO_LEGALTRADEMARKS - */ - -#ifdef __STDC__ -#ifdef SPECIALBUILD -# pragma message("PNG_LIBPNG_SPECIALBUILD (and deprecated SPECIALBUILD)\ - are now LIBPNG reserved macros. Use PNG_USER_PRIVATEBUILD instead.") -#endif - -#ifdef PRIVATEBUILD -# pragma message("PRIVATEBUILD is deprecated.\ - Use PNG_USER_PRIVATEBUILD instead.") -# define PNG_USER_PRIVATEBUILD PRIVATEBUILD -#endif -#endif /* __STDC__ */ - -#ifndef PNG_VERSION_INFO_ONLY - -/* End of material added to libpng-1.2.8 */ - -/* Added at libpng-1.2.19, removed at libpng-1.2.20 because it caused trouble - Restored at libpng-1.2.21 */ -#if !defined(PNG_NO_WARN_UNINITIALIZED_ROW) && \ - !defined(PNG_WARN_UNINITIALIZED_ROW) -# define PNG_WARN_UNINITIALIZED_ROW 1 -#endif -/* End of material added at libpng-1.2.19/1.2.21 */ - -/* This is the size of the compression buffer, and thus the size of - * an IDAT chunk. Make this whatever size you feel is best for your - * machine. One of these will be allocated per png_struct. When this - * is full, it writes the data to the disk, and does some other - * calculations. Making this an extremely small size will slow - * the library down, but you may want to experiment to determine - * where it becomes significant, if you are concerned with memory - * usage. Note that zlib allocates at least 32Kb also. For readers, - * this describes the size of the buffer available to read the data in. - * Unless this gets smaller than the size of a row (compressed), - * it should not make much difference how big this is. - */ - -#ifndef PNG_ZBUF_SIZE -# define PNG_ZBUF_SIZE 8192 -#endif - -/* Enable if you want a write-only libpng */ - -#ifndef PNG_NO_READ_SUPPORTED -# define PNG_READ_SUPPORTED -#endif - -/* Enable if you want a read-only libpng */ - -#ifndef PNG_NO_WRITE_SUPPORTED -# define PNG_WRITE_SUPPORTED -#endif - -/* Enabled by default in 1.2.0. You can disable this if you don't need to - support PNGs that are embedded in MNG datastreams */ -#if !defined(PNG_1_0_X) && !defined(PNG_NO_MNG_FEATURES) -# ifndef PNG_MNG_FEATURES_SUPPORTED -# define PNG_MNG_FEATURES_SUPPORTED -# endif -#endif - -#ifndef PNG_NO_FLOATING_POINT_SUPPORTED -# ifndef PNG_FLOATING_POINT_SUPPORTED -# define PNG_FLOATING_POINT_SUPPORTED -# endif -#endif - -/* If you are running on a machine where you cannot allocate more - * than 64K of memory at once, uncomment this. While libpng will not - * normally need that much memory in a chunk (unless you load up a very - * large file), zlib needs to know how big of a chunk it can use, and - * libpng thus makes sure to check any memory allocation to verify it - * will fit into memory. -#define PNG_MAX_MALLOC_64K - */ -#if defined(MAXSEG_64K) && !defined(PNG_MAX_MALLOC_64K) -# define PNG_MAX_MALLOC_64K -#endif - -/* Special munging to support doing things the 'cygwin' way: - * 'Normal' png-on-win32 defines/defaults: - * PNG_BUILD_DLL -- building dll - * PNG_USE_DLL -- building an application, linking to dll - * (no define) -- building static library, or building an - * application and linking to the static lib - * 'Cygwin' defines/defaults: - * PNG_BUILD_DLL -- (ignored) building the dll - * (no define) -- (ignored) building an application, linking to the dll - * PNG_STATIC -- (ignored) building the static lib, or building an - * application that links to the static lib. - * ALL_STATIC -- (ignored) building various static libs, or building an - * application that links to the static libs. - * Thus, - * a cygwin user should define either PNG_BUILD_DLL or PNG_STATIC, and - * this bit of #ifdefs will define the 'correct' config variables based on - * that. If a cygwin user *wants* to define 'PNG_USE_DLL' that's okay, but - * unnecessary. - * - * Also, the precedence order is: - * ALL_STATIC (since we can't #undef something outside our namespace) - * PNG_BUILD_DLL - * PNG_STATIC - * (nothing) == PNG_USE_DLL - * - * CYGWIN (2002-01-20): The preceding is now obsolete. With the advent - * of auto-import in binutils, we no longer need to worry about - * __declspec(dllexport) / __declspec(dllimport) and friends. Therefore, - * we don't need to worry about PNG_STATIC or ALL_STATIC when it comes - * to __declspec() stuff. However, we DO need to worry about - * PNG_BUILD_DLL and PNG_STATIC because those change some defaults - * such as CONSOLE_IO and whether GLOBAL_ARRAYS are allowed. - */ -#if defined(__CYGWIN__) -# if defined(ALL_STATIC) -# if defined(PNG_BUILD_DLL) -# undef PNG_BUILD_DLL -# endif -# if defined(PNG_USE_DLL) -# undef PNG_USE_DLL -# endif -# if defined(PNG_DLL) -# undef PNG_DLL -# endif -# if !defined(PNG_STATIC) -# define PNG_STATIC -# endif -# else -# if defined (PNG_BUILD_DLL) -# if defined(PNG_STATIC) -# undef PNG_STATIC -# endif -# if defined(PNG_USE_DLL) -# undef PNG_USE_DLL -# endif -# if !defined(PNG_DLL) -# define PNG_DLL -# endif -# else -# if defined(PNG_STATIC) -# if defined(PNG_USE_DLL) -# undef PNG_USE_DLL -# endif -# if defined(PNG_DLL) -# undef PNG_DLL -# endif -# else -# if !defined(PNG_USE_DLL) -# define PNG_USE_DLL -# endif -# if !defined(PNG_DLL) -# define PNG_DLL -# endif -# endif -# endif -# endif -#endif - -/* This protects us against compilers that run on a windowing system - * and thus don't have or would rather us not use the stdio types: - * stdin, stdout, and stderr. The only one currently used is stderr - * in png_error() and png_warning(). #defining PNG_NO_CONSOLE_IO will - * prevent these from being compiled and used. #defining PNG_NO_STDIO - * will also prevent these, plus will prevent the entire set of stdio - * macros and functions (FILE *, printf, etc.) from being compiled and used, - * unless (PNG_DEBUG > 0) has been #defined. - * - * #define PNG_NO_CONSOLE_IO - * #define PNG_NO_STDIO - */ - -#if defined(_WIN32_WCE) -# include - /* Console I/O functions are not supported on WindowsCE */ -# define PNG_NO_CONSOLE_IO -# ifdef PNG_DEBUG -# undef PNG_DEBUG -# endif -#endif - -#ifdef PNG_BUILD_DLL -# ifndef PNG_CONSOLE_IO_SUPPORTED -# ifndef PNG_NO_CONSOLE_IO -# define PNG_NO_CONSOLE_IO -# endif -# endif -#endif - -# ifdef PNG_NO_STDIO -# ifndef PNG_NO_CONSOLE_IO -# define PNG_NO_CONSOLE_IO -# endif -# ifdef PNG_DEBUG -# if (PNG_DEBUG > 0) -# include -# endif -# endif -# else -# if !defined(_WIN32_WCE) -/* "stdio.h" functions are not supported on WindowsCE */ -# include -# endif -# endif - -/* This macro protects us against machines that don't have function - * prototypes (ie K&R style headers). If your compiler does not handle - * function prototypes, define this macro and use the included ansi2knr. - * I've always been able to use _NO_PROTO as the indicator, but you may - * need to drag the empty declaration out in front of here, or change the - * ifdef to suit your own needs. - */ -#ifndef PNGARG - -#ifdef OF /* zlib prototype munger */ -# define PNGARG(arglist) OF(arglist) -#else - -#ifdef _NO_PROTO -# define PNGARG(arglist) () -# ifndef PNG_TYPECAST_NULL -# define PNG_TYPECAST_NULL -# endif -#else -# define PNGARG(arglist) arglist -#endif /* _NO_PROTO */ - - -#endif /* OF */ - -#endif /* PNGARG */ - -/* Try to determine if we are compiling on a Mac. Note that testing for - * just __MWERKS__ is not good enough, because the Codewarrior is now used - * on non-Mac platforms. - */ -#ifndef MACOS -# if (defined(__MWERKS__) && defined(macintosh)) || defined(applec) || \ - defined(THINK_C) || defined(__SC__) || defined(TARGET_OS_MAC) -# define MACOS -# endif -#endif - -/* enough people need this for various reasons to include it here */ -#if !defined(MACOS) && !defined(RISCOS) && !defined(_WIN32_WCE) -# include -#endif - -#if !defined(PNG_SETJMP_NOT_SUPPORTED) && !defined(PNG_NO_SETJMP_SUPPORTED) -# define PNG_SETJMP_SUPPORTED -#endif - -#ifdef PNG_SETJMP_SUPPORTED -/* This is an attempt to force a single setjmp behaviour on Linux. If - * the X config stuff didn't define _BSD_SOURCE we wouldn't need this. - */ - -# ifdef __linux__ -# ifdef _BSD_SOURCE -# define PNG_SAVE_BSD_SOURCE -# undef _BSD_SOURCE -# endif -# ifdef _SETJMP_H - /* If you encounter a compiler error here, see the explanation - * near the end of INSTALL. - */ - __pngconf.h__ already includes setjmp.h; - __dont__ include it again.; -# endif -# endif /* __linux__ */ - - /* include setjmp.h for error handling */ -# include - -# ifdef __linux__ -# ifdef PNG_SAVE_BSD_SOURCE -# ifndef _BSD_SOURCE -# define _BSD_SOURCE -# endif -# undef PNG_SAVE_BSD_SOURCE -# endif -# endif /* __linux__ */ -#endif /* PNG_SETJMP_SUPPORTED */ - -#ifdef BSD -# include -#else -# include -#endif - -/* Other defines for things like memory and the like can go here. */ -#ifdef PNG_INTERNAL - -#include - -/* The functions exported by PNG_EXTERN are PNG_INTERNAL functions, which - * aren't usually used outside the library (as far as I know), so it is - * debatable if they should be exported at all. In the future, when it is - * possible to have run-time registry of chunk-handling functions, some of - * these will be made available again. -#define PNG_EXTERN extern - */ -#define PNG_EXTERN - -/* Other defines specific to compilers can go here. Try to keep - * them inside an appropriate ifdef/endif pair for portability. - */ - -#if defined(PNG_FLOATING_POINT_SUPPORTED) -# if defined(MACOS) - /* We need to check that hasn't already been included earlier - * as it seems it doesn't agree with , yet we should really use - * if possible. - */ -# if !defined(__MATH_H__) && !defined(__MATH_H) && !defined(__cmath__) -# include -# endif -# else -# include -# endif -# if defined(_AMIGA) && defined(__SASC) && defined(_M68881) - /* Amiga SAS/C: We must include builtin FPU functions when compiling using - * MATH=68881 - */ -# include -# endif -#endif - -/* Codewarrior on NT has linking problems without this. */ -#if (defined(__MWERKS__) && defined(WIN32)) || defined(__STDC__) -# define PNG_ALWAYS_EXTERN -#endif - -/* This provides the non-ANSI (far) memory allocation routines. */ -#if defined(__TURBOC__) && defined(__MSDOS__) -# include -# include -#endif - -/* I have no idea why is this necessary... */ -#if defined(_MSC_VER) && (defined(WIN32) || defined(_Windows) || \ - defined(_WINDOWS) || defined(_WIN32) || defined(__WIN32__)) -# include -#endif - -/* This controls how fine the dithering gets. As this allocates - * a largish chunk of memory (32K), those who are not as concerned - * with dithering quality can decrease some or all of these. - */ -#ifndef PNG_DITHER_RED_BITS -# define PNG_DITHER_RED_BITS 5 -#endif -#ifndef PNG_DITHER_GREEN_BITS -# define PNG_DITHER_GREEN_BITS 5 -#endif -#ifndef PNG_DITHER_BLUE_BITS -# define PNG_DITHER_BLUE_BITS 5 -#endif - -/* This controls how fine the gamma correction becomes when you - * are only interested in 8 bits anyway. Increasing this value - * results in more memory being used, and more pow() functions - * being called to fill in the gamma tables. Don't set this value - * less then 8, and even that may not work (I haven't tested it). - */ - -#ifndef PNG_MAX_GAMMA_8 -# define PNG_MAX_GAMMA_8 11 -#endif - -/* This controls how much a difference in gamma we can tolerate before - * we actually start doing gamma conversion. - */ -#ifndef PNG_GAMMA_THRESHOLD -# define PNG_GAMMA_THRESHOLD 0.05 -#endif - -#endif /* PNG_INTERNAL */ - -/* The following uses const char * instead of char * for error - * and warning message functions, so some compilers won't complain. - * If you do not want to use const, define PNG_NO_CONST here. - */ - -#ifndef PNG_NO_CONST -# define PNG_CONST const -#else -# define PNG_CONST -#endif - -/* The following defines give you the ability to remove code from the - * library that you will not be using. I wish I could figure out how to - * automate this, but I can't do that without making it seriously hard - * on the users. So if you are not using an ability, change the #define - * to and #undef, and that part of the library will not be compiled. If - * your linker can't find a function, you may want to make sure the - * ability is defined here. Some of these depend upon some others being - * defined. I haven't figured out all the interactions here, so you may - * have to experiment awhile to get everything to compile. If you are - * creating or using a shared library, you probably shouldn't touch this, - * as it will affect the size of the structures, and this will cause bad - * things to happen if the library and/or application ever change. - */ - -/* Any features you will not be using can be undef'ed here */ - -/* GR-P, 0.96a: Set "*TRANSFORMS_SUPPORTED as default but allow user - * to turn it off with "*TRANSFORMS_NOT_SUPPORTED" or *PNG_NO_*_TRANSFORMS - * on the compile line, then pick and choose which ones to define without - * having to edit this file. It is safe to use the *TRANSFORMS_NOT_SUPPORTED - * if you only want to have a png-compliant reader/writer but don't need - * any of the extra transformations. This saves about 80 kbytes in a - * typical installation of the library. (PNG_NO_* form added in version - * 1.0.1c, for consistency) - */ - -/* The size of the png_text structure changed in libpng-1.0.6 when - * iTXt support was added. iTXt support was turned off by default through - * libpng-1.2.x, to support old apps that malloc the png_text structure - * instead of calling png_set_text() and letting libpng malloc it. It - * was turned on by default in libpng-1.3.0. - */ - -#if defined(PNG_1_0_X) || defined (PNG_1_2_X) -# ifndef PNG_NO_iTXt_SUPPORTED -# define PNG_NO_iTXt_SUPPORTED -# endif -# ifndef PNG_NO_READ_iTXt -# define PNG_NO_READ_iTXt -# endif -# ifndef PNG_NO_WRITE_iTXt -# define PNG_NO_WRITE_iTXt -# endif -#endif - -#if !defined(PNG_NO_iTXt_SUPPORTED) -# if !defined(PNG_READ_iTXt_SUPPORTED) && !defined(PNG_NO_READ_iTXt) -# define PNG_READ_iTXt -# endif -# if !defined(PNG_WRITE_iTXt_SUPPORTED) && !defined(PNG_NO_WRITE_iTXt) -# define PNG_WRITE_iTXt -# endif -#endif - -/* The following support, added after version 1.0.0, can be turned off here en - * masse by defining PNG_LEGACY_SUPPORTED in case you need binary compatibility - * with old applications that require the length of png_struct and png_info - * to remain unchanged. - */ - -#ifdef PNG_LEGACY_SUPPORTED -# define PNG_NO_FREE_ME -# define PNG_NO_READ_UNKNOWN_CHUNKS -# define PNG_NO_WRITE_UNKNOWN_CHUNKS -# define PNG_NO_READ_USER_CHUNKS -# define PNG_NO_READ_iCCP -# define PNG_NO_WRITE_iCCP -# define PNG_NO_READ_iTXt -# define PNG_NO_WRITE_iTXt -# define PNG_NO_READ_sCAL -# define PNG_NO_WRITE_sCAL -# define PNG_NO_READ_sPLT -# define PNG_NO_WRITE_sPLT -# define PNG_NO_INFO_IMAGE -# define PNG_NO_READ_RGB_TO_GRAY -# define PNG_NO_READ_USER_TRANSFORM -# define PNG_NO_WRITE_USER_TRANSFORM -# define PNG_NO_USER_MEM -# define PNG_NO_READ_EMPTY_PLTE -# define PNG_NO_MNG_FEATURES -# define PNG_NO_FIXED_POINT_SUPPORTED -#endif - -/* Ignore attempt to turn off both floating and fixed point support */ -#if !defined(PNG_FLOATING_POINT_SUPPORTED) || \ - !defined(PNG_NO_FIXED_POINT_SUPPORTED) -# define PNG_FIXED_POINT_SUPPORTED -#endif - -#ifndef PNG_NO_FREE_ME -# define PNG_FREE_ME_SUPPORTED -#endif - -#if defined(PNG_READ_SUPPORTED) - -#if !defined(PNG_READ_TRANSFORMS_NOT_SUPPORTED) && \ - !defined(PNG_NO_READ_TRANSFORMS) -# define PNG_READ_TRANSFORMS_SUPPORTED -#endif - -#ifdef PNG_READ_TRANSFORMS_SUPPORTED -# ifndef PNG_NO_READ_EXPAND -# define PNG_READ_EXPAND_SUPPORTED -# endif -# ifndef PNG_NO_READ_SHIFT -# define PNG_READ_SHIFT_SUPPORTED -# endif -# ifndef PNG_NO_READ_PACK -# define PNG_READ_PACK_SUPPORTED -# endif -# ifndef PNG_NO_READ_BGR -# define PNG_READ_BGR_SUPPORTED -# endif -# ifndef PNG_NO_READ_SWAP -# define PNG_READ_SWAP_SUPPORTED -# endif -# ifndef PNG_NO_READ_PACKSWAP -# define PNG_READ_PACKSWAP_SUPPORTED -# endif -# ifndef PNG_NO_READ_INVERT -# define PNG_READ_INVERT_SUPPORTED -# endif -# ifndef PNG_NO_READ_DITHER -# define PNG_READ_DITHER_SUPPORTED -# endif -# ifndef PNG_NO_READ_BACKGROUND -# define PNG_READ_BACKGROUND_SUPPORTED -# endif -# ifndef PNG_NO_READ_16_TO_8 -# define PNG_READ_16_TO_8_SUPPORTED -# endif -# ifndef PNG_NO_READ_FILLER -# define PNG_READ_FILLER_SUPPORTED -# endif -# ifndef PNG_NO_READ_GAMMA -# define PNG_READ_GAMMA_SUPPORTED -# endif -# ifndef PNG_NO_READ_GRAY_TO_RGB -# define PNG_READ_GRAY_TO_RGB_SUPPORTED -# endif -# ifndef PNG_NO_READ_SWAP_ALPHA -# define PNG_READ_SWAP_ALPHA_SUPPORTED -# endif -# ifndef PNG_NO_READ_INVERT_ALPHA -# define PNG_READ_INVERT_ALPHA_SUPPORTED -# endif -# ifndef PNG_NO_READ_STRIP_ALPHA -# define PNG_READ_STRIP_ALPHA_SUPPORTED -# endif -# ifndef PNG_NO_READ_USER_TRANSFORM -# define PNG_READ_USER_TRANSFORM_SUPPORTED -# endif -# ifndef PNG_NO_READ_RGB_TO_GRAY -# define PNG_READ_RGB_TO_GRAY_SUPPORTED -# endif -#endif /* PNG_READ_TRANSFORMS_SUPPORTED */ - -#if !defined(PNG_NO_PROGRESSIVE_READ) && \ - !defined(PNG_PROGRESSIVE_READ_SUPPORTED) /* if you don't do progressive */ -# define PNG_PROGRESSIVE_READ_SUPPORTED /* reading. This is not talking */ -#endif /* about interlacing capability! You'll */ - /* still have interlacing unless you change the following line: */ - -#define PNG_READ_INTERLACING_SUPPORTED /* required in PNG-compliant decoders */ - -#ifndef PNG_NO_READ_COMPOSITE_NODIV -# ifndef PNG_NO_READ_COMPOSITED_NODIV /* libpng-1.0.x misspelling */ -# define PNG_READ_COMPOSITE_NODIV_SUPPORTED /* well tested on Intel, SGI */ -# endif -#endif - -#if defined(PNG_1_0_X) || defined (PNG_1_2_X) -/* Deprecated, will be removed from version 2.0.0. - Use PNG_MNG_FEATURES_SUPPORTED instead. */ -#ifndef PNG_NO_READ_EMPTY_PLTE -# define PNG_READ_EMPTY_PLTE_SUPPORTED -#endif -#endif - -#endif /* PNG_READ_SUPPORTED */ - -#if defined(PNG_WRITE_SUPPORTED) - -# if !defined(PNG_WRITE_TRANSFORMS_NOT_SUPPORTED) && \ - !defined(PNG_NO_WRITE_TRANSFORMS) -# define PNG_WRITE_TRANSFORMS_SUPPORTED -#endif - -#ifdef PNG_WRITE_TRANSFORMS_SUPPORTED -# ifndef PNG_NO_WRITE_SHIFT -# define PNG_WRITE_SHIFT_SUPPORTED -# endif -# ifndef PNG_NO_WRITE_PACK -# define PNG_WRITE_PACK_SUPPORTED -# endif -# ifndef PNG_NO_WRITE_BGR -# define PNG_WRITE_BGR_SUPPORTED -# endif -# ifndef PNG_NO_WRITE_SWAP -# define PNG_WRITE_SWAP_SUPPORTED -# endif -# ifndef PNG_NO_WRITE_PACKSWAP -# define PNG_WRITE_PACKSWAP_SUPPORTED -# endif -# ifndef PNG_NO_WRITE_INVERT -# define PNG_WRITE_INVERT_SUPPORTED -# endif -# ifndef PNG_NO_WRITE_FILLER -# define PNG_WRITE_FILLER_SUPPORTED /* same as WRITE_STRIP_ALPHA */ -# endif -# ifndef PNG_NO_WRITE_SWAP_ALPHA -# define PNG_WRITE_SWAP_ALPHA_SUPPORTED -# endif -# ifndef PNG_NO_WRITE_INVERT_ALPHA -# define PNG_WRITE_INVERT_ALPHA_SUPPORTED -# endif -# ifndef PNG_NO_WRITE_USER_TRANSFORM -# define PNG_WRITE_USER_TRANSFORM_SUPPORTED -# endif -#endif /* PNG_WRITE_TRANSFORMS_SUPPORTED */ - -#if !defined(PNG_NO_WRITE_INTERLACING_SUPPORTED) && \ - !defined(PNG_WRITE_INTERLACING_SUPPORTED) -#define PNG_WRITE_INTERLACING_SUPPORTED /* not required for PNG-compliant - encoders, but can cause trouble - if left undefined */ -#endif - -#if !defined(PNG_NO_WRITE_WEIGHTED_FILTER) && \ - !defined(PNG_WRITE_WEIGHTED_FILTER) && \ - defined(PNG_FLOATING_POINT_SUPPORTED) -# define PNG_WRITE_WEIGHTED_FILTER_SUPPORTED -#endif - -#ifndef PNG_NO_WRITE_FLUSH -# define PNG_WRITE_FLUSH_SUPPORTED -#endif - -#if defined(PNG_1_0_X) || defined (PNG_1_2_X) -/* Deprecated, see PNG_MNG_FEATURES_SUPPORTED, above */ -#ifndef PNG_NO_WRITE_EMPTY_PLTE -# define PNG_WRITE_EMPTY_PLTE_SUPPORTED -#endif -#endif - -#endif /* PNG_WRITE_SUPPORTED */ - -#ifndef PNG_1_0_X -# ifndef PNG_NO_ERROR_NUMBERS -# define PNG_ERROR_NUMBERS_SUPPORTED -# endif -#endif /* PNG_1_0_X */ - -#if defined(PNG_READ_USER_TRANSFORM_SUPPORTED) || \ - defined(PNG_WRITE_USER_TRANSFORM_SUPPORTED) -# ifndef PNG_NO_USER_TRANSFORM_PTR -# define PNG_USER_TRANSFORM_PTR_SUPPORTED -# endif -#endif - -#ifndef PNG_NO_STDIO -# define PNG_TIME_RFC1123_SUPPORTED -#endif - -/* This adds extra functions in pngget.c for accessing data from the - * info pointer (added in version 0.99) - * png_get_image_width() - * png_get_image_height() - * png_get_bit_depth() - * png_get_color_type() - * png_get_compression_type() - * png_get_filter_type() - * png_get_interlace_type() - * png_get_pixel_aspect_ratio() - * png_get_pixels_per_meter() - * png_get_x_offset_pixels() - * png_get_y_offset_pixels() - * png_get_x_offset_microns() - * png_get_y_offset_microns() - */ -#if !defined(PNG_NO_EASY_ACCESS) && !defined(PNG_EASY_ACCESS_SUPPORTED) -# define PNG_EASY_ACCESS_SUPPORTED -#endif - -/* PNG_ASSEMBLER_CODE was enabled by default in version 1.2.0 - * and removed from version 1.2.20. The following will be removed - * from libpng-1.4.0 -*/ - -#if defined(PNG_READ_SUPPORTED) && !defined(PNG_NO_OPTIMIZED_CODE) -# ifndef PNG_OPTIMIZED_CODE_SUPPORTED -# define PNG_OPTIMIZED_CODE_SUPPORTED -# endif -#endif - -#if defined(PNG_READ_SUPPORTED) && !defined(PNG_NO_ASSEMBLER_CODE) -# ifndef PNG_ASSEMBLER_CODE_SUPPORTED -# define PNG_ASSEMBLER_CODE_SUPPORTED -# endif - -# if defined(__GNUC__) && defined(__x86_64__) && (__GNUC__ < 4) - /* work around 64-bit gcc compiler bugs in gcc-3.x */ -# if !defined(PNG_MMX_CODE_SUPPORTED) && !defined(PNG_NO_MMX_CODE) -# define PNG_NO_MMX_CODE -# endif -# endif - -# if defined(__APPLE__) -# if !defined(PNG_MMX_CODE_SUPPORTED) && !defined(PNG_NO_MMX_CODE) -# define PNG_NO_MMX_CODE -# endif -# endif - -# if (defined(__MWERKS__) && ((__MWERKS__ < 0x0900) || macintosh)) -# if !defined(PNG_MMX_CODE_SUPPORTED) && !defined(PNG_NO_MMX_CODE) -# define PNG_NO_MMX_CODE -# endif -# endif - -# if !defined(PNG_MMX_CODE_SUPPORTED) && !defined(PNG_NO_MMX_CODE) -# define PNG_MMX_CODE_SUPPORTED -# endif - -#endif -/* end of obsolete code to be removed from libpng-1.4.0 */ - -#if !defined(PNG_1_0_X) -#if !defined(PNG_NO_USER_MEM) && !defined(PNG_USER_MEM_SUPPORTED) -# define PNG_USER_MEM_SUPPORTED -#endif -#endif /* PNG_1_0_X */ - -/* Added at libpng-1.2.6 */ -#if !defined(PNG_1_0_X) -#ifndef PNG_SET_USER_LIMITS_SUPPORTED -#if !defined(PNG_NO_SET_USER_LIMITS) && !defined(PNG_SET_USER_LIMITS_SUPPORTED) -# define PNG_SET_USER_LIMITS_SUPPORTED -#endif -#endif -#endif /* PNG_1_0_X */ - -/* Added at libpng-1.0.16 and 1.2.6. To accept all valid PNGS no matter - * how large, set these limits to 0x7fffffffL - */ -#ifndef PNG_USER_WIDTH_MAX -# define PNG_USER_WIDTH_MAX 1000000L -#endif -#ifndef PNG_USER_HEIGHT_MAX -# define PNG_USER_HEIGHT_MAX 1000000L -#endif - -/* These are currently experimental features, define them if you want */ - -/* very little testing */ -/* -#ifdef PNG_READ_SUPPORTED -# ifndef PNG_READ_16_TO_8_ACCURATE_SCALE_SUPPORTED -# define PNG_READ_16_TO_8_ACCURATE_SCALE_SUPPORTED -# endif -#endif -*/ - -/* This is only for PowerPC big-endian and 680x0 systems */ -/* some testing */ -/* -#ifndef PNG_READ_BIG_ENDIAN_SUPPORTED -# define PNG_READ_BIG_ENDIAN_SUPPORTED -#endif -*/ - -/* Buggy compilers (e.g., gcc 2.7.2.2) need this */ -/* -#define PNG_NO_POINTER_INDEXING -*/ - -/* These functions are turned off by default, as they will be phased out. */ -/* -#define PNG_USELESS_TESTS_SUPPORTED -#define PNG_CORRECT_PALETTE_SUPPORTED -*/ - -/* Any chunks you are not interested in, you can undef here. The - * ones that allocate memory may be expecially important (hIST, - * tEXt, zTXt, tRNS, pCAL). Others will just save time and make png_info - * a bit smaller. - */ - -#if defined(PNG_READ_SUPPORTED) && \ - !defined(PNG_READ_ANCILLARY_CHUNKS_NOT_SUPPORTED) && \ - !defined(PNG_NO_READ_ANCILLARY_CHUNKS) -# define PNG_READ_ANCILLARY_CHUNKS_SUPPORTED -#endif - -#if defined(PNG_WRITE_SUPPORTED) && \ - !defined(PNG_WRITE_ANCILLARY_CHUNKS_NOT_SUPPORTED) && \ - !defined(PNG_NO_WRITE_ANCILLARY_CHUNKS) -# define PNG_WRITE_ANCILLARY_CHUNKS_SUPPORTED -#endif - -#ifdef PNG_READ_ANCILLARY_CHUNKS_SUPPORTED - -#ifdef PNG_NO_READ_TEXT -# define PNG_NO_READ_iTXt -# define PNG_NO_READ_tEXt -# define PNG_NO_READ_zTXt -#endif -#ifndef PNG_NO_READ_bKGD -# define PNG_READ_bKGD_SUPPORTED -# define PNG_bKGD_SUPPORTED -#endif -#ifndef PNG_NO_READ_cHRM -# define PNG_READ_cHRM_SUPPORTED -# define PNG_cHRM_SUPPORTED -#endif -#ifndef PNG_NO_READ_gAMA -# define PNG_READ_gAMA_SUPPORTED -# define PNG_gAMA_SUPPORTED -#endif -#ifndef PNG_NO_READ_hIST -# define PNG_READ_hIST_SUPPORTED -# define PNG_hIST_SUPPORTED -#endif -#ifndef PNG_NO_READ_iCCP -# define PNG_READ_iCCP_SUPPORTED -# define PNG_iCCP_SUPPORTED -#endif -#ifndef PNG_NO_READ_iTXt -# ifndef PNG_READ_iTXt_SUPPORTED -# define PNG_READ_iTXt_SUPPORTED -# endif -# ifndef PNG_iTXt_SUPPORTED -# define PNG_iTXt_SUPPORTED -# endif -#endif -#ifndef PNG_NO_READ_oFFs -# define PNG_READ_oFFs_SUPPORTED -# define PNG_oFFs_SUPPORTED -#endif -#ifndef PNG_NO_READ_pCAL -# define PNG_READ_pCAL_SUPPORTED -# define PNG_pCAL_SUPPORTED -#endif -#ifndef PNG_NO_READ_sCAL -# define PNG_READ_sCAL_SUPPORTED -# define PNG_sCAL_SUPPORTED -#endif -#ifndef PNG_NO_READ_pHYs -# define PNG_READ_pHYs_SUPPORTED -# define PNG_pHYs_SUPPORTED -#endif -#ifndef PNG_NO_READ_sBIT -# define PNG_READ_sBIT_SUPPORTED -# define PNG_sBIT_SUPPORTED -#endif -#ifndef PNG_NO_READ_sPLT -# define PNG_READ_sPLT_SUPPORTED -# define PNG_sPLT_SUPPORTED -#endif -#ifndef PNG_NO_READ_sRGB -# define PNG_READ_sRGB_SUPPORTED -# define PNG_sRGB_SUPPORTED -#endif -#ifndef PNG_NO_READ_tEXt -# define PNG_READ_tEXt_SUPPORTED -# define PNG_tEXt_SUPPORTED -#endif -#ifndef PNG_NO_READ_tIME -# define PNG_READ_tIME_SUPPORTED -# define PNG_tIME_SUPPORTED -#endif -#ifndef PNG_NO_READ_tRNS -# define PNG_READ_tRNS_SUPPORTED -# define PNG_tRNS_SUPPORTED -#endif -#ifndef PNG_NO_READ_zTXt -# define PNG_READ_zTXt_SUPPORTED -# define PNG_zTXt_SUPPORTED -#endif -#ifndef PNG_NO_READ_UNKNOWN_CHUNKS -# define PNG_READ_UNKNOWN_CHUNKS_SUPPORTED -# ifndef PNG_UNKNOWN_CHUNKS_SUPPORTED -# define PNG_UNKNOWN_CHUNKS_SUPPORTED -# endif -# ifndef PNG_NO_HANDLE_AS_UNKNOWN -# define PNG_HANDLE_AS_UNKNOWN_SUPPORTED -# endif -#endif -#if !defined(PNG_NO_READ_USER_CHUNKS) && \ - defined(PNG_READ_UNKNOWN_CHUNKS_SUPPORTED) -# define PNG_READ_USER_CHUNKS_SUPPORTED -# define PNG_USER_CHUNKS_SUPPORTED -# ifdef PNG_NO_READ_UNKNOWN_CHUNKS -# undef PNG_NO_READ_UNKNOWN_CHUNKS -# endif -# ifdef PNG_NO_HANDLE_AS_UNKNOWN -# undef PNG_NO_HANDLE_AS_UNKNOWN -# endif -#endif -#ifndef PNG_NO_READ_OPT_PLTE -# define PNG_READ_OPT_PLTE_SUPPORTED /* only affects support of the */ -#endif /* optional PLTE chunk in RGB and RGBA images */ -#if defined(PNG_READ_iTXt_SUPPORTED) || defined(PNG_READ_tEXt_SUPPORTED) || \ - defined(PNG_READ_zTXt_SUPPORTED) -# define PNG_READ_TEXT_SUPPORTED -# define PNG_TEXT_SUPPORTED -#endif - -#endif /* PNG_READ_ANCILLARY_CHUNKS_SUPPORTED */ - -#ifdef PNG_WRITE_ANCILLARY_CHUNKS_SUPPORTED - -#ifdef PNG_NO_WRITE_TEXT -# define PNG_NO_WRITE_iTXt -# define PNG_NO_WRITE_tEXt -# define PNG_NO_WRITE_zTXt -#endif -#ifndef PNG_NO_WRITE_bKGD -# define PNG_WRITE_bKGD_SUPPORTED -# ifndef PNG_bKGD_SUPPORTED -# define PNG_bKGD_SUPPORTED -# endif -#endif -#ifndef PNG_NO_WRITE_cHRM -# define PNG_WRITE_cHRM_SUPPORTED -# ifndef PNG_cHRM_SUPPORTED -# define PNG_cHRM_SUPPORTED -# endif -#endif -#ifndef PNG_NO_WRITE_gAMA -# define PNG_WRITE_gAMA_SUPPORTED -# ifndef PNG_gAMA_SUPPORTED -# define PNG_gAMA_SUPPORTED -# endif -#endif -#ifndef PNG_NO_WRITE_hIST -# define PNG_WRITE_hIST_SUPPORTED -# ifndef PNG_hIST_SUPPORTED -# define PNG_hIST_SUPPORTED -# endif -#endif -#ifndef PNG_NO_WRITE_iCCP -# define PNG_WRITE_iCCP_SUPPORTED -# ifndef PNG_iCCP_SUPPORTED -# define PNG_iCCP_SUPPORTED -# endif -#endif -#ifndef PNG_NO_WRITE_iTXt -# ifndef PNG_WRITE_iTXt_SUPPORTED -# define PNG_WRITE_iTXt_SUPPORTED -# endif -# ifndef PNG_iTXt_SUPPORTED -# define PNG_iTXt_SUPPORTED -# endif -#endif -#ifndef PNG_NO_WRITE_oFFs -# define PNG_WRITE_oFFs_SUPPORTED -# ifndef PNG_oFFs_SUPPORTED -# define PNG_oFFs_SUPPORTED -# endif -#endif -#ifndef PNG_NO_WRITE_pCAL -# define PNG_WRITE_pCAL_SUPPORTED -# ifndef PNG_pCAL_SUPPORTED -# define PNG_pCAL_SUPPORTED -# endif -#endif -#ifndef PNG_NO_WRITE_sCAL -# define PNG_WRITE_sCAL_SUPPORTED -# ifndef PNG_sCAL_SUPPORTED -# define PNG_sCAL_SUPPORTED -# endif -#endif -#ifndef PNG_NO_WRITE_pHYs -# define PNG_WRITE_pHYs_SUPPORTED -# ifndef PNG_pHYs_SUPPORTED -# define PNG_pHYs_SUPPORTED -# endif -#endif -#ifndef PNG_NO_WRITE_sBIT -# define PNG_WRITE_sBIT_SUPPORTED -# ifndef PNG_sBIT_SUPPORTED -# define PNG_sBIT_SUPPORTED -# endif -#endif -#ifndef PNG_NO_WRITE_sPLT -# define PNG_WRITE_sPLT_SUPPORTED -# ifndef PNG_sPLT_SUPPORTED -# define PNG_sPLT_SUPPORTED -# endif -#endif -#ifndef PNG_NO_WRITE_sRGB -# define PNG_WRITE_sRGB_SUPPORTED -# ifndef PNG_sRGB_SUPPORTED -# define PNG_sRGB_SUPPORTED -# endif -#endif -#ifndef PNG_NO_WRITE_tEXt -# define PNG_WRITE_tEXt_SUPPORTED -# ifndef PNG_tEXt_SUPPORTED -# define PNG_tEXt_SUPPORTED -# endif -#endif -#ifndef PNG_NO_WRITE_tIME -# define PNG_WRITE_tIME_SUPPORTED -# ifndef PNG_tIME_SUPPORTED -# define PNG_tIME_SUPPORTED -# endif -#endif -#ifndef PNG_NO_WRITE_tRNS -# define PNG_WRITE_tRNS_SUPPORTED -# ifndef PNG_tRNS_SUPPORTED -# define PNG_tRNS_SUPPORTED -# endif -#endif -#ifndef PNG_NO_WRITE_zTXt -# define PNG_WRITE_zTXt_SUPPORTED -# ifndef PNG_zTXt_SUPPORTED -# define PNG_zTXt_SUPPORTED -# endif -#endif -#ifndef PNG_NO_WRITE_UNKNOWN_CHUNKS -# define PNG_WRITE_UNKNOWN_CHUNKS_SUPPORTED -# ifndef PNG_UNKNOWN_CHUNKS_SUPPORTED -# define PNG_UNKNOWN_CHUNKS_SUPPORTED -# endif -# ifndef PNG_NO_HANDLE_AS_UNKNOWN -# ifndef PNG_HANDLE_AS_UNKNOWN_SUPPORTED -# define PNG_HANDLE_AS_UNKNOWN_SUPPORTED -# endif -# endif -#endif -#if defined(PNG_WRITE_iTXt_SUPPORTED) || defined(PNG_WRITE_tEXt_SUPPORTED) || \ - defined(PNG_WRITE_zTXt_SUPPORTED) -# define PNG_WRITE_TEXT_SUPPORTED -# ifndef PNG_TEXT_SUPPORTED -# define PNG_TEXT_SUPPORTED -# endif -#endif - -#endif /* PNG_WRITE_ANCILLARY_CHUNKS_SUPPORTED */ - -/* Turn this off to disable png_read_png() and - * png_write_png() and leave the row_pointers member - * out of the info structure. - */ -#ifndef PNG_NO_INFO_IMAGE -# define PNG_INFO_IMAGE_SUPPORTED -#endif - -/* need the time information for reading tIME chunks */ -#if defined(PNG_tIME_SUPPORTED) -# if !defined(_WIN32_WCE) - /* "time.h" functions are not supported on WindowsCE */ -# include -# endif -#endif - -/* Some typedefs to get us started. These should be safe on most of the - * common platforms. The typedefs should be at least as large as the - * numbers suggest (a png_uint_32 must be at least 32 bits long), but they - * don't have to be exactly that size. Some compilers dislike passing - * unsigned shorts as function parameters, so you may be better off using - * unsigned int for png_uint_16. Likewise, for 64-bit systems, you may - * want to have unsigned int for png_uint_32 instead of unsigned long. - */ - -typedef unsigned long png_uint_32; -typedef long png_int_32; -typedef unsigned short png_uint_16; -typedef short png_int_16; -typedef unsigned char png_byte; - -/* This is usually size_t. It is typedef'ed just in case you need it to - change (I'm not sure if you will or not, so I thought I'd be safe) */ -#ifdef PNG_SIZE_T - typedef PNG_SIZE_T png_size_t; -# define png_sizeof(x) png_convert_size(sizeof (x)) -#else - typedef size_t png_size_t; -# define png_sizeof(x) sizeof (x) -#endif - -/* The following is needed for medium model support. It cannot be in the - * PNG_INTERNAL section. Needs modification for other compilers besides - * MSC. Model independent support declares all arrays and pointers to be - * large using the far keyword. The zlib version used must also support - * model independent data. As of version zlib 1.0.4, the necessary changes - * have been made in zlib. The USE_FAR_KEYWORD define triggers other - * changes that are needed. (Tim Wegner) - */ - -/* Separate compiler dependencies (problem here is that zlib.h always - defines FAR. (SJT) */ -#ifdef __BORLANDC__ -# if defined(__LARGE__) || defined(__HUGE__) || defined(__COMPACT__) -# define LDATA 1 -# else -# define LDATA 0 -# endif - /* GRR: why is Cygwin in here? Cygwin is not Borland C... */ -# if !defined(__WIN32__) && !defined(__FLAT__) && !defined(__CYGWIN__) -# define PNG_MAX_MALLOC_64K -# if (LDATA != 1) -# ifndef FAR -# define FAR __far -# endif -# define USE_FAR_KEYWORD -# endif /* LDATA != 1 */ - /* Possibly useful for moving data out of default segment. - * Uncomment it if you want. Could also define FARDATA as - * const if your compiler supports it. (SJT) -# define FARDATA FAR - */ -# endif /* __WIN32__, __FLAT__, __CYGWIN__ */ -#endif /* __BORLANDC__ */ - - -/* Suggest testing for specific compiler first before testing for - * FAR. The Watcom compiler defines both __MEDIUM__ and M_I86MM, - * making reliance oncertain keywords suspect. (SJT) - */ - -/* MSC Medium model */ -#if defined(FAR) -# if defined(M_I86MM) -# define USE_FAR_KEYWORD -# define FARDATA FAR -# include -# endif -#endif - -/* SJT: default case */ -#ifndef FAR -# define FAR -#endif - -/* At this point FAR is always defined */ -#ifndef FARDATA -# define FARDATA -#endif - -/* Typedef for floating-point numbers that are converted - to fixed-point with a multiple of 100,000, e.g., int_gamma */ -typedef png_int_32 png_fixed_point; - -/* Add typedefs for pointers */ -typedef void FAR * png_voidp; -typedef png_byte FAR * png_bytep; -typedef png_uint_32 FAR * png_uint_32p; -typedef png_int_32 FAR * png_int_32p; -typedef png_uint_16 FAR * png_uint_16p; -typedef png_int_16 FAR * png_int_16p; -typedef PNG_CONST char FAR * png_const_charp; -typedef char FAR * png_charp; -typedef png_fixed_point FAR * png_fixed_point_p; - -#ifndef PNG_NO_STDIO -#if defined(_WIN32_WCE) -typedef HANDLE png_FILE_p; -#else -typedef FILE * png_FILE_p; -#endif -#endif - -#ifdef PNG_FLOATING_POINT_SUPPORTED -typedef double FAR * png_doublep; -#endif - -/* Pointers to pointers; i.e. arrays */ -typedef png_byte FAR * FAR * png_bytepp; -typedef png_uint_32 FAR * FAR * png_uint_32pp; -typedef png_int_32 FAR * FAR * png_int_32pp; -typedef png_uint_16 FAR * FAR * png_uint_16pp; -typedef png_int_16 FAR * FAR * png_int_16pp; -typedef PNG_CONST char FAR * FAR * png_const_charpp; -typedef char FAR * FAR * png_charpp; -typedef png_fixed_point FAR * FAR * png_fixed_point_pp; -#ifdef PNG_FLOATING_POINT_SUPPORTED -typedef double FAR * FAR * png_doublepp; -#endif - -/* Pointers to pointers to pointers; i.e., pointer to array */ -typedef char FAR * FAR * FAR * png_charppp; - -#if defined(PNG_1_0_X) || defined(PNG_1_2_X) -/* SPC - Is this stuff deprecated? */ -/* It'll be removed as of libpng-1.3.0 - GR-P */ -/* libpng typedefs for types in zlib. If zlib changes - * or another compression library is used, then change these. - * Eliminates need to change all the source files. - */ -typedef charf * png_zcharp; -typedef charf * FAR * png_zcharpp; -typedef z_stream FAR * png_zstreamp; -#endif /* (PNG_1_0_X) || defined(PNG_1_2_X) */ - -/* - * Define PNG_BUILD_DLL if the module being built is a Windows - * LIBPNG DLL. - * - * Define PNG_USE_DLL if you want to *link* to the Windows LIBPNG DLL. - * It is equivalent to Microsoft predefined macro _DLL that is - * automatically defined when you compile using the share - * version of the CRT (C Run-Time library) - * - * The cygwin mods make this behavior a little different: - * Define PNG_BUILD_DLL if you are building a dll for use with cygwin - * Define PNG_STATIC if you are building a static library for use with cygwin, - * -or- if you are building an application that you want to link to the - * static library. - * PNG_USE_DLL is defined by default (no user action needed) unless one of - * the other flags is defined. - */ - -#if !defined(PNG_DLL) && (defined(PNG_BUILD_DLL) || defined(PNG_USE_DLL)) -# define PNG_DLL -#endif -/* If CYGWIN, then disallow GLOBAL ARRAYS unless building a static lib. - * When building a static lib, default to no GLOBAL ARRAYS, but allow - * command-line override - */ -#if defined(__CYGWIN__) -# if !defined(PNG_STATIC) -# if defined(PNG_USE_GLOBAL_ARRAYS) -# undef PNG_USE_GLOBAL_ARRAYS -# endif -# if !defined(PNG_USE_LOCAL_ARRAYS) -# define PNG_USE_LOCAL_ARRAYS -# endif -# else -# if defined(PNG_USE_LOCAL_ARRAYS) || defined(PNG_NO_GLOBAL_ARRAYS) -# if defined(PNG_USE_GLOBAL_ARRAYS) -# undef PNG_USE_GLOBAL_ARRAYS -# endif -# endif -# endif -# if !defined(PNG_USE_LOCAL_ARRAYS) && !defined(PNG_USE_GLOBAL_ARRAYS) -# define PNG_USE_LOCAL_ARRAYS -# endif -#endif - -/* Do not use global arrays (helps with building DLL's) - * They are no longer used in libpng itself, since version 1.0.5c, - * but might be required for some pre-1.0.5c applications. - */ -#if !defined(PNG_USE_LOCAL_ARRAYS) && !defined(PNG_USE_GLOBAL_ARRAYS) -# if defined(PNG_NO_GLOBAL_ARRAYS) || \ - (defined(__GNUC__) && defined(PNG_DLL)) || defined(_MSC_VER) -# define PNG_USE_LOCAL_ARRAYS -# else -# define PNG_USE_GLOBAL_ARRAYS -# endif -#endif - -#if defined(__CYGWIN__) -# undef PNGAPI -# define PNGAPI __cdecl -# undef PNG_IMPEXP -# define PNG_IMPEXP -#endif - -/* If you define PNGAPI, e.g., with compiler option "-DPNGAPI=__stdcall", - * you may get warnings regarding the linkage of png_zalloc and png_zfree. - * Don't ignore those warnings; you must also reset the default calling - * convention in your compiler to match your PNGAPI, and you must build - * zlib and your applications the same way you build libpng. - */ - -#if defined(__MINGW32__) && !defined(PNG_MODULEDEF) -# ifndef PNG_NO_MODULEDEF -# define PNG_NO_MODULEDEF -# endif -#endif - -#if !defined(PNG_IMPEXP) && defined(PNG_BUILD_DLL) && !defined(PNG_NO_MODULEDEF) -# define PNG_IMPEXP -#endif - -#if defined(PNG_DLL) || defined(_DLL) || defined(__DLL__ ) || \ - (( defined(_Windows) || defined(_WINDOWS) || \ - defined(WIN32) || defined(_WIN32) || defined(__WIN32__) )) - -# ifndef PNGAPI -# if defined(__GNUC__) || (defined (_MSC_VER) && (_MSC_VER >= 800)) -# define PNGAPI __cdecl -# else -# define PNGAPI _cdecl -# endif -# endif - -# if !defined(PNG_IMPEXP) && (!defined(PNG_DLL) || \ - 0 /* WINCOMPILER_WITH_NO_SUPPORT_FOR_DECLIMPEXP */) -# define PNG_IMPEXP -# endif - -# if !defined(PNG_IMPEXP) - -# define PNG_EXPORT_TYPE1(type,symbol) PNG_IMPEXP type PNGAPI symbol -# define PNG_EXPORT_TYPE2(type,symbol) type PNG_IMPEXP PNGAPI symbol - - /* Borland/Microsoft */ -# if defined(_MSC_VER) || defined(__BORLANDC__) -# if (_MSC_VER >= 800) || (__BORLANDC__ >= 0x500) -# define PNG_EXPORT PNG_EXPORT_TYPE1 -# else -# define PNG_EXPORT PNG_EXPORT_TYPE2 -# if defined(PNG_BUILD_DLL) -# define PNG_IMPEXP __export -# else -# define PNG_IMPEXP /*__import */ /* doesn't exist AFAIK in - VC++ */ -# endif /* Exists in Borland C++ for - C++ classes (== huge) */ -# endif -# endif - -# if !defined(PNG_IMPEXP) -# if defined(PNG_BUILD_DLL) -# define PNG_IMPEXP __declspec(dllexport) -# else -# define PNG_IMPEXP __declspec(dllimport) -# endif -# endif -# endif /* PNG_IMPEXP */ -#else /* !(DLL || non-cygwin WINDOWS) */ -# if (defined(__IBMC__) || defined(__IBMCPP__)) && defined(__OS2__) -# ifndef PNGAPI -# define PNGAPI _System -# endif -# else -# if 0 /* ... other platforms, with other meanings */ -# endif -# endif -#endif - -#ifndef PNGAPI -# define PNGAPI -#endif -#ifndef PNG_IMPEXP -# define PNG_IMPEXP -#endif - -#ifdef PNG_BUILDSYMS -# ifndef PNG_EXPORT -# define PNG_EXPORT(type,symbol) PNG_FUNCTION_EXPORT symbol END -# endif -# ifdef PNG_USE_GLOBAL_ARRAYS -# ifndef PNG_EXPORT_VAR -# define PNG_EXPORT_VAR(type) PNG_DATA_EXPORT -# endif -# endif -#endif - -#ifndef PNG_EXPORT -# define PNG_EXPORT(type,symbol) PNG_IMPEXP type PNGAPI symbol -#endif - -#ifdef PNG_USE_GLOBAL_ARRAYS -# ifndef PNG_EXPORT_VAR -# define PNG_EXPORT_VAR(type) extern PNG_IMPEXP type -# endif -#endif - -/* User may want to use these so they are not in PNG_INTERNAL. Any library - * functions that are passed far data must be model independent. - */ - -#ifndef PNG_ABORT -# define PNG_ABORT() abort() -#endif - -#ifdef PNG_SETJMP_SUPPORTED -# define png_jmpbuf(png_ptr) ((png_ptr)->jmpbuf) -#else -# define png_jmpbuf(png_ptr) \ - (LIBPNG_WAS_COMPILED_WITH__PNG_SETJMP_NOT_SUPPORTED) -#endif - -#if defined(USE_FAR_KEYWORD) /* memory model independent fns */ -/* use this to make far-to-near assignments */ -# define CHECK 1 -# define NOCHECK 0 -# define CVT_PTR(ptr) (png_far_to_near(png_ptr,ptr,CHECK)) -# define CVT_PTR_NOCHECK(ptr) (png_far_to_near(png_ptr,ptr,NOCHECK)) -# define png_snprintf _fsnprintf /* Added to v 1.2.19 */ -# define png_strlen _fstrlen -# define png_memcmp _fmemcmp /* SJT: added */ -# define png_memcpy _fmemcpy -# define png_memset _fmemset -#else /* use the usual functions */ -# define CVT_PTR(ptr) (ptr) -# define CVT_PTR_NOCHECK(ptr) (ptr) -# ifndef PNG_NO_SNPRINTF -# ifdef _MSC_VER -# define png_snprintf _snprintf /* Added to v 1.2.19 */ -# define png_snprintf2 _snprintf -# define png_snprintf6 _snprintf -# else -# define png_snprintf snprintf /* Added to v 1.2.19 */ -# define png_snprintf2 snprintf -# define png_snprintf6 snprintf -# endif -# else - /* You don't have or don't want to use snprintf(). Caution: Using - * sprintf instead of snprintf exposes your application to accidental - * or malevolent buffer overflows. If you don't have snprintf() - * as a general rule you should provide one (you can get one from - * Portable OpenSSH). */ -# define png_snprintf(s1,n,fmt,x1) sprintf(s1,fmt,x1) -# define png_snprintf2(s1,n,fmt,x1,x2) sprintf(s1,fmt,x1,x2) -# define png_snprintf6(s1,n,fmt,x1,x2,x3,x4,x5,x6) \ - sprintf(s1,fmt,x1,x2,x3,x4,x5,x6) -# endif -# define png_strlen strlen -# define png_memcmp memcmp /* SJT: added */ -# define png_memcpy memcpy -# define png_memset memset -#endif -/* End of memory model independent support */ - -/* Just a little check that someone hasn't tried to define something - * contradictory. - */ -#if (PNG_ZBUF_SIZE > 65536L) && defined(PNG_MAX_MALLOC_64K) -# undef PNG_ZBUF_SIZE -# define PNG_ZBUF_SIZE 65536L -#endif - -/* Added at libpng-1.2.8 */ -#endif /* PNG_VERSION_INFO_ONLY */ - -#endif /* PNGCONF_H */ diff --git a/dependencies/libpng/lib/libpng.lib b/dependencies/libpng/lib/libpng.lib deleted file mode 100644 index 99a85adf..00000000 Binary files a/dependencies/libpng/lib/libpng.lib and /dev/null differ diff --git a/dependencies/libpng/lib/libpngd.lib b/dependencies/libpng/lib/libpngd.lib deleted file mode 100644 index e4fb04aa..00000000 Binary files a/dependencies/libpng/lib/libpngd.lib and /dev/null differ diff --git a/dependencies/libpng/lib/vc90.pdb b/dependencies/libpng/lib/vc90.pdb deleted file mode 100644 index 63d84bc4..00000000 Binary files a/dependencies/libpng/lib/vc90.pdb and /dev/null differ diff --git a/dependencies/msvc/gl/glext.h b/dependencies/msvc/gl/glext.h deleted file mode 100644 index 3d69d4e3..00000000 --- a/dependencies/msvc/gl/glext.h +++ /dev/null @@ -1,7271 +0,0 @@ -#ifndef __glext_h_ -#define __glext_h_ - -#ifdef __cplusplus -extern "C" { -#endif - -/* -** Copyright (c) 2007 The Khronos Group Inc. -** -** Permission is hereby granted, free of charge, to any person obtaining a -** copy of this software and/or associated documentation files (the -** "Materials"), to deal in the Materials without restriction, including -** without limitation the rights to use, copy, modify, merge, publish, -** distribute, sublicense, and/or sell copies of the Materials, and to -** permit persons to whom the Materials are furnished to do so, subject to -** the following conditions: -** -** The above copyright notice and this permission notice shall be included -** in all copies or substantial portions of the Materials. -** -** THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, -** EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF -** MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. -** IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY -** CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, -** TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE -** MATERIALS OR THE USE OR OTHER DEALINGS IN THE MATERIALS. -*/ - -#if defined(_WIN32) && !defined(APIENTRY) && !defined(__CYGWIN__) && !defined(__SCITECH_SNAP__) -#define WIN32_LEAN_AND_MEAN 1 -#include -#endif - -#ifndef APIENTRY -#define APIENTRY -#endif -#ifndef APIENTRYP -#define APIENTRYP APIENTRY * -#endif -#ifndef GLAPI -#define GLAPI extern -#endif - -/*************************************************************/ - -/* Header file version number, required by OpenGL ABI for Linux */ -/* glext.h last updated 2007/02/12 */ -/* Current version at http://www.opengl.org/registry/ */ -#define GL_GLEXT_VERSION 39 - -#ifndef GL_VERSION_1_2 -#define GL_UNSIGNED_BYTE_3_3_2 0x8032 -#define GL_UNSIGNED_SHORT_4_4_4_4 0x8033 -#define GL_UNSIGNED_SHORT_5_5_5_1 0x8034 -#define GL_UNSIGNED_INT_8_8_8_8 0x8035 -#define GL_UNSIGNED_INT_10_10_10_2 0x8036 -#define GL_RESCALE_NORMAL 0x803A -#define GL_TEXTURE_BINDING_3D 0x806A -#define GL_PACK_SKIP_IMAGES 0x806B -#define GL_PACK_IMAGE_HEIGHT 0x806C -#define GL_UNPACK_SKIP_IMAGES 0x806D -#define GL_UNPACK_IMAGE_HEIGHT 0x806E -#define GL_TEXTURE_3D 0x806F -#define GL_PROXY_TEXTURE_3D 0x8070 -#define GL_TEXTURE_DEPTH 0x8071 -#define GL_TEXTURE_WRAP_R 0x8072 -#define GL_MAX_3D_TEXTURE_SIZE 0x8073 -#define GL_UNSIGNED_BYTE_2_3_3_REV 0x8362 -#define GL_UNSIGNED_SHORT_5_6_5 0x8363 -#define GL_UNSIGNED_SHORT_5_6_5_REV 0x8364 -#define GL_UNSIGNED_SHORT_4_4_4_4_REV 0x8365 -#define GL_UNSIGNED_SHORT_1_5_5_5_REV 0x8366 -#define GL_UNSIGNED_INT_8_8_8_8_REV 0x8367 -#define GL_UNSIGNED_INT_2_10_10_10_REV 0x8368 -#define GL_BGR 0x80E0 -#define GL_BGRA 0x80E1 -#define GL_MAX_ELEMENTS_VERTICES 0x80E8 -#define GL_MAX_ELEMENTS_INDICES 0x80E9 -#define GL_CLAMP_TO_EDGE 0x812F -#define GL_TEXTURE_MIN_LOD 0x813A -#define GL_TEXTURE_MAX_LOD 0x813B -#define GL_TEXTURE_BASE_LEVEL 0x813C -#define GL_TEXTURE_MAX_LEVEL 0x813D -#define GL_LIGHT_MODEL_COLOR_CONTROL 0x81F8 -#define GL_SINGLE_COLOR 0x81F9 -#define GL_SEPARATE_SPECULAR_COLOR 0x81FA -#define GL_SMOOTH_POINT_SIZE_RANGE 0x0B12 -#define GL_SMOOTH_POINT_SIZE_GRANULARITY 0x0B13 -#define GL_SMOOTH_LINE_WIDTH_RANGE 0x0B22 -#define GL_SMOOTH_LINE_WIDTH_GRANULARITY 0x0B23 -#define GL_ALIASED_POINT_SIZE_RANGE 0x846D -#define GL_ALIASED_LINE_WIDTH_RANGE 0x846E -#endif - -#ifndef GL_ARB_imaging -#define GL_CONSTANT_COLOR 0x8001 -#define GL_ONE_MINUS_CONSTANT_COLOR 0x8002 -#define GL_CONSTANT_ALPHA 0x8003 -#define GL_ONE_MINUS_CONSTANT_ALPHA 0x8004 -#define GL_BLEND_COLOR 0x8005 -#define GL_FUNC_ADD 0x8006 -#define GL_MIN 0x8007 -#define GL_MAX 0x8008 -#define GL_BLEND_EQUATION 0x8009 -#define GL_FUNC_SUBTRACT 0x800A -#define GL_FUNC_REVERSE_SUBTRACT 0x800B -#define GL_CONVOLUTION_1D 0x8010 -#define GL_CONVOLUTION_2D 0x8011 -#define GL_SEPARABLE_2D 0x8012 -#define GL_CONVOLUTION_BORDER_MODE 0x8013 -#define GL_CONVOLUTION_FILTER_SCALE 0x8014 -#define GL_CONVOLUTION_FILTER_BIAS 0x8015 -#define GL_REDUCE 0x8016 -#define GL_CONVOLUTION_FORMAT 0x8017 -#define GL_CONVOLUTION_WIDTH 0x8018 -#define GL_CONVOLUTION_HEIGHT 0x8019 -#define GL_MAX_CONVOLUTION_WIDTH 0x801A -#define GL_MAX_CONVOLUTION_HEIGHT 0x801B -#define GL_POST_CONVOLUTION_RED_SCALE 0x801C -#define GL_POST_CONVOLUTION_GREEN_SCALE 0x801D -#define GL_POST_CONVOLUTION_BLUE_SCALE 0x801E -#define GL_POST_CONVOLUTION_ALPHA_SCALE 0x801F -#define GL_POST_CONVOLUTION_RED_BIAS 0x8020 -#define GL_POST_CONVOLUTION_GREEN_BIAS 0x8021 -#define GL_POST_CONVOLUTION_BLUE_BIAS 0x8022 -#define GL_POST_CONVOLUTION_ALPHA_BIAS 0x8023 -#define GL_HISTOGRAM 0x8024 -#define GL_PROXY_HISTOGRAM 0x8025 -#define GL_HISTOGRAM_WIDTH 0x8026 -#define GL_HISTOGRAM_FORMAT 0x8027 -#define GL_HISTOGRAM_RED_SIZE 0x8028 -#define GL_HISTOGRAM_GREEN_SIZE 0x8029 -#define GL_HISTOGRAM_BLUE_SIZE 0x802A -#define GL_HISTOGRAM_ALPHA_SIZE 0x802B -#define GL_HISTOGRAM_LUMINANCE_SIZE 0x802C -#define GL_HISTOGRAM_SINK 0x802D -#define GL_MINMAX 0x802E -#define GL_MINMAX_FORMAT 0x802F -#define GL_MINMAX_SINK 0x8030 -#define GL_TABLE_TOO_LARGE 0x8031 -#define GL_COLOR_MATRIX 0x80B1 -#define GL_COLOR_MATRIX_STACK_DEPTH 0x80B2 -#define GL_MAX_COLOR_MATRIX_STACK_DEPTH 0x80B3 -#define GL_POST_COLOR_MATRIX_RED_SCALE 0x80B4 -#define GL_POST_COLOR_MATRIX_GREEN_SCALE 0x80B5 -#define GL_POST_COLOR_MATRIX_BLUE_SCALE 0x80B6 -#define GL_POST_COLOR_MATRIX_ALPHA_SCALE 0x80B7 -#define GL_POST_COLOR_MATRIX_RED_BIAS 0x80B8 -#define GL_POST_COLOR_MATRIX_GREEN_BIAS 0x80B9 -#define GL_POST_COLOR_MATRIX_BLUE_BIAS 0x80BA -#define GL_POST_COLOR_MATRIX_ALPHA_BIAS 0x80BB -#define GL_COLOR_TABLE 0x80D0 -#define GL_POST_CONVOLUTION_COLOR_TABLE 0x80D1 -#define GL_POST_COLOR_MATRIX_COLOR_TABLE 0x80D2 -#define GL_PROXY_COLOR_TABLE 0x80D3 -#define GL_PROXY_POST_CONVOLUTION_COLOR_TABLE 0x80D4 -#define GL_PROXY_POST_COLOR_MATRIX_COLOR_TABLE 0x80D5 -#define GL_COLOR_TABLE_SCALE 0x80D6 -#define GL_COLOR_TABLE_BIAS 0x80D7 -#define GL_COLOR_TABLE_FORMAT 0x80D8 -#define GL_COLOR_TABLE_WIDTH 0x80D9 -#define GL_COLOR_TABLE_RED_SIZE 0x80DA -#define GL_COLOR_TABLE_GREEN_SIZE 0x80DB -#define GL_COLOR_TABLE_BLUE_SIZE 0x80DC -#define GL_COLOR_TABLE_ALPHA_SIZE 0x80DD -#define GL_COLOR_TABLE_LUMINANCE_SIZE 0x80DE -#define GL_COLOR_TABLE_INTENSITY_SIZE 0x80DF -#define GL_CONSTANT_BORDER 0x8151 -#define GL_REPLICATE_BORDER 0x8153 -#define GL_CONVOLUTION_BORDER_COLOR 0x8154 -#endif - -#ifndef GL_VERSION_1_3 -#define GL_TEXTURE0 0x84C0 -#define GL_TEXTURE1 0x84C1 -#define GL_TEXTURE2 0x84C2 -#define GL_TEXTURE3 0x84C3 -#define GL_TEXTURE4 0x84C4 -#define GL_TEXTURE5 0x84C5 -#define GL_TEXTURE6 0x84C6 -#define GL_TEXTURE7 0x84C7 -#define GL_TEXTURE8 0x84C8 -#define GL_TEXTURE9 0x84C9 -#define GL_TEXTURE10 0x84CA -#define GL_TEXTURE11 0x84CB -#define GL_TEXTURE12 0x84CC -#define GL_TEXTURE13 0x84CD -#define GL_TEXTURE14 0x84CE -#define GL_TEXTURE15 0x84CF -#define GL_TEXTURE16 0x84D0 -#define GL_TEXTURE17 0x84D1 -#define GL_TEXTURE18 0x84D2 -#define GL_TEXTURE19 0x84D3 -#define GL_TEXTURE20 0x84D4 -#define GL_TEXTURE21 0x84D5 -#define GL_TEXTURE22 0x84D6 -#define GL_TEXTURE23 0x84D7 -#define GL_TEXTURE24 0x84D8 -#define GL_TEXTURE25 0x84D9 -#define GL_TEXTURE26 0x84DA -#define GL_TEXTURE27 0x84DB -#define GL_TEXTURE28 0x84DC -#define GL_TEXTURE29 0x84DD -#define GL_TEXTURE30 0x84DE -#define GL_TEXTURE31 0x84DF -#define GL_ACTIVE_TEXTURE 0x84E0 -#define GL_CLIENT_ACTIVE_TEXTURE 0x84E1 -#define GL_MAX_TEXTURE_UNITS 0x84E2 -#define GL_TRANSPOSE_MODELVIEW_MATRIX 0x84E3 -#define GL_TRANSPOSE_PROJECTION_MATRIX 0x84E4 -#define GL_TRANSPOSE_TEXTURE_MATRIX 0x84E5 -#define GL_TRANSPOSE_COLOR_MATRIX 0x84E6 -#define GL_MULTISAMPLE 0x809D -#define GL_SAMPLE_ALPHA_TO_COVERAGE 0x809E -#define GL_SAMPLE_ALPHA_TO_ONE 0x809F -#define GL_SAMPLE_COVERAGE 0x80A0 -#define GL_SAMPLE_BUFFERS 0x80A8 -#define GL_SAMPLES 0x80A9 -#define GL_SAMPLE_COVERAGE_VALUE 0x80AA -#define GL_SAMPLE_COVERAGE_INVERT 0x80AB -#define GL_MULTISAMPLE_BIT 0x20000000 -#define GL_NORMAL_MAP 0x8511 -#define GL_REFLECTION_MAP 0x8512 -#define GL_TEXTURE_CUBE_MAP 0x8513 -#define GL_TEXTURE_BINDING_CUBE_MAP 0x8514 -#define GL_TEXTURE_CUBE_MAP_POSITIVE_X 0x8515 -#define GL_TEXTURE_CUBE_MAP_NEGATIVE_X 0x8516 -#define GL_TEXTURE_CUBE_MAP_POSITIVE_Y 0x8517 -#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Y 0x8518 -#define GL_TEXTURE_CUBE_MAP_POSITIVE_Z 0x8519 -#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z 0x851A -#define GL_PROXY_TEXTURE_CUBE_MAP 0x851B -#define GL_MAX_CUBE_MAP_TEXTURE_SIZE 0x851C -#define GL_COMPRESSED_ALPHA 0x84E9 -#define GL_COMPRESSED_LUMINANCE 0x84EA -#define GL_COMPRESSED_LUMINANCE_ALPHA 0x84EB -#define GL_COMPRESSED_INTENSITY 0x84EC -#define GL_COMPRESSED_RGB 0x84ED -#define GL_COMPRESSED_RGBA 0x84EE -#define GL_TEXTURE_COMPRESSION_HINT 0x84EF -#define GL_TEXTURE_COMPRESSED_IMAGE_SIZE 0x86A0 -#define GL_TEXTURE_COMPRESSED 0x86A1 -#define GL_NUM_COMPRESSED_TEXTURE_FORMATS 0x86A2 -#define GL_COMPRESSED_TEXTURE_FORMATS 0x86A3 -#define GL_CLAMP_TO_BORDER 0x812D -#define GL_COMBINE 0x8570 -#define GL_COMBINE_RGB 0x8571 -#define GL_COMBINE_ALPHA 0x8572 -#define GL_SOURCE0_RGB 0x8580 -#define GL_SOURCE1_RGB 0x8581 -#define GL_SOURCE2_RGB 0x8582 -#define GL_SOURCE0_ALPHA 0x8588 -#define GL_SOURCE1_ALPHA 0x8589 -#define GL_SOURCE2_ALPHA 0x858A -#define GL_OPERAND0_RGB 0x8590 -#define GL_OPERAND1_RGB 0x8591 -#define GL_OPERAND2_RGB 0x8592 -#define GL_OPERAND0_ALPHA 0x8598 -#define GL_OPERAND1_ALPHA 0x8599 -#define GL_OPERAND2_ALPHA 0x859A -#define GL_RGB_SCALE 0x8573 -#define GL_ADD_SIGNED 0x8574 -#define GL_INTERPOLATE 0x8575 -#define GL_SUBTRACT 0x84E7 -#define GL_CONSTANT 0x8576 -#define GL_PRIMARY_COLOR 0x8577 -#define GL_PREVIOUS 0x8578 -#define GL_DOT3_RGB 0x86AE -#define GL_DOT3_RGBA 0x86AF -#endif - -#ifndef GL_VERSION_1_4 -#define GL_BLEND_DST_RGB 0x80C8 -#define GL_BLEND_SRC_RGB 0x80C9 -#define GL_BLEND_DST_ALPHA 0x80CA -#define GL_BLEND_SRC_ALPHA 0x80CB -#define GL_POINT_SIZE_MIN 0x8126 -#define GL_POINT_SIZE_MAX 0x8127 -#define GL_POINT_FADE_THRESHOLD_SIZE 0x8128 -#define GL_POINT_DISTANCE_ATTENUATION 0x8129 -#define GL_GENERATE_MIPMAP 0x8191 -#define GL_GENERATE_MIPMAP_HINT 0x8192 -#define GL_DEPTH_COMPONENT16 0x81A5 -#define GL_DEPTH_COMPONENT24 0x81A6 -#define GL_DEPTH_COMPONENT32 0x81A7 -#define GL_MIRRORED_REPEAT 0x8370 -#define GL_FOG_COORDINATE_SOURCE 0x8450 -#define GL_FOG_COORDINATE 0x8451 -#define GL_FRAGMENT_DEPTH 0x8452 -#define GL_CURRENT_FOG_COORDINATE 0x8453 -#define GL_FOG_COORDINATE_ARRAY_TYPE 0x8454 -#define GL_FOG_COORDINATE_ARRAY_STRIDE 0x8455 -#define GL_FOG_COORDINATE_ARRAY_POINTER 0x8456 -#define GL_FOG_COORDINATE_ARRAY 0x8457 -#define GL_COLOR_SUM 0x8458 -#define GL_CURRENT_SECONDARY_COLOR 0x8459 -#define GL_SECONDARY_COLOR_ARRAY_SIZE 0x845A -#define GL_SECONDARY_COLOR_ARRAY_TYPE 0x845B -#define GL_SECONDARY_COLOR_ARRAY_STRIDE 0x845C -#define GL_SECONDARY_COLOR_ARRAY_POINTER 0x845D -#define GL_SECONDARY_COLOR_ARRAY 0x845E -#define GL_MAX_TEXTURE_LOD_BIAS 0x84FD -#define GL_TEXTURE_FILTER_CONTROL 0x8500 -#define GL_TEXTURE_LOD_BIAS 0x8501 -#define GL_INCR_WRAP 0x8507 -#define GL_DECR_WRAP 0x8508 -#define GL_TEXTURE_DEPTH_SIZE 0x884A -#define GL_DEPTH_TEXTURE_MODE 0x884B -#define GL_TEXTURE_COMPARE_MODE 0x884C -#define GL_TEXTURE_COMPARE_FUNC 0x884D -#define GL_COMPARE_R_TO_TEXTURE 0x884E -#endif - -#ifndef GL_VERSION_1_5 -#define GL_BUFFER_SIZE 0x8764 -#define GL_BUFFER_USAGE 0x8765 -#define GL_QUERY_COUNTER_BITS 0x8864 -#define GL_CURRENT_QUERY 0x8865 -#define GL_QUERY_RESULT 0x8866 -#define GL_QUERY_RESULT_AVAILABLE 0x8867 -#define GL_ARRAY_BUFFER 0x8892 -#define GL_ELEMENT_ARRAY_BUFFER 0x8893 -#define GL_ARRAY_BUFFER_BINDING 0x8894 -#define GL_ELEMENT_ARRAY_BUFFER_BINDING 0x8895 -#define GL_VERTEX_ARRAY_BUFFER_BINDING 0x8896 -#define GL_NORMAL_ARRAY_BUFFER_BINDING 0x8897 -#define GL_COLOR_ARRAY_BUFFER_BINDING 0x8898 -#define GL_INDEX_ARRAY_BUFFER_BINDING 0x8899 -#define GL_TEXTURE_COORD_ARRAY_BUFFER_BINDING 0x889A -#define GL_EDGE_FLAG_ARRAY_BUFFER_BINDING 0x889B -#define GL_SECONDARY_COLOR_ARRAY_BUFFER_BINDING 0x889C -#define GL_FOG_COORDINATE_ARRAY_BUFFER_BINDING 0x889D -#define GL_WEIGHT_ARRAY_BUFFER_BINDING 0x889E -#define GL_VERTEX_ATTRIB_ARRAY_BUFFER_BINDING 0x889F -#define GL_READ_ONLY 0x88B8 -#define GL_WRITE_ONLY 0x88B9 -#define GL_READ_WRITE 0x88BA -#define GL_BUFFER_ACCESS 0x88BB -#define GL_BUFFER_MAPPED 0x88BC -#define GL_BUFFER_MAP_POINTER 0x88BD -#define GL_STREAM_DRAW 0x88E0 -#define GL_STREAM_READ 0x88E1 -#define GL_STREAM_COPY 0x88E2 -#define GL_STATIC_DRAW 0x88E4 -#define GL_STATIC_READ 0x88E5 -#define GL_STATIC_COPY 0x88E6 -#define GL_DYNAMIC_DRAW 0x88E8 -#define GL_DYNAMIC_READ 0x88E9 -#define GL_DYNAMIC_COPY 0x88EA -#define GL_SAMPLES_PASSED 0x8914 -#define GL_FOG_COORD_SRC GL_FOG_COORDINATE_SOURCE -#define GL_FOG_COORD GL_FOG_COORDINATE -#define GL_CURRENT_FOG_COORD GL_CURRENT_FOG_COORDINATE -#define GL_FOG_COORD_ARRAY_TYPE GL_FOG_COORDINATE_ARRAY_TYPE -#define GL_FOG_COORD_ARRAY_STRIDE GL_FOG_COORDINATE_ARRAY_STRIDE -#define GL_FOG_COORD_ARRAY_POINTER GL_FOG_COORDINATE_ARRAY_POINTER -#define GL_FOG_COORD_ARRAY GL_FOG_COORDINATE_ARRAY -#define GL_FOG_COORD_ARRAY_BUFFER_BINDING GL_FOG_COORDINATE_ARRAY_BUFFER_BINDING -#define GL_SRC0_RGB GL_SOURCE0_RGB -#define GL_SRC1_RGB GL_SOURCE1_RGB -#define GL_SRC2_RGB GL_SOURCE2_RGB -#define GL_SRC0_ALPHA GL_SOURCE0_ALPHA -#define GL_SRC1_ALPHA GL_SOURCE1_ALPHA -#define GL_SRC2_ALPHA GL_SOURCE2_ALPHA -#endif - -#ifndef GL_VERSION_2_0 -#define GL_BLEND_EQUATION_RGB GL_BLEND_EQUATION -#define GL_VERTEX_ATTRIB_ARRAY_ENABLED 0x8622 -#define GL_VERTEX_ATTRIB_ARRAY_SIZE 0x8623 -#define GL_VERTEX_ATTRIB_ARRAY_STRIDE 0x8624 -#define GL_VERTEX_ATTRIB_ARRAY_TYPE 0x8625 -#define GL_CURRENT_VERTEX_ATTRIB 0x8626 -#define GL_VERTEX_PROGRAM_POINT_SIZE 0x8642 -#define GL_VERTEX_PROGRAM_TWO_SIDE 0x8643 -#define GL_VERTEX_ATTRIB_ARRAY_POINTER 0x8645 -#define GL_STENCIL_BACK_FUNC 0x8800 -#define GL_STENCIL_BACK_FAIL 0x8801 -#define GL_STENCIL_BACK_PASS_DEPTH_FAIL 0x8802 -#define GL_STENCIL_BACK_PASS_DEPTH_PASS 0x8803 -#define GL_MAX_DRAW_BUFFERS 0x8824 -#define GL_DRAW_BUFFER0 0x8825 -#define GL_DRAW_BUFFER1 0x8826 -#define GL_DRAW_BUFFER2 0x8827 -#define GL_DRAW_BUFFER3 0x8828 -#define GL_DRAW_BUFFER4 0x8829 -#define GL_DRAW_BUFFER5 0x882A -#define GL_DRAW_BUFFER6 0x882B -#define GL_DRAW_BUFFER7 0x882C -#define GL_DRAW_BUFFER8 0x882D -#define GL_DRAW_BUFFER9 0x882E -#define GL_DRAW_BUFFER10 0x882F -#define GL_DRAW_BUFFER11 0x8830 -#define GL_DRAW_BUFFER12 0x8831 -#define GL_DRAW_BUFFER13 0x8832 -#define GL_DRAW_BUFFER14 0x8833 -#define GL_DRAW_BUFFER15 0x8834 -#define GL_BLEND_EQUATION_ALPHA 0x883D -#define GL_POINT_SPRITE 0x8861 -#define GL_COORD_REPLACE 0x8862 -#define GL_MAX_VERTEX_ATTRIBS 0x8869 -#define GL_VERTEX_ATTRIB_ARRAY_NORMALIZED 0x886A -#define GL_MAX_TEXTURE_COORDS 0x8871 -#define GL_MAX_TEXTURE_IMAGE_UNITS 0x8872 -#define GL_FRAGMENT_SHADER 0x8B30 -#define GL_VERTEX_SHADER 0x8B31 -#define GL_MAX_FRAGMENT_UNIFORM_COMPONENTS 0x8B49 -#define GL_MAX_VERTEX_UNIFORM_COMPONENTS 0x8B4A -#define GL_MAX_VARYING_FLOATS 0x8B4B -#define GL_MAX_VERTEX_TEXTURE_IMAGE_UNITS 0x8B4C -#define GL_MAX_COMBINED_TEXTURE_IMAGE_UNITS 0x8B4D -#define GL_SHADER_TYPE 0x8B4F -#define GL_FLOAT_VEC2 0x8B50 -#define GL_FLOAT_VEC3 0x8B51 -#define GL_FLOAT_VEC4 0x8B52 -#define GL_INT_VEC2 0x8B53 -#define GL_INT_VEC3 0x8B54 -#define GL_INT_VEC4 0x8B55 -#define GL_BOOL 0x8B56 -#define GL_BOOL_VEC2 0x8B57 -#define GL_BOOL_VEC3 0x8B58 -#define GL_BOOL_VEC4 0x8B59 -#define GL_FLOAT_MAT2 0x8B5A -#define GL_FLOAT_MAT3 0x8B5B -#define GL_FLOAT_MAT4 0x8B5C -#define GL_SAMPLER_1D 0x8B5D -#define GL_SAMPLER_2D 0x8B5E -#define GL_SAMPLER_3D 0x8B5F -#define GL_SAMPLER_CUBE 0x8B60 -#define GL_SAMPLER_1D_SHADOW 0x8B61 -#define GL_SAMPLER_2D_SHADOW 0x8B62 -#define GL_DELETE_STATUS 0x8B80 -#define GL_COMPILE_STATUS 0x8B81 -#define GL_LINK_STATUS 0x8B82 -#define GL_VALIDATE_STATUS 0x8B83 -#define GL_INFO_LOG_LENGTH 0x8B84 -#define GL_ATTACHED_SHADERS 0x8B85 -#define GL_ACTIVE_UNIFORMS 0x8B86 -#define GL_ACTIVE_UNIFORM_MAX_LENGTH 0x8B87 -#define GL_SHADER_SOURCE_LENGTH 0x8B88 -#define GL_ACTIVE_ATTRIBUTES 0x8B89 -#define GL_ACTIVE_ATTRIBUTE_MAX_LENGTH 0x8B8A -#define GL_FRAGMENT_SHADER_DERIVATIVE_HINT 0x8B8B -#define GL_SHADING_LANGUAGE_VERSION 0x8B8C -#define GL_CURRENT_PROGRAM 0x8B8D -#define GL_POINT_SPRITE_COORD_ORIGIN 0x8CA0 -#define GL_LOWER_LEFT 0x8CA1 -#define GL_UPPER_LEFT 0x8CA2 -#define GL_STENCIL_BACK_REF 0x8CA3 -#define GL_STENCIL_BACK_VALUE_MASK 0x8CA4 -#define GL_STENCIL_BACK_WRITEMASK 0x8CA5 -#endif - -#ifndef GL_VERSION_2_1 -#define GL_CURRENT_RASTER_SECONDARY_COLOR 0x845F -#define GL_PIXEL_PACK_BUFFER 0x88EB -#define GL_PIXEL_UNPACK_BUFFER 0x88EC -#define GL_PIXEL_PACK_BUFFER_BINDING 0x88ED -#define GL_PIXEL_UNPACK_BUFFER_BINDING 0x88EF -#define GL_FLOAT_MAT2x3 0x8B65 -#define GL_FLOAT_MAT2x4 0x8B66 -#define GL_FLOAT_MAT3x2 0x8B67 -#define GL_FLOAT_MAT3x4 0x8B68 -#define GL_FLOAT_MAT4x2 0x8B69 -#define GL_FLOAT_MAT4x3 0x8B6A -#define GL_SRGB 0x8C40 -#define GL_SRGB8 0x8C41 -#define GL_SRGB_ALPHA 0x8C42 -#define GL_SRGB8_ALPHA8 0x8C43 -#define GL_SLUMINANCE_ALPHA 0x8C44 -#define GL_SLUMINANCE8_ALPHA8 0x8C45 -#define GL_SLUMINANCE 0x8C46 -#define GL_SLUMINANCE8 0x8C47 -#define GL_COMPRESSED_SRGB 0x8C48 -#define GL_COMPRESSED_SRGB_ALPHA 0x8C49 -#define GL_COMPRESSED_SLUMINANCE 0x8C4A -#define GL_COMPRESSED_SLUMINANCE_ALPHA 0x8C4B -#endif - -#ifndef GL_ARB_multitexture -#define GL_TEXTURE0_ARB 0x84C0 -#define GL_TEXTURE1_ARB 0x84C1 -#define GL_TEXTURE2_ARB 0x84C2 -#define GL_TEXTURE3_ARB 0x84C3 -#define GL_TEXTURE4_ARB 0x84C4 -#define GL_TEXTURE5_ARB 0x84C5 -#define GL_TEXTURE6_ARB 0x84C6 -#define GL_TEXTURE7_ARB 0x84C7 -#define GL_TEXTURE8_ARB 0x84C8 -#define GL_TEXTURE9_ARB 0x84C9 -#define GL_TEXTURE10_ARB 0x84CA -#define GL_TEXTURE11_ARB 0x84CB -#define GL_TEXTURE12_ARB 0x84CC -#define GL_TEXTURE13_ARB 0x84CD -#define GL_TEXTURE14_ARB 0x84CE -#define GL_TEXTURE15_ARB 0x84CF -#define GL_TEXTURE16_ARB 0x84D0 -#define GL_TEXTURE17_ARB 0x84D1 -#define GL_TEXTURE18_ARB 0x84D2 -#define GL_TEXTURE19_ARB 0x84D3 -#define GL_TEXTURE20_ARB 0x84D4 -#define GL_TEXTURE21_ARB 0x84D5 -#define GL_TEXTURE22_ARB 0x84D6 -#define GL_TEXTURE23_ARB 0x84D7 -#define GL_TEXTURE24_ARB 0x84D8 -#define GL_TEXTURE25_ARB 0x84D9 -#define GL_TEXTURE26_ARB 0x84DA -#define GL_TEXTURE27_ARB 0x84DB -#define GL_TEXTURE28_ARB 0x84DC -#define GL_TEXTURE29_ARB 0x84DD -#define GL_TEXTURE30_ARB 0x84DE -#define GL_TEXTURE31_ARB 0x84DF -#define GL_ACTIVE_TEXTURE_ARB 0x84E0 -#define GL_CLIENT_ACTIVE_TEXTURE_ARB 0x84E1 -#define GL_MAX_TEXTURE_UNITS_ARB 0x84E2 -#endif - -#ifndef GL_ARB_transpose_matrix -#define GL_TRANSPOSE_MODELVIEW_MATRIX_ARB 0x84E3 -#define GL_TRANSPOSE_PROJECTION_MATRIX_ARB 0x84E4 -#define GL_TRANSPOSE_TEXTURE_MATRIX_ARB 0x84E5 -#define GL_TRANSPOSE_COLOR_MATRIX_ARB 0x84E6 -#endif - -#ifndef GL_ARB_multisample -#define GL_MULTISAMPLE_ARB 0x809D -#define GL_SAMPLE_ALPHA_TO_COVERAGE_ARB 0x809E -#define GL_SAMPLE_ALPHA_TO_ONE_ARB 0x809F -#define GL_SAMPLE_COVERAGE_ARB 0x80A0 -#define GL_SAMPLE_BUFFERS_ARB 0x80A8 -#define GL_SAMPLES_ARB 0x80A9 -#define GL_SAMPLE_COVERAGE_VALUE_ARB 0x80AA -#define GL_SAMPLE_COVERAGE_INVERT_ARB 0x80AB -#define GL_MULTISAMPLE_BIT_ARB 0x20000000 -#endif - -#ifndef GL_ARB_texture_env_add -#endif - -#ifndef GL_ARB_texture_cube_map -#define GL_NORMAL_MAP_ARB 0x8511 -#define GL_REFLECTION_MAP_ARB 0x8512 -#define GL_TEXTURE_CUBE_MAP_ARB 0x8513 -#define GL_TEXTURE_BINDING_CUBE_MAP_ARB 0x8514 -#define GL_TEXTURE_CUBE_MAP_POSITIVE_X_ARB 0x8515 -#define GL_TEXTURE_CUBE_MAP_NEGATIVE_X_ARB 0x8516 -#define GL_TEXTURE_CUBE_MAP_POSITIVE_Y_ARB 0x8517 -#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Y_ARB 0x8518 -#define GL_TEXTURE_CUBE_MAP_POSITIVE_Z_ARB 0x8519 -#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z_ARB 0x851A -#define GL_PROXY_TEXTURE_CUBE_MAP_ARB 0x851B -#define GL_MAX_CUBE_MAP_TEXTURE_SIZE_ARB 0x851C -#endif - -#ifndef GL_ARB_texture_compression -#define GL_COMPRESSED_ALPHA_ARB 0x84E9 -#define GL_COMPRESSED_LUMINANCE_ARB 0x84EA -#define GL_COMPRESSED_LUMINANCE_ALPHA_ARB 0x84EB -#define GL_COMPRESSED_INTENSITY_ARB 0x84EC -#define GL_COMPRESSED_RGB_ARB 0x84ED -#define GL_COMPRESSED_RGBA_ARB 0x84EE -#define GL_TEXTURE_COMPRESSION_HINT_ARB 0x84EF -#define GL_TEXTURE_COMPRESSED_IMAGE_SIZE_ARB 0x86A0 -#define GL_TEXTURE_COMPRESSED_ARB 0x86A1 -#define GL_NUM_COMPRESSED_TEXTURE_FORMATS_ARB 0x86A2 -#define GL_COMPRESSED_TEXTURE_FORMATS_ARB 0x86A3 -#endif - -#ifndef GL_ARB_texture_border_clamp -#define GL_CLAMP_TO_BORDER_ARB 0x812D -#endif - -#ifndef GL_ARB_point_parameters -#define GL_POINT_SIZE_MIN_ARB 0x8126 -#define GL_POINT_SIZE_MAX_ARB 0x8127 -#define GL_POINT_FADE_THRESHOLD_SIZE_ARB 0x8128 -#define GL_POINT_DISTANCE_ATTENUATION_ARB 0x8129 -#endif - -#ifndef GL_ARB_vertex_blend -#define GL_MAX_VERTEX_UNITS_ARB 0x86A4 -#define GL_ACTIVE_VERTEX_UNITS_ARB 0x86A5 -#define GL_WEIGHT_SUM_UNITY_ARB 0x86A6 -#define GL_VERTEX_BLEND_ARB 0x86A7 -#define GL_CURRENT_WEIGHT_ARB 0x86A8 -#define GL_WEIGHT_ARRAY_TYPE_ARB 0x86A9 -#define GL_WEIGHT_ARRAY_STRIDE_ARB 0x86AA -#define GL_WEIGHT_ARRAY_SIZE_ARB 0x86AB -#define GL_WEIGHT_ARRAY_POINTER_ARB 0x86AC -#define GL_WEIGHT_ARRAY_ARB 0x86AD -#define GL_MODELVIEW0_ARB 0x1700 -#define GL_MODELVIEW1_ARB 0x850A -#define GL_MODELVIEW2_ARB 0x8722 -#define GL_MODELVIEW3_ARB 0x8723 -#define GL_MODELVIEW4_ARB 0x8724 -#define GL_MODELVIEW5_ARB 0x8725 -#define GL_MODELVIEW6_ARB 0x8726 -#define GL_MODELVIEW7_ARB 0x8727 -#define GL_MODELVIEW8_ARB 0x8728 -#define GL_MODELVIEW9_ARB 0x8729 -#define GL_MODELVIEW10_ARB 0x872A -#define GL_MODELVIEW11_ARB 0x872B -#define GL_MODELVIEW12_ARB 0x872C -#define GL_MODELVIEW13_ARB 0x872D -#define GL_MODELVIEW14_ARB 0x872E -#define GL_MODELVIEW15_ARB 0x872F -#define GL_MODELVIEW16_ARB 0x8730 -#define GL_MODELVIEW17_ARB 0x8731 -#define GL_MODELVIEW18_ARB 0x8732 -#define GL_MODELVIEW19_ARB 0x8733 -#define GL_MODELVIEW20_ARB 0x8734 -#define GL_MODELVIEW21_ARB 0x8735 -#define GL_MODELVIEW22_ARB 0x8736 -#define GL_MODELVIEW23_ARB 0x8737 -#define GL_MODELVIEW24_ARB 0x8738 -#define GL_MODELVIEW25_ARB 0x8739 -#define GL_MODELVIEW26_ARB 0x873A -#define GL_MODELVIEW27_ARB 0x873B -#define GL_MODELVIEW28_ARB 0x873C -#define GL_MODELVIEW29_ARB 0x873D -#define GL_MODELVIEW30_ARB 0x873E -#define GL_MODELVIEW31_ARB 0x873F -#endif - -#ifndef GL_ARB_matrix_palette -#define GL_MATRIX_PALETTE_ARB 0x8840 -#define GL_MAX_MATRIX_PALETTE_STACK_DEPTH_ARB 0x8841 -#define GL_MAX_PALETTE_MATRICES_ARB 0x8842 -#define GL_CURRENT_PALETTE_MATRIX_ARB 0x8843 -#define GL_MATRIX_INDEX_ARRAY_ARB 0x8844 -#define GL_CURRENT_MATRIX_INDEX_ARB 0x8845 -#define GL_MATRIX_INDEX_ARRAY_SIZE_ARB 0x8846 -#define GL_MATRIX_INDEX_ARRAY_TYPE_ARB 0x8847 -#define GL_MATRIX_INDEX_ARRAY_STRIDE_ARB 0x8848 -#define GL_MATRIX_INDEX_ARRAY_POINTER_ARB 0x8849 -#endif - -#ifndef GL_ARB_texture_env_combine -#define GL_COMBINE_ARB 0x8570 -#define GL_COMBINE_RGB_ARB 0x8571 -#define GL_COMBINE_ALPHA_ARB 0x8572 -#define GL_SOURCE0_RGB_ARB 0x8580 -#define GL_SOURCE1_RGB_ARB 0x8581 -#define GL_SOURCE2_RGB_ARB 0x8582 -#define GL_SOURCE0_ALPHA_ARB 0x8588 -#define GL_SOURCE1_ALPHA_ARB 0x8589 -#define GL_SOURCE2_ALPHA_ARB 0x858A -#define GL_OPERAND0_RGB_ARB 0x8590 -#define GL_OPERAND1_RGB_ARB 0x8591 -#define GL_OPERAND2_RGB_ARB 0x8592 -#define GL_OPERAND0_ALPHA_ARB 0x8598 -#define GL_OPERAND1_ALPHA_ARB 0x8599 -#define GL_OPERAND2_ALPHA_ARB 0x859A -#define GL_RGB_SCALE_ARB 0x8573 -#define GL_ADD_SIGNED_ARB 0x8574 -#define GL_INTERPOLATE_ARB 0x8575 -#define GL_SUBTRACT_ARB 0x84E7 -#define GL_CONSTANT_ARB 0x8576 -#define GL_PRIMARY_COLOR_ARB 0x8577 -#define GL_PREVIOUS_ARB 0x8578 -#endif - -#ifndef GL_ARB_texture_env_crossbar -#endif - -#ifndef GL_ARB_texture_env_dot3 -#define GL_DOT3_RGB_ARB 0x86AE -#define GL_DOT3_RGBA_ARB 0x86AF -#endif - -#ifndef GL_ARB_texture_mirrored_repeat -#define GL_MIRRORED_REPEAT_ARB 0x8370 -#endif - -#ifndef GL_ARB_depth_texture -#define GL_DEPTH_COMPONENT16_ARB 0x81A5 -#define GL_DEPTH_COMPONENT24_ARB 0x81A6 -#define GL_DEPTH_COMPONENT32_ARB 0x81A7 -#define GL_TEXTURE_DEPTH_SIZE_ARB 0x884A -#define GL_DEPTH_TEXTURE_MODE_ARB 0x884B -#endif - -#ifndef GL_ARB_shadow -#define GL_TEXTURE_COMPARE_MODE_ARB 0x884C -#define GL_TEXTURE_COMPARE_FUNC_ARB 0x884D -#define GL_COMPARE_R_TO_TEXTURE_ARB 0x884E -#endif - -#ifndef GL_ARB_shadow_ambient -#define GL_TEXTURE_COMPARE_FAIL_VALUE_ARB 0x80BF -#endif - -#ifndef GL_ARB_window_pos -#endif - -#ifndef GL_ARB_vertex_program -#define GL_COLOR_SUM_ARB 0x8458 -#define GL_VERTEX_PROGRAM_ARB 0x8620 -#define GL_VERTEX_ATTRIB_ARRAY_ENABLED_ARB 0x8622 -#define GL_VERTEX_ATTRIB_ARRAY_SIZE_ARB 0x8623 -#define GL_VERTEX_ATTRIB_ARRAY_STRIDE_ARB 0x8624 -#define GL_VERTEX_ATTRIB_ARRAY_TYPE_ARB 0x8625 -#define GL_CURRENT_VERTEX_ATTRIB_ARB 0x8626 -#define GL_PROGRAM_LENGTH_ARB 0x8627 -#define GL_PROGRAM_STRING_ARB 0x8628 -#define GL_MAX_PROGRAM_MATRIX_STACK_DEPTH_ARB 0x862E -#define GL_MAX_PROGRAM_MATRICES_ARB 0x862F -#define GL_CURRENT_MATRIX_STACK_DEPTH_ARB 0x8640 -#define GL_CURRENT_MATRIX_ARB 0x8641 -#define GL_VERTEX_PROGRAM_POINT_SIZE_ARB 0x8642 -#define GL_VERTEX_PROGRAM_TWO_SIDE_ARB 0x8643 -#define GL_VERTEX_ATTRIB_ARRAY_POINTER_ARB 0x8645 -#define GL_PROGRAM_ERROR_POSITION_ARB 0x864B -#define GL_PROGRAM_BINDING_ARB 0x8677 -#define GL_MAX_VERTEX_ATTRIBS_ARB 0x8869 -#define GL_VERTEX_ATTRIB_ARRAY_NORMALIZED_ARB 0x886A -#define GL_PROGRAM_ERROR_STRING_ARB 0x8874 -#define GL_PROGRAM_FORMAT_ASCII_ARB 0x8875 -#define GL_PROGRAM_FORMAT_ARB 0x8876 -#define GL_PROGRAM_INSTRUCTIONS_ARB 0x88A0 -#define GL_MAX_PROGRAM_INSTRUCTIONS_ARB 0x88A1 -#define GL_PROGRAM_NATIVE_INSTRUCTIONS_ARB 0x88A2 -#define GL_MAX_PROGRAM_NATIVE_INSTRUCTIONS_ARB 0x88A3 -#define GL_PROGRAM_TEMPORARIES_ARB 0x88A4 -#define GL_MAX_PROGRAM_TEMPORARIES_ARB 0x88A5 -#define GL_PROGRAM_NATIVE_TEMPORARIES_ARB 0x88A6 -#define GL_MAX_PROGRAM_NATIVE_TEMPORARIES_ARB 0x88A7 -#define GL_PROGRAM_PARAMETERS_ARB 0x88A8 -#define GL_MAX_PROGRAM_PARAMETERS_ARB 0x88A9 -#define GL_PROGRAM_NATIVE_PARAMETERS_ARB 0x88AA -#define GL_MAX_PROGRAM_NATIVE_PARAMETERS_ARB 0x88AB -#define GL_PROGRAM_ATTRIBS_ARB 0x88AC -#define GL_MAX_PROGRAM_ATTRIBS_ARB 0x88AD -#define GL_PROGRAM_NATIVE_ATTRIBS_ARB 0x88AE -#define GL_MAX_PROGRAM_NATIVE_ATTRIBS_ARB 0x88AF -#define GL_PROGRAM_ADDRESS_REGISTERS_ARB 0x88B0 -#define GL_MAX_PROGRAM_ADDRESS_REGISTERS_ARB 0x88B1 -#define GL_PROGRAM_NATIVE_ADDRESS_REGISTERS_ARB 0x88B2 -#define GL_MAX_PROGRAM_NATIVE_ADDRESS_REGISTERS_ARB 0x88B3 -#define GL_MAX_PROGRAM_LOCAL_PARAMETERS_ARB 0x88B4 -#define GL_MAX_PROGRAM_ENV_PARAMETERS_ARB 0x88B5 -#define GL_PROGRAM_UNDER_NATIVE_LIMITS_ARB 0x88B6 -#define GL_TRANSPOSE_CURRENT_MATRIX_ARB 0x88B7 -#define GL_MATRIX0_ARB 0x88C0 -#define GL_MATRIX1_ARB 0x88C1 -#define GL_MATRIX2_ARB 0x88C2 -#define GL_MATRIX3_ARB 0x88C3 -#define GL_MATRIX4_ARB 0x88C4 -#define GL_MATRIX5_ARB 0x88C5 -#define GL_MATRIX6_ARB 0x88C6 -#define GL_MATRIX7_ARB 0x88C7 -#define GL_MATRIX8_ARB 0x88C8 -#define GL_MATRIX9_ARB 0x88C9 -#define GL_MATRIX10_ARB 0x88CA -#define GL_MATRIX11_ARB 0x88CB -#define GL_MATRIX12_ARB 0x88CC -#define GL_MATRIX13_ARB 0x88CD -#define GL_MATRIX14_ARB 0x88CE -#define GL_MATRIX15_ARB 0x88CF -#define GL_MATRIX16_ARB 0x88D0 -#define GL_MATRIX17_ARB 0x88D1 -#define GL_MATRIX18_ARB 0x88D2 -#define GL_MATRIX19_ARB 0x88D3 -#define GL_MATRIX20_ARB 0x88D4 -#define GL_MATRIX21_ARB 0x88D5 -#define GL_MATRIX22_ARB 0x88D6 -#define GL_MATRIX23_ARB 0x88D7 -#define GL_MATRIX24_ARB 0x88D8 -#define GL_MATRIX25_ARB 0x88D9 -#define GL_MATRIX26_ARB 0x88DA -#define GL_MATRIX27_ARB 0x88DB -#define GL_MATRIX28_ARB 0x88DC -#define GL_MATRIX29_ARB 0x88DD -#define GL_MATRIX30_ARB 0x88DE -#define GL_MATRIX31_ARB 0x88DF -#endif - -#ifndef GL_ARB_fragment_program -#define GL_FRAGMENT_PROGRAM_ARB 0x8804 -#define GL_PROGRAM_ALU_INSTRUCTIONS_ARB 0x8805 -#define GL_PROGRAM_TEX_INSTRUCTIONS_ARB 0x8806 -#define GL_PROGRAM_TEX_INDIRECTIONS_ARB 0x8807 -#define GL_PROGRAM_NATIVE_ALU_INSTRUCTIONS_ARB 0x8808 -#define GL_PROGRAM_NATIVE_TEX_INSTRUCTIONS_ARB 0x8809 -#define GL_PROGRAM_NATIVE_TEX_INDIRECTIONS_ARB 0x880A -#define GL_MAX_PROGRAM_ALU_INSTRUCTIONS_ARB 0x880B -#define GL_MAX_PROGRAM_TEX_INSTRUCTIONS_ARB 0x880C -#define GL_MAX_PROGRAM_TEX_INDIRECTIONS_ARB 0x880D -#define GL_MAX_PROGRAM_NATIVE_ALU_INSTRUCTIONS_ARB 0x880E -#define GL_MAX_PROGRAM_NATIVE_TEX_INSTRUCTIONS_ARB 0x880F -#define GL_MAX_PROGRAM_NATIVE_TEX_INDIRECTIONS_ARB 0x8810 -#define GL_MAX_TEXTURE_COORDS_ARB 0x8871 -#define GL_MAX_TEXTURE_IMAGE_UNITS_ARB 0x8872 -#endif - -#ifndef GL_ARB_vertex_buffer_object -#define GL_BUFFER_SIZE_ARB 0x8764 -#define GL_BUFFER_USAGE_ARB 0x8765 -#define GL_ARRAY_BUFFER_ARB 0x8892 -#define GL_ELEMENT_ARRAY_BUFFER_ARB 0x8893 -#define GL_ARRAY_BUFFER_BINDING_ARB 0x8894 -#define GL_ELEMENT_ARRAY_BUFFER_BINDING_ARB 0x8895 -#define GL_VERTEX_ARRAY_BUFFER_BINDING_ARB 0x8896 -#define GL_NORMAL_ARRAY_BUFFER_BINDING_ARB 0x8897 -#define GL_COLOR_ARRAY_BUFFER_BINDING_ARB 0x8898 -#define GL_INDEX_ARRAY_BUFFER_BINDING_ARB 0x8899 -#define GL_TEXTURE_COORD_ARRAY_BUFFER_BINDING_ARB 0x889A -#define GL_EDGE_FLAG_ARRAY_BUFFER_BINDING_ARB 0x889B -#define GL_SECONDARY_COLOR_ARRAY_BUFFER_BINDING_ARB 0x889C -#define GL_FOG_COORDINATE_ARRAY_BUFFER_BINDING_ARB 0x889D -#define GL_WEIGHT_ARRAY_BUFFER_BINDING_ARB 0x889E -#define GL_VERTEX_ATTRIB_ARRAY_BUFFER_BINDING_ARB 0x889F -#define GL_READ_ONLY_ARB 0x88B8 -#define GL_WRITE_ONLY_ARB 0x88B9 -#define GL_READ_WRITE_ARB 0x88BA -#define GL_BUFFER_ACCESS_ARB 0x88BB -#define GL_BUFFER_MAPPED_ARB 0x88BC -#define GL_BUFFER_MAP_POINTER_ARB 0x88BD -#define GL_STREAM_DRAW_ARB 0x88E0 -#define GL_STREAM_READ_ARB 0x88E1 -#define GL_STREAM_COPY_ARB 0x88E2 -#define GL_STATIC_DRAW_ARB 0x88E4 -#define GL_STATIC_READ_ARB 0x88E5 -#define GL_STATIC_COPY_ARB 0x88E6 -#define GL_DYNAMIC_DRAW_ARB 0x88E8 -#define GL_DYNAMIC_READ_ARB 0x88E9 -#define GL_DYNAMIC_COPY_ARB 0x88EA -#endif - -#ifndef GL_ARB_occlusion_query -#define GL_QUERY_COUNTER_BITS_ARB 0x8864 -#define GL_CURRENT_QUERY_ARB 0x8865 -#define GL_QUERY_RESULT_ARB 0x8866 -#define GL_QUERY_RESULT_AVAILABLE_ARB 0x8867 -#define GL_SAMPLES_PASSED_ARB 0x8914 -#endif - -#ifndef GL_ARB_shader_objects -#define GL_PROGRAM_OBJECT_ARB 0x8B40 -#define GL_SHADER_OBJECT_ARB 0x8B48 -#define GL_OBJECT_TYPE_ARB 0x8B4E -#define GL_OBJECT_SUBTYPE_ARB 0x8B4F -#define GL_FLOAT_VEC2_ARB 0x8B50 -#define GL_FLOAT_VEC3_ARB 0x8B51 -#define GL_FLOAT_VEC4_ARB 0x8B52 -#define GL_INT_VEC2_ARB 0x8B53 -#define GL_INT_VEC3_ARB 0x8B54 -#define GL_INT_VEC4_ARB 0x8B55 -#define GL_BOOL_ARB 0x8B56 -#define GL_BOOL_VEC2_ARB 0x8B57 -#define GL_BOOL_VEC3_ARB 0x8B58 -#define GL_BOOL_VEC4_ARB 0x8B59 -#define GL_FLOAT_MAT2_ARB 0x8B5A -#define GL_FLOAT_MAT3_ARB 0x8B5B -#define GL_FLOAT_MAT4_ARB 0x8B5C -#define GL_SAMPLER_1D_ARB 0x8B5D -#define GL_SAMPLER_2D_ARB 0x8B5E -#define GL_SAMPLER_3D_ARB 0x8B5F -#define GL_SAMPLER_CUBE_ARB 0x8B60 -#define GL_SAMPLER_1D_SHADOW_ARB 0x8B61 -#define GL_SAMPLER_2D_SHADOW_ARB 0x8B62 -#define GL_SAMPLER_2D_RECT_ARB 0x8B63 -#define GL_SAMPLER_2D_RECT_SHADOW_ARB 0x8B64 -#define GL_OBJECT_DELETE_STATUS_ARB 0x8B80 -#define GL_OBJECT_COMPILE_STATUS_ARB 0x8B81 -#define GL_OBJECT_LINK_STATUS_ARB 0x8B82 -#define GL_OBJECT_VALIDATE_STATUS_ARB 0x8B83 -#define GL_OBJECT_INFO_LOG_LENGTH_ARB 0x8B84 -#define GL_OBJECT_ATTACHED_OBJECTS_ARB 0x8B85 -#define GL_OBJECT_ACTIVE_UNIFORMS_ARB 0x8B86 -#define GL_OBJECT_ACTIVE_UNIFORM_MAX_LENGTH_ARB 0x8B87 -#define GL_OBJECT_SHADER_SOURCE_LENGTH_ARB 0x8B88 -#endif - -#ifndef GL_ARB_vertex_shader -#define GL_VERTEX_SHADER_ARB 0x8B31 -#define GL_MAX_VERTEX_UNIFORM_COMPONENTS_ARB 0x8B4A -#define GL_MAX_VARYING_FLOATS_ARB 0x8B4B -#define GL_MAX_VERTEX_TEXTURE_IMAGE_UNITS_ARB 0x8B4C -#define GL_MAX_COMBINED_TEXTURE_IMAGE_UNITS_ARB 0x8B4D -#define GL_OBJECT_ACTIVE_ATTRIBUTES_ARB 0x8B89 -#define GL_OBJECT_ACTIVE_ATTRIBUTE_MAX_LENGTH_ARB 0x8B8A -#endif - -#ifndef GL_ARB_fragment_shader -#define GL_FRAGMENT_SHADER_ARB 0x8B30 -#define GL_MAX_FRAGMENT_UNIFORM_COMPONENTS_ARB 0x8B49 -#define GL_FRAGMENT_SHADER_DERIVATIVE_HINT_ARB 0x8B8B -#endif - -#ifndef GL_ARB_shading_language_100 -#define GL_SHADING_LANGUAGE_VERSION_ARB 0x8B8C -#endif - -#ifndef GL_ARB_texture_non_power_of_two -#endif - -#ifndef GL_ARB_point_sprite -#define GL_POINT_SPRITE_ARB 0x8861 -#define GL_COORD_REPLACE_ARB 0x8862 -#endif - -#ifndef GL_ARB_fragment_program_shadow -#endif - -#ifndef GL_ARB_draw_buffers -#define GL_MAX_DRAW_BUFFERS_ARB 0x8824 -#define GL_DRAW_BUFFER0_ARB 0x8825 -#define GL_DRAW_BUFFER1_ARB 0x8826 -#define GL_DRAW_BUFFER2_ARB 0x8827 -#define GL_DRAW_BUFFER3_ARB 0x8828 -#define GL_DRAW_BUFFER4_ARB 0x8829 -#define GL_DRAW_BUFFER5_ARB 0x882A -#define GL_DRAW_BUFFER6_ARB 0x882B -#define GL_DRAW_BUFFER7_ARB 0x882C -#define GL_DRAW_BUFFER8_ARB 0x882D -#define GL_DRAW_BUFFER9_ARB 0x882E -#define GL_DRAW_BUFFER10_ARB 0x882F -#define GL_DRAW_BUFFER11_ARB 0x8830 -#define GL_DRAW_BUFFER12_ARB 0x8831 -#define GL_DRAW_BUFFER13_ARB 0x8832 -#define GL_DRAW_BUFFER14_ARB 0x8833 -#define GL_DRAW_BUFFER15_ARB 0x8834 -#endif - -#ifndef GL_ARB_texture_rectangle -#define GL_TEXTURE_RECTANGLE_ARB 0x84F5 -#define GL_TEXTURE_BINDING_RECTANGLE_ARB 0x84F6 -#define GL_PROXY_TEXTURE_RECTANGLE_ARB 0x84F7 -#define GL_MAX_RECTANGLE_TEXTURE_SIZE_ARB 0x84F8 -#endif - -#ifndef GL_ARB_color_buffer_float -#define GL_RGBA_FLOAT_MODE_ARB 0x8820 -#define GL_CLAMP_VERTEX_COLOR_ARB 0x891A -#define GL_CLAMP_FRAGMENT_COLOR_ARB 0x891B -#define GL_CLAMP_READ_COLOR_ARB 0x891C -#define GL_FIXED_ONLY_ARB 0x891D -#endif - -#ifndef GL_ARB_half_float_pixel -#define GL_HALF_FLOAT_ARB 0x140B -#endif - -#ifndef GL_ARB_texture_float -#define GL_TEXTURE_RED_TYPE_ARB 0x8C10 -#define GL_TEXTURE_GREEN_TYPE_ARB 0x8C11 -#define GL_TEXTURE_BLUE_TYPE_ARB 0x8C12 -#define GL_TEXTURE_ALPHA_TYPE_ARB 0x8C13 -#define GL_TEXTURE_LUMINANCE_TYPE_ARB 0x8C14 -#define GL_TEXTURE_INTENSITY_TYPE_ARB 0x8C15 -#define GL_TEXTURE_DEPTH_TYPE_ARB 0x8C16 -#define GL_UNSIGNED_NORMALIZED_ARB 0x8C17 -#define GL_RGBA32F_ARB 0x8814 -#define GL_RGB32F_ARB 0x8815 -#define GL_ALPHA32F_ARB 0x8816 -#define GL_INTENSITY32F_ARB 0x8817 -#define GL_LUMINANCE32F_ARB 0x8818 -#define GL_LUMINANCE_ALPHA32F_ARB 0x8819 -#define GL_RGBA16F_ARB 0x881A -#define GL_RGB16F_ARB 0x881B -#define GL_ALPHA16F_ARB 0x881C -#define GL_INTENSITY16F_ARB 0x881D -#define GL_LUMINANCE16F_ARB 0x881E -#define GL_LUMINANCE_ALPHA16F_ARB 0x881F -#endif - -#ifndef GL_ARB_pixel_buffer_object -#define GL_PIXEL_PACK_BUFFER_ARB 0x88EB -#define GL_PIXEL_UNPACK_BUFFER_ARB 0x88EC -#define GL_PIXEL_PACK_BUFFER_BINDING_ARB 0x88ED -#define GL_PIXEL_UNPACK_BUFFER_BINDING_ARB 0x88EF -#endif - -#ifndef GL_EXT_abgr -#define GL_ABGR_EXT 0x8000 -#endif - -#ifndef GL_EXT_blend_color -#define GL_CONSTANT_COLOR_EXT 0x8001 -#define GL_ONE_MINUS_CONSTANT_COLOR_EXT 0x8002 -#define GL_CONSTANT_ALPHA_EXT 0x8003 -#define GL_ONE_MINUS_CONSTANT_ALPHA_EXT 0x8004 -#define GL_BLEND_COLOR_EXT 0x8005 -#endif - -#ifndef GL_EXT_polygon_offset -#define GL_POLYGON_OFFSET_EXT 0x8037 -#define GL_POLYGON_OFFSET_FACTOR_EXT 0x8038 -#define GL_POLYGON_OFFSET_BIAS_EXT 0x8039 -#endif - -#ifndef GL_EXT_texture -#define GL_ALPHA4_EXT 0x803B -#define GL_ALPHA8_EXT 0x803C -#define GL_ALPHA12_EXT 0x803D -#define GL_ALPHA16_EXT 0x803E -#define GL_LUMINANCE4_EXT 0x803F -#define GL_LUMINANCE8_EXT 0x8040 -#define GL_LUMINANCE12_EXT 0x8041 -#define GL_LUMINANCE16_EXT 0x8042 -#define GL_LUMINANCE4_ALPHA4_EXT 0x8043 -#define GL_LUMINANCE6_ALPHA2_EXT 0x8044 -#define GL_LUMINANCE8_ALPHA8_EXT 0x8045 -#define GL_LUMINANCE12_ALPHA4_EXT 0x8046 -#define GL_LUMINANCE12_ALPHA12_EXT 0x8047 -#define GL_LUMINANCE16_ALPHA16_EXT 0x8048 -#define GL_INTENSITY_EXT 0x8049 -#define GL_INTENSITY4_EXT 0x804A -#define GL_INTENSITY8_EXT 0x804B -#define GL_INTENSITY12_EXT 0x804C -#define GL_INTENSITY16_EXT 0x804D -#define GL_RGB2_EXT 0x804E -#define GL_RGB4_EXT 0x804F -#define GL_RGB5_EXT 0x8050 -#define GL_RGB8_EXT 0x8051 -#define GL_RGB10_EXT 0x8052 -#define GL_RGB12_EXT 0x8053 -#define GL_RGB16_EXT 0x8054 -#define GL_RGBA2_EXT 0x8055 -#define GL_RGBA4_EXT 0x8056 -#define GL_RGB5_A1_EXT 0x8057 -#define GL_RGBA8_EXT 0x8058 -#define GL_RGB10_A2_EXT 0x8059 -#define GL_RGBA12_EXT 0x805A -#define GL_RGBA16_EXT 0x805B -#define GL_TEXTURE_RED_SIZE_EXT 0x805C -#define GL_TEXTURE_GREEN_SIZE_EXT 0x805D -#define GL_TEXTURE_BLUE_SIZE_EXT 0x805E -#define GL_TEXTURE_ALPHA_SIZE_EXT 0x805F -#define GL_TEXTURE_LUMINANCE_SIZE_EXT 0x8060 -#define GL_TEXTURE_INTENSITY_SIZE_EXT 0x8061 -#define GL_REPLACE_EXT 0x8062 -#define GL_PROXY_TEXTURE_1D_EXT 0x8063 -#define GL_PROXY_TEXTURE_2D_EXT 0x8064 -#define GL_TEXTURE_TOO_LARGE_EXT 0x8065 -#endif - -#ifndef GL_EXT_texture3D -#define GL_PACK_SKIP_IMAGES_EXT 0x806B -#define GL_PACK_IMAGE_HEIGHT_EXT 0x806C -#define GL_UNPACK_SKIP_IMAGES_EXT 0x806D -#define GL_UNPACK_IMAGE_HEIGHT_EXT 0x806E -#define GL_TEXTURE_3D_EXT 0x806F -#define GL_PROXY_TEXTURE_3D_EXT 0x8070 -#define GL_TEXTURE_DEPTH_EXT 0x8071 -#define GL_TEXTURE_WRAP_R_EXT 0x8072 -#define GL_MAX_3D_TEXTURE_SIZE_EXT 0x8073 -#endif - -#ifndef GL_SGIS_texture_filter4 -#define GL_FILTER4_SGIS 0x8146 -#define GL_TEXTURE_FILTER4_SIZE_SGIS 0x8147 -#endif - -#ifndef GL_EXT_subtexture -#endif - -#ifndef GL_EXT_copy_texture -#endif - -#ifndef GL_EXT_histogram -#define GL_HISTOGRAM_EXT 0x8024 -#define GL_PROXY_HISTOGRAM_EXT 0x8025 -#define GL_HISTOGRAM_WIDTH_EXT 0x8026 -#define GL_HISTOGRAM_FORMAT_EXT 0x8027 -#define GL_HISTOGRAM_RED_SIZE_EXT 0x8028 -#define GL_HISTOGRAM_GREEN_SIZE_EXT 0x8029 -#define GL_HISTOGRAM_BLUE_SIZE_EXT 0x802A -#define GL_HISTOGRAM_ALPHA_SIZE_EXT 0x802B -#define GL_HISTOGRAM_LUMINANCE_SIZE_EXT 0x802C -#define GL_HISTOGRAM_SINK_EXT 0x802D -#define GL_MINMAX_EXT 0x802E -#define GL_MINMAX_FORMAT_EXT 0x802F -#define GL_MINMAX_SINK_EXT 0x8030 -#define GL_TABLE_TOO_LARGE_EXT 0x8031 -#endif - -#ifndef GL_EXT_convolution -#define GL_CONVOLUTION_1D_EXT 0x8010 -#define GL_CONVOLUTION_2D_EXT 0x8011 -#define GL_SEPARABLE_2D_EXT 0x8012 -#define GL_CONVOLUTION_BORDER_MODE_EXT 0x8013 -#define GL_CONVOLUTION_FILTER_SCALE_EXT 0x8014 -#define GL_CONVOLUTION_FILTER_BIAS_EXT 0x8015 -#define GL_REDUCE_EXT 0x8016 -#define GL_CONVOLUTION_FORMAT_EXT 0x8017 -#define GL_CONVOLUTION_WIDTH_EXT 0x8018 -#define GL_CONVOLUTION_HEIGHT_EXT 0x8019 -#define GL_MAX_CONVOLUTION_WIDTH_EXT 0x801A -#define GL_MAX_CONVOLUTION_HEIGHT_EXT 0x801B -#define GL_POST_CONVOLUTION_RED_SCALE_EXT 0x801C -#define GL_POST_CONVOLUTION_GREEN_SCALE_EXT 0x801D -#define GL_POST_CONVOLUTION_BLUE_SCALE_EXT 0x801E -#define GL_POST_CONVOLUTION_ALPHA_SCALE_EXT 0x801F -#define GL_POST_CONVOLUTION_RED_BIAS_EXT 0x8020 -#define GL_POST_CONVOLUTION_GREEN_BIAS_EXT 0x8021 -#define GL_POST_CONVOLUTION_BLUE_BIAS_EXT 0x8022 -#define GL_POST_CONVOLUTION_ALPHA_BIAS_EXT 0x8023 -#endif - -#ifndef GL_SGI_color_matrix -#define GL_COLOR_MATRIX_SGI 0x80B1 -#define GL_COLOR_MATRIX_STACK_DEPTH_SGI 0x80B2 -#define GL_MAX_COLOR_MATRIX_STACK_DEPTH_SGI 0x80B3 -#define GL_POST_COLOR_MATRIX_RED_SCALE_SGI 0x80B4 -#define GL_POST_COLOR_MATRIX_GREEN_SCALE_SGI 0x80B5 -#define GL_POST_COLOR_MATRIX_BLUE_SCALE_SGI 0x80B6 -#define GL_POST_COLOR_MATRIX_ALPHA_SCALE_SGI 0x80B7 -#define GL_POST_COLOR_MATRIX_RED_BIAS_SGI 0x80B8 -#define GL_POST_COLOR_MATRIX_GREEN_BIAS_SGI 0x80B9 -#define GL_POST_COLOR_MATRIX_BLUE_BIAS_SGI 0x80BA -#define GL_POST_COLOR_MATRIX_ALPHA_BIAS_SGI 0x80BB -#endif - -#ifndef GL_SGI_color_table -#define GL_COLOR_TABLE_SGI 0x80D0 -#define GL_POST_CONVOLUTION_COLOR_TABLE_SGI 0x80D1 -#define GL_POST_COLOR_MATRIX_COLOR_TABLE_SGI 0x80D2 -#define GL_PROXY_COLOR_TABLE_SGI 0x80D3 -#define GL_PROXY_POST_CONVOLUTION_COLOR_TABLE_SGI 0x80D4 -#define GL_PROXY_POST_COLOR_MATRIX_COLOR_TABLE_SGI 0x80D5 -#define GL_COLOR_TABLE_SCALE_SGI 0x80D6 -#define GL_COLOR_TABLE_BIAS_SGI 0x80D7 -#define GL_COLOR_TABLE_FORMAT_SGI 0x80D8 -#define GL_COLOR_TABLE_WIDTH_SGI 0x80D9 -#define GL_COLOR_TABLE_RED_SIZE_SGI 0x80DA -#define GL_COLOR_TABLE_GREEN_SIZE_SGI 0x80DB -#define GL_COLOR_TABLE_BLUE_SIZE_SGI 0x80DC -#define GL_COLOR_TABLE_ALPHA_SIZE_SGI 0x80DD -#define GL_COLOR_TABLE_LUMINANCE_SIZE_SGI 0x80DE -#define GL_COLOR_TABLE_INTENSITY_SIZE_SGI 0x80DF -#endif - -#ifndef GL_SGIS_pixel_texture -#define GL_PIXEL_TEXTURE_SGIS 0x8353 -#define GL_PIXEL_FRAGMENT_RGB_SOURCE_SGIS 0x8354 -#define GL_PIXEL_FRAGMENT_ALPHA_SOURCE_SGIS 0x8355 -#define GL_PIXEL_GROUP_COLOR_SGIS 0x8356 -#endif - -#ifndef GL_SGIX_pixel_texture -#define GL_PIXEL_TEX_GEN_SGIX 0x8139 -#define GL_PIXEL_TEX_GEN_MODE_SGIX 0x832B -#endif - -#ifndef GL_SGIS_texture4D -#define GL_PACK_SKIP_VOLUMES_SGIS 0x8130 -#define GL_PACK_IMAGE_DEPTH_SGIS 0x8131 -#define GL_UNPACK_SKIP_VOLUMES_SGIS 0x8132 -#define GL_UNPACK_IMAGE_DEPTH_SGIS 0x8133 -#define GL_TEXTURE_4D_SGIS 0x8134 -#define GL_PROXY_TEXTURE_4D_SGIS 0x8135 -#define GL_TEXTURE_4DSIZE_SGIS 0x8136 -#define GL_TEXTURE_WRAP_Q_SGIS 0x8137 -#define GL_MAX_4D_TEXTURE_SIZE_SGIS 0x8138 -#define GL_TEXTURE_4D_BINDING_SGIS 0x814F -#endif - -#ifndef GL_SGI_texture_color_table -#define GL_TEXTURE_COLOR_TABLE_SGI 0x80BC -#define GL_PROXY_TEXTURE_COLOR_TABLE_SGI 0x80BD -#endif - -#ifndef GL_EXT_cmyka -#define GL_CMYK_EXT 0x800C -#define GL_CMYKA_EXT 0x800D -#define GL_PACK_CMYK_HINT_EXT 0x800E -#define GL_UNPACK_CMYK_HINT_EXT 0x800F -#endif - -#ifndef GL_EXT_texture_object -#define GL_TEXTURE_PRIORITY_EXT 0x8066 -#define GL_TEXTURE_RESIDENT_EXT 0x8067 -#define GL_TEXTURE_1D_BINDING_EXT 0x8068 -#define GL_TEXTURE_2D_BINDING_EXT 0x8069 -#define GL_TEXTURE_3D_BINDING_EXT 0x806A -#endif - -#ifndef GL_SGIS_detail_texture -#define GL_DETAIL_TEXTURE_2D_SGIS 0x8095 -#define GL_DETAIL_TEXTURE_2D_BINDING_SGIS 0x8096 -#define GL_LINEAR_DETAIL_SGIS 0x8097 -#define GL_LINEAR_DETAIL_ALPHA_SGIS 0x8098 -#define GL_LINEAR_DETAIL_COLOR_SGIS 0x8099 -#define GL_DETAIL_TEXTURE_LEVEL_SGIS 0x809A -#define GL_DETAIL_TEXTURE_MODE_SGIS 0x809B -#define GL_DETAIL_TEXTURE_FUNC_POINTS_SGIS 0x809C -#endif - -#ifndef GL_SGIS_sharpen_texture -#define GL_LINEAR_SHARPEN_SGIS 0x80AD -#define GL_LINEAR_SHARPEN_ALPHA_SGIS 0x80AE -#define GL_LINEAR_SHARPEN_COLOR_SGIS 0x80AF -#define GL_SHARPEN_TEXTURE_FUNC_POINTS_SGIS 0x80B0 -#endif - -#ifndef GL_EXT_packed_pixels -#define GL_UNSIGNED_BYTE_3_3_2_EXT 0x8032 -#define GL_UNSIGNED_SHORT_4_4_4_4_EXT 0x8033 -#define GL_UNSIGNED_SHORT_5_5_5_1_EXT 0x8034 -#define GL_UNSIGNED_INT_8_8_8_8_EXT 0x8035 -#define GL_UNSIGNED_INT_10_10_10_2_EXT 0x8036 -#endif - -#ifndef GL_SGIS_texture_lod -#define GL_TEXTURE_MIN_LOD_SGIS 0x813A -#define GL_TEXTURE_MAX_LOD_SGIS 0x813B -#define GL_TEXTURE_BASE_LEVEL_SGIS 0x813C -#define GL_TEXTURE_MAX_LEVEL_SGIS 0x813D -#endif - -#ifndef GL_SGIS_multisample -#define GL_MULTISAMPLE_SGIS 0x809D -#define GL_SAMPLE_ALPHA_TO_MASK_SGIS 0x809E -#define GL_SAMPLE_ALPHA_TO_ONE_SGIS 0x809F -#define GL_SAMPLE_MASK_SGIS 0x80A0 -#define GL_1PASS_SGIS 0x80A1 -#define GL_2PASS_0_SGIS 0x80A2 -#define GL_2PASS_1_SGIS 0x80A3 -#define GL_4PASS_0_SGIS 0x80A4 -#define GL_4PASS_1_SGIS 0x80A5 -#define GL_4PASS_2_SGIS 0x80A6 -#define GL_4PASS_3_SGIS 0x80A7 -#define GL_SAMPLE_BUFFERS_SGIS 0x80A8 -#define GL_SAMPLES_SGIS 0x80A9 -#define GL_SAMPLE_MASK_VALUE_SGIS 0x80AA -#define GL_SAMPLE_MASK_INVERT_SGIS 0x80AB -#define GL_SAMPLE_PATTERN_SGIS 0x80AC -#endif - -#ifndef GL_EXT_rescale_normal -#define GL_RESCALE_NORMAL_EXT 0x803A -#endif - -#ifndef GL_EXT_vertex_array -#define GL_VERTEX_ARRAY_EXT 0x8074 -#define GL_NORMAL_ARRAY_EXT 0x8075 -#define GL_COLOR_ARRAY_EXT 0x8076 -#define GL_INDEX_ARRAY_EXT 0x8077 -#define GL_TEXTURE_COORD_ARRAY_EXT 0x8078 -#define GL_EDGE_FLAG_ARRAY_EXT 0x8079 -#define GL_VERTEX_ARRAY_SIZE_EXT 0x807A -#define GL_VERTEX_ARRAY_TYPE_EXT 0x807B -#define GL_VERTEX_ARRAY_STRIDE_EXT 0x807C -#define GL_VERTEX_ARRAY_COUNT_EXT 0x807D -#define GL_NORMAL_ARRAY_TYPE_EXT 0x807E -#define GL_NORMAL_ARRAY_STRIDE_EXT 0x807F -#define GL_NORMAL_ARRAY_COUNT_EXT 0x8080 -#define GL_COLOR_ARRAY_SIZE_EXT 0x8081 -#define GL_COLOR_ARRAY_TYPE_EXT 0x8082 -#define GL_COLOR_ARRAY_STRIDE_EXT 0x8083 -#define GL_COLOR_ARRAY_COUNT_EXT 0x8084 -#define GL_INDEX_ARRAY_TYPE_EXT 0x8085 -#define GL_INDEX_ARRAY_STRIDE_EXT 0x8086 -#define GL_INDEX_ARRAY_COUNT_EXT 0x8087 -#define GL_TEXTURE_COORD_ARRAY_SIZE_EXT 0x8088 -#define GL_TEXTURE_COORD_ARRAY_TYPE_EXT 0x8089 -#define GL_TEXTURE_COORD_ARRAY_STRIDE_EXT 0x808A -#define GL_TEXTURE_COORD_ARRAY_COUNT_EXT 0x808B -#define GL_EDGE_FLAG_ARRAY_STRIDE_EXT 0x808C -#define GL_EDGE_FLAG_ARRAY_COUNT_EXT 0x808D -#define GL_VERTEX_ARRAY_POINTER_EXT 0x808E -#define GL_NORMAL_ARRAY_POINTER_EXT 0x808F -#define GL_COLOR_ARRAY_POINTER_EXT 0x8090 -#define GL_INDEX_ARRAY_POINTER_EXT 0x8091 -#define GL_TEXTURE_COORD_ARRAY_POINTER_EXT 0x8092 -#define GL_EDGE_FLAG_ARRAY_POINTER_EXT 0x8093 -#endif - -#ifndef GL_EXT_misc_attribute -#endif - -#ifndef GL_SGIS_generate_mipmap -#define GL_GENERATE_MIPMAP_SGIS 0x8191 -#define GL_GENERATE_MIPMAP_HINT_SGIS 0x8192 -#endif - -#ifndef GL_SGIX_clipmap -#define GL_LINEAR_CLIPMAP_LINEAR_SGIX 0x8170 -#define GL_TEXTURE_CLIPMAP_CENTER_SGIX 0x8171 -#define GL_TEXTURE_CLIPMAP_FRAME_SGIX 0x8172 -#define GL_TEXTURE_CLIPMAP_OFFSET_SGIX 0x8173 -#define GL_TEXTURE_CLIPMAP_VIRTUAL_DEPTH_SGIX 0x8174 -#define GL_TEXTURE_CLIPMAP_LOD_OFFSET_SGIX 0x8175 -#define GL_TEXTURE_CLIPMAP_DEPTH_SGIX 0x8176 -#define GL_MAX_CLIPMAP_DEPTH_SGIX 0x8177 -#define GL_MAX_CLIPMAP_VIRTUAL_DEPTH_SGIX 0x8178 -#define GL_NEAREST_CLIPMAP_NEAREST_SGIX 0x844D -#define GL_NEAREST_CLIPMAP_LINEAR_SGIX 0x844E -#define GL_LINEAR_CLIPMAP_NEAREST_SGIX 0x844F -#endif - -#ifndef GL_SGIX_shadow -#define GL_TEXTURE_COMPARE_SGIX 0x819A -#define GL_TEXTURE_COMPARE_OPERATOR_SGIX 0x819B -#define GL_TEXTURE_LEQUAL_R_SGIX 0x819C -#define GL_TEXTURE_GEQUAL_R_SGIX 0x819D -#endif - -#ifndef GL_SGIS_texture_edge_clamp -#define GL_CLAMP_TO_EDGE_SGIS 0x812F -#endif - -#ifndef GL_SGIS_texture_border_clamp -#define GL_CLAMP_TO_BORDER_SGIS 0x812D -#endif - -#ifndef GL_EXT_blend_minmax -#define GL_FUNC_ADD_EXT 0x8006 -#define GL_MIN_EXT 0x8007 -#define GL_MAX_EXT 0x8008 -#define GL_BLEND_EQUATION_EXT 0x8009 -#endif - -#ifndef GL_EXT_blend_subtract -#define GL_FUNC_SUBTRACT_EXT 0x800A -#define GL_FUNC_REVERSE_SUBTRACT_EXT 0x800B -#endif - -#ifndef GL_EXT_blend_logic_op -#endif - -#ifndef GL_SGIX_interlace -#define GL_INTERLACE_SGIX 0x8094 -#endif - -#ifndef GL_SGIX_pixel_tiles -#define GL_PIXEL_TILE_BEST_ALIGNMENT_SGIX 0x813E -#define GL_PIXEL_TILE_CACHE_INCREMENT_SGIX 0x813F -#define GL_PIXEL_TILE_WIDTH_SGIX 0x8140 -#define GL_PIXEL_TILE_HEIGHT_SGIX 0x8141 -#define GL_PIXEL_TILE_GRID_WIDTH_SGIX 0x8142 -#define GL_PIXEL_TILE_GRID_HEIGHT_SGIX 0x8143 -#define GL_PIXEL_TILE_GRID_DEPTH_SGIX 0x8144 -#define GL_PIXEL_TILE_CACHE_SIZE_SGIX 0x8145 -#endif - -#ifndef GL_SGIS_texture_select -#define GL_DUAL_ALPHA4_SGIS 0x8110 -#define GL_DUAL_ALPHA8_SGIS 0x8111 -#define GL_DUAL_ALPHA12_SGIS 0x8112 -#define GL_DUAL_ALPHA16_SGIS 0x8113 -#define GL_DUAL_LUMINANCE4_SGIS 0x8114 -#define GL_DUAL_LUMINANCE8_SGIS 0x8115 -#define GL_DUAL_LUMINANCE12_SGIS 0x8116 -#define GL_DUAL_LUMINANCE16_SGIS 0x8117 -#define GL_DUAL_INTENSITY4_SGIS 0x8118 -#define GL_DUAL_INTENSITY8_SGIS 0x8119 -#define GL_DUAL_INTENSITY12_SGIS 0x811A -#define GL_DUAL_INTENSITY16_SGIS 0x811B -#define GL_DUAL_LUMINANCE_ALPHA4_SGIS 0x811C -#define GL_DUAL_LUMINANCE_ALPHA8_SGIS 0x811D -#define GL_QUAD_ALPHA4_SGIS 0x811E -#define GL_QUAD_ALPHA8_SGIS 0x811F -#define GL_QUAD_LUMINANCE4_SGIS 0x8120 -#define GL_QUAD_LUMINANCE8_SGIS 0x8121 -#define GL_QUAD_INTENSITY4_SGIS 0x8122 -#define GL_QUAD_INTENSITY8_SGIS 0x8123 -#define GL_DUAL_TEXTURE_SELECT_SGIS 0x8124 -#define GL_QUAD_TEXTURE_SELECT_SGIS 0x8125 -#endif - -#ifndef GL_SGIX_sprite -#define GL_SPRITE_SGIX 0x8148 -#define GL_SPRITE_MODE_SGIX 0x8149 -#define GL_SPRITE_AXIS_SGIX 0x814A -#define GL_SPRITE_TRANSLATION_SGIX 0x814B -#define GL_SPRITE_AXIAL_SGIX 0x814C -#define GL_SPRITE_OBJECT_ALIGNED_SGIX 0x814D -#define GL_SPRITE_EYE_ALIGNED_SGIX 0x814E -#endif - -#ifndef GL_SGIX_texture_multi_buffer -#define GL_TEXTURE_MULTI_BUFFER_HINT_SGIX 0x812E -#endif - -#ifndef GL_EXT_point_parameters -#define GL_POINT_SIZE_MIN_EXT 0x8126 -#define GL_POINT_SIZE_MAX_EXT 0x8127 -#define GL_POINT_FADE_THRESHOLD_SIZE_EXT 0x8128 -#define GL_DISTANCE_ATTENUATION_EXT 0x8129 -#endif - -#ifndef GL_SGIS_point_parameters -#define GL_POINT_SIZE_MIN_SGIS 0x8126 -#define GL_POINT_SIZE_MAX_SGIS 0x8127 -#define GL_POINT_FADE_THRESHOLD_SIZE_SGIS 0x8128 -#define GL_DISTANCE_ATTENUATION_SGIS 0x8129 -#endif - -#ifndef GL_SGIX_instruments -#define GL_INSTRUMENT_BUFFER_POINTER_SGIX 0x8180 -#define GL_INSTRUMENT_MEASUREMENTS_SGIX 0x8181 -#endif - -#ifndef GL_SGIX_texture_scale_bias -#define GL_POST_TEXTURE_FILTER_BIAS_SGIX 0x8179 -#define GL_POST_TEXTURE_FILTER_SCALE_SGIX 0x817A -#define GL_POST_TEXTURE_FILTER_BIAS_RANGE_SGIX 0x817B -#define GL_POST_TEXTURE_FILTER_SCALE_RANGE_SGIX 0x817C -#endif - -#ifndef GL_SGIX_framezoom -#define GL_FRAMEZOOM_SGIX 0x818B -#define GL_FRAMEZOOM_FACTOR_SGIX 0x818C -#define GL_MAX_FRAMEZOOM_FACTOR_SGIX 0x818D -#endif - -#ifndef GL_SGIX_tag_sample_buffer -#endif - -#ifndef GL_FfdMaskSGIX -#define GL_TEXTURE_DEFORMATION_BIT_SGIX 0x00000001 -#define GL_GEOMETRY_DEFORMATION_BIT_SGIX 0x00000002 -#endif - -#ifndef GL_SGIX_polynomial_ffd -#define GL_GEOMETRY_DEFORMATION_SGIX 0x8194 -#define GL_TEXTURE_DEFORMATION_SGIX 0x8195 -#define GL_DEFORMATIONS_MASK_SGIX 0x8196 -#define GL_MAX_DEFORMATION_ORDER_SGIX 0x8197 -#endif - -#ifndef GL_SGIX_reference_plane -#define GL_REFERENCE_PLANE_SGIX 0x817D -#define GL_REFERENCE_PLANE_EQUATION_SGIX 0x817E -#endif - -#ifndef GL_SGIX_flush_raster -#endif - -#ifndef GL_SGIX_depth_texture -#define GL_DEPTH_COMPONENT16_SGIX 0x81A5 -#define GL_DEPTH_COMPONENT24_SGIX 0x81A6 -#define GL_DEPTH_COMPONENT32_SGIX 0x81A7 -#endif - -#ifndef GL_SGIS_fog_function -#define GL_FOG_FUNC_SGIS 0x812A -#define GL_FOG_FUNC_POINTS_SGIS 0x812B -#define GL_MAX_FOG_FUNC_POINTS_SGIS 0x812C -#endif - -#ifndef GL_SGIX_fog_offset -#define GL_FOG_OFFSET_SGIX 0x8198 -#define GL_FOG_OFFSET_VALUE_SGIX 0x8199 -#endif - -#ifndef GL_HP_image_transform -#define GL_IMAGE_SCALE_X_HP 0x8155 -#define GL_IMAGE_SCALE_Y_HP 0x8156 -#define GL_IMAGE_TRANSLATE_X_HP 0x8157 -#define GL_IMAGE_TRANSLATE_Y_HP 0x8158 -#define GL_IMAGE_ROTATE_ANGLE_HP 0x8159 -#define GL_IMAGE_ROTATE_ORIGIN_X_HP 0x815A -#define GL_IMAGE_ROTATE_ORIGIN_Y_HP 0x815B -#define GL_IMAGE_MAG_FILTER_HP 0x815C -#define GL_IMAGE_MIN_FILTER_HP 0x815D -#define GL_IMAGE_CUBIC_WEIGHT_HP 0x815E -#define GL_CUBIC_HP 0x815F -#define GL_AVERAGE_HP 0x8160 -#define GL_IMAGE_TRANSFORM_2D_HP 0x8161 -#define GL_POST_IMAGE_TRANSFORM_COLOR_TABLE_HP 0x8162 -#define GL_PROXY_POST_IMAGE_TRANSFORM_COLOR_TABLE_HP 0x8163 -#endif - -#ifndef GL_HP_convolution_border_modes -#define GL_IGNORE_BORDER_HP 0x8150 -#define GL_CONSTANT_BORDER_HP 0x8151 -#define GL_REPLICATE_BORDER_HP 0x8153 -#define GL_CONVOLUTION_BORDER_COLOR_HP 0x8154 -#endif - -#ifndef GL_INGR_palette_buffer -#endif - -#ifndef GL_SGIX_texture_add_env -#define GL_TEXTURE_ENV_BIAS_SGIX 0x80BE -#endif - -#ifndef GL_EXT_color_subtable -#endif - -#ifndef GL_PGI_vertex_hints -#define GL_VERTEX_DATA_HINT_PGI 0x1A22A -#define GL_VERTEX_CONSISTENT_HINT_PGI 0x1A22B -#define GL_MATERIAL_SIDE_HINT_PGI 0x1A22C -#define GL_MAX_VERTEX_HINT_PGI 0x1A22D -#define GL_COLOR3_BIT_PGI 0x00010000 -#define GL_COLOR4_BIT_PGI 0x00020000 -#define GL_EDGEFLAG_BIT_PGI 0x00040000 -#define GL_INDEX_BIT_PGI 0x00080000 -#define GL_MAT_AMBIENT_BIT_PGI 0x00100000 -#define GL_MAT_AMBIENT_AND_DIFFUSE_BIT_PGI 0x00200000 -#define GL_MAT_DIFFUSE_BIT_PGI 0x00400000 -#define GL_MAT_EMISSION_BIT_PGI 0x00800000 -#define GL_MAT_COLOR_INDEXES_BIT_PGI 0x01000000 -#define GL_MAT_SHININESS_BIT_PGI 0x02000000 -#define GL_MAT_SPECULAR_BIT_PGI 0x04000000 -#define GL_NORMAL_BIT_PGI 0x08000000 -#define GL_TEXCOORD1_BIT_PGI 0x10000000 -#define GL_TEXCOORD2_BIT_PGI 0x20000000 -#define GL_TEXCOORD3_BIT_PGI 0x40000000 -#define GL_TEXCOORD4_BIT_PGI 0x80000000 -#define GL_VERTEX23_BIT_PGI 0x00000004 -#define GL_VERTEX4_BIT_PGI 0x00000008 -#endif - -#ifndef GL_PGI_misc_hints -#define GL_PREFER_DOUBLEBUFFER_HINT_PGI 0x1A1F8 -#define GL_CONSERVE_MEMORY_HINT_PGI 0x1A1FD -#define GL_RECLAIM_MEMORY_HINT_PGI 0x1A1FE -#define GL_NATIVE_GRAPHICS_HANDLE_PGI 0x1A202 -#define GL_NATIVE_GRAPHICS_BEGIN_HINT_PGI 0x1A203 -#define GL_NATIVE_GRAPHICS_END_HINT_PGI 0x1A204 -#define GL_ALWAYS_FAST_HINT_PGI 0x1A20C -#define GL_ALWAYS_SOFT_HINT_PGI 0x1A20D -#define GL_ALLOW_DRAW_OBJ_HINT_PGI 0x1A20E -#define GL_ALLOW_DRAW_WIN_HINT_PGI 0x1A20F -#define GL_ALLOW_DRAW_FRG_HINT_PGI 0x1A210 -#define GL_ALLOW_DRAW_MEM_HINT_PGI 0x1A211 -#define GL_STRICT_DEPTHFUNC_HINT_PGI 0x1A216 -#define GL_STRICT_LIGHTING_HINT_PGI 0x1A217 -#define GL_STRICT_SCISSOR_HINT_PGI 0x1A218 -#define GL_FULL_STIPPLE_HINT_PGI 0x1A219 -#define GL_CLIP_NEAR_HINT_PGI 0x1A220 -#define GL_CLIP_FAR_HINT_PGI 0x1A221 -#define GL_WIDE_LINE_HINT_PGI 0x1A222 -#define GL_BACK_NORMALS_HINT_PGI 0x1A223 -#endif - -#ifndef GL_EXT_paletted_texture -#define GL_COLOR_INDEX1_EXT 0x80E2 -#define GL_COLOR_INDEX2_EXT 0x80E3 -#define GL_COLOR_INDEX4_EXT 0x80E4 -#define GL_COLOR_INDEX8_EXT 0x80E5 -#define GL_COLOR_INDEX12_EXT 0x80E6 -#define GL_COLOR_INDEX16_EXT 0x80E7 -#define GL_TEXTURE_INDEX_SIZE_EXT 0x80ED -#endif - -#ifndef GL_EXT_clip_volume_hint -#define GL_CLIP_VOLUME_CLIPPING_HINT_EXT 0x80F0 -#endif - -#ifndef GL_SGIX_list_priority -#define GL_LIST_PRIORITY_SGIX 0x8182 -#endif - -#ifndef GL_SGIX_ir_instrument1 -#define GL_IR_INSTRUMENT1_SGIX 0x817F -#endif - -#ifndef GL_SGIX_calligraphic_fragment -#define GL_CALLIGRAPHIC_FRAGMENT_SGIX 0x8183 -#endif - -#ifndef GL_SGIX_texture_lod_bias -#define GL_TEXTURE_LOD_BIAS_S_SGIX 0x818E -#define GL_TEXTURE_LOD_BIAS_T_SGIX 0x818F -#define GL_TEXTURE_LOD_BIAS_R_SGIX 0x8190 -#endif - -#ifndef GL_SGIX_shadow_ambient -#define GL_SHADOW_AMBIENT_SGIX 0x80BF -#endif - -#ifndef GL_EXT_index_texture -#endif - -#ifndef GL_EXT_index_material -#define GL_INDEX_MATERIAL_EXT 0x81B8 -#define GL_INDEX_MATERIAL_PARAMETER_EXT 0x81B9 -#define GL_INDEX_MATERIAL_FACE_EXT 0x81BA -#endif - -#ifndef GL_EXT_index_func -#define GL_INDEX_TEST_EXT 0x81B5 -#define GL_INDEX_TEST_FUNC_EXT 0x81B6 -#define GL_INDEX_TEST_REF_EXT 0x81B7 -#endif - -#ifndef GL_EXT_index_array_formats -#define GL_IUI_V2F_EXT 0x81AD -#define GL_IUI_V3F_EXT 0x81AE -#define GL_IUI_N3F_V2F_EXT 0x81AF -#define GL_IUI_N3F_V3F_EXT 0x81B0 -#define GL_T2F_IUI_V2F_EXT 0x81B1 -#define GL_T2F_IUI_V3F_EXT 0x81B2 -#define GL_T2F_IUI_N3F_V2F_EXT 0x81B3 -#define GL_T2F_IUI_N3F_V3F_EXT 0x81B4 -#endif - -#ifndef GL_EXT_compiled_vertex_array -#define GL_ARRAY_ELEMENT_LOCK_FIRST_EXT 0x81A8 -#define GL_ARRAY_ELEMENT_LOCK_COUNT_EXT 0x81A9 -#endif - -#ifndef GL_EXT_cull_vertex -#define GL_CULL_VERTEX_EXT 0x81AA -#define GL_CULL_VERTEX_EYE_POSITION_EXT 0x81AB -#define GL_CULL_VERTEX_OBJECT_POSITION_EXT 0x81AC -#endif - -#ifndef GL_SGIX_ycrcb -#define GL_YCRCB_422_SGIX 0x81BB -#define GL_YCRCB_444_SGIX 0x81BC -#endif - -#ifndef GL_SGIX_fragment_lighting -#define GL_FRAGMENT_LIGHTING_SGIX 0x8400 -#define GL_FRAGMENT_COLOR_MATERIAL_SGIX 0x8401 -#define GL_FRAGMENT_COLOR_MATERIAL_FACE_SGIX 0x8402 -#define GL_FRAGMENT_COLOR_MATERIAL_PARAMETER_SGIX 0x8403 -#define GL_MAX_FRAGMENT_LIGHTS_SGIX 0x8404 -#define GL_MAX_ACTIVE_LIGHTS_SGIX 0x8405 -#define GL_CURRENT_RASTER_NORMAL_SGIX 0x8406 -#define GL_LIGHT_ENV_MODE_SGIX 0x8407 -#define GL_FRAGMENT_LIGHT_MODEL_LOCAL_VIEWER_SGIX 0x8408 -#define GL_FRAGMENT_LIGHT_MODEL_TWO_SIDE_SGIX 0x8409 -#define GL_FRAGMENT_LIGHT_MODEL_AMBIENT_SGIX 0x840A -#define GL_FRAGMENT_LIGHT_MODEL_NORMAL_INTERPOLATION_SGIX 0x840B -#define GL_FRAGMENT_LIGHT0_SGIX 0x840C -#define GL_FRAGMENT_LIGHT1_SGIX 0x840D -#define GL_FRAGMENT_LIGHT2_SGIX 0x840E -#define GL_FRAGMENT_LIGHT3_SGIX 0x840F -#define GL_FRAGMENT_LIGHT4_SGIX 0x8410 -#define GL_FRAGMENT_LIGHT5_SGIX 0x8411 -#define GL_FRAGMENT_LIGHT6_SGIX 0x8412 -#define GL_FRAGMENT_LIGHT7_SGIX 0x8413 -#endif - -#ifndef GL_IBM_rasterpos_clip -#define GL_RASTER_POSITION_UNCLIPPED_IBM 0x19262 -#endif - -#ifndef GL_HP_texture_lighting -#define GL_TEXTURE_LIGHTING_MODE_HP 0x8167 -#define GL_TEXTURE_POST_SPECULAR_HP 0x8168 -#define GL_TEXTURE_PRE_SPECULAR_HP 0x8169 -#endif - -#ifndef GL_EXT_draw_range_elements -#define GL_MAX_ELEMENTS_VERTICES_EXT 0x80E8 -#define GL_MAX_ELEMENTS_INDICES_EXT 0x80E9 -#endif - -#ifndef GL_WIN_phong_shading -#define GL_PHONG_WIN 0x80EA -#define GL_PHONG_HINT_WIN 0x80EB -#endif - -#ifndef GL_WIN_specular_fog -#define GL_FOG_SPECULAR_TEXTURE_WIN 0x80EC -#endif - -#ifndef GL_EXT_light_texture -#define GL_FRAGMENT_MATERIAL_EXT 0x8349 -#define GL_FRAGMENT_NORMAL_EXT 0x834A -#define GL_FRAGMENT_COLOR_EXT 0x834C -#define GL_ATTENUATION_EXT 0x834D -#define GL_SHADOW_ATTENUATION_EXT 0x834E -#define GL_TEXTURE_APPLICATION_MODE_EXT 0x834F -#define GL_TEXTURE_LIGHT_EXT 0x8350 -#define GL_TEXTURE_MATERIAL_FACE_EXT 0x8351 -#define GL_TEXTURE_MATERIAL_PARAMETER_EXT 0x8352 -/* reuse GL_FRAGMENT_DEPTH_EXT */ -#endif - -#ifndef GL_SGIX_blend_alpha_minmax -#define GL_ALPHA_MIN_SGIX 0x8320 -#define GL_ALPHA_MAX_SGIX 0x8321 -#endif - -#ifndef GL_SGIX_impact_pixel_texture -#define GL_PIXEL_TEX_GEN_Q_CEILING_SGIX 0x8184 -#define GL_PIXEL_TEX_GEN_Q_ROUND_SGIX 0x8185 -#define GL_PIXEL_TEX_GEN_Q_FLOOR_SGIX 0x8186 -#define GL_PIXEL_TEX_GEN_ALPHA_REPLACE_SGIX 0x8187 -#define GL_PIXEL_TEX_GEN_ALPHA_NO_REPLACE_SGIX 0x8188 -#define GL_PIXEL_TEX_GEN_ALPHA_LS_SGIX 0x8189 -#define GL_PIXEL_TEX_GEN_ALPHA_MS_SGIX 0x818A -#endif - -#ifndef GL_EXT_bgra -#define GL_BGR_EXT 0x80E0 -#define GL_BGRA_EXT 0x80E1 -#endif - -#ifndef GL_SGIX_async -#define GL_ASYNC_MARKER_SGIX 0x8329 -#endif - -#ifndef GL_SGIX_async_pixel -#define GL_ASYNC_TEX_IMAGE_SGIX 0x835C -#define GL_ASYNC_DRAW_PIXELS_SGIX 0x835D -#define GL_ASYNC_READ_PIXELS_SGIX 0x835E -#define GL_MAX_ASYNC_TEX_IMAGE_SGIX 0x835F -#define GL_MAX_ASYNC_DRAW_PIXELS_SGIX 0x8360 -#define GL_MAX_ASYNC_READ_PIXELS_SGIX 0x8361 -#endif - -#ifndef GL_SGIX_async_histogram -#define GL_ASYNC_HISTOGRAM_SGIX 0x832C -#define GL_MAX_ASYNC_HISTOGRAM_SGIX 0x832D -#endif - -#ifndef GL_INTEL_texture_scissor -#endif - -#ifndef GL_INTEL_parallel_arrays -#define GL_PARALLEL_ARRAYS_INTEL 0x83F4 -#define GL_VERTEX_ARRAY_PARALLEL_POINTERS_INTEL 0x83F5 -#define GL_NORMAL_ARRAY_PARALLEL_POINTERS_INTEL 0x83F6 -#define GL_COLOR_ARRAY_PARALLEL_POINTERS_INTEL 0x83F7 -#define GL_TEXTURE_COORD_ARRAY_PARALLEL_POINTERS_INTEL 0x83F8 -#endif - -#ifndef GL_HP_occlusion_test -#define GL_OCCLUSION_TEST_HP 0x8165 -#define GL_OCCLUSION_TEST_RESULT_HP 0x8166 -#endif - -#ifndef GL_EXT_pixel_transform -#define GL_PIXEL_TRANSFORM_2D_EXT 0x8330 -#define GL_PIXEL_MAG_FILTER_EXT 0x8331 -#define GL_PIXEL_MIN_FILTER_EXT 0x8332 -#define GL_PIXEL_CUBIC_WEIGHT_EXT 0x8333 -#define GL_CUBIC_EXT 0x8334 -#define GL_AVERAGE_EXT 0x8335 -#define GL_PIXEL_TRANSFORM_2D_STACK_DEPTH_EXT 0x8336 -#define GL_MAX_PIXEL_TRANSFORM_2D_STACK_DEPTH_EXT 0x8337 -#define GL_PIXEL_TRANSFORM_2D_MATRIX_EXT 0x8338 -#endif - -#ifndef GL_EXT_pixel_transform_color_table -#endif - -#ifndef GL_EXT_shared_texture_palette -#define GL_SHARED_TEXTURE_PALETTE_EXT 0x81FB -#endif - -#ifndef GL_EXT_separate_specular_color -#define GL_LIGHT_MODEL_COLOR_CONTROL_EXT 0x81F8 -#define GL_SINGLE_COLOR_EXT 0x81F9 -#define GL_SEPARATE_SPECULAR_COLOR_EXT 0x81FA -#endif - -#ifndef GL_EXT_secondary_color -#define GL_COLOR_SUM_EXT 0x8458 -#define GL_CURRENT_SECONDARY_COLOR_EXT 0x8459 -#define GL_SECONDARY_COLOR_ARRAY_SIZE_EXT 0x845A -#define GL_SECONDARY_COLOR_ARRAY_TYPE_EXT 0x845B -#define GL_SECONDARY_COLOR_ARRAY_STRIDE_EXT 0x845C -#define GL_SECONDARY_COLOR_ARRAY_POINTER_EXT 0x845D -#define GL_SECONDARY_COLOR_ARRAY_EXT 0x845E -#endif - -#ifndef GL_EXT_texture_perturb_normal -#define GL_PERTURB_EXT 0x85AE -#define GL_TEXTURE_NORMAL_EXT 0x85AF -#endif - -#ifndef GL_EXT_multi_draw_arrays -#endif - -#ifndef GL_EXT_fog_coord -#define GL_FOG_COORDINATE_SOURCE_EXT 0x8450 -#define GL_FOG_COORDINATE_EXT 0x8451 -#define GL_FRAGMENT_DEPTH_EXT 0x8452 -#define GL_CURRENT_FOG_COORDINATE_EXT 0x8453 -#define GL_FOG_COORDINATE_ARRAY_TYPE_EXT 0x8454 -#define GL_FOG_COORDINATE_ARRAY_STRIDE_EXT 0x8455 -#define GL_FOG_COORDINATE_ARRAY_POINTER_EXT 0x8456 -#define GL_FOG_COORDINATE_ARRAY_EXT 0x8457 -#endif - -#ifndef GL_REND_screen_coordinates -#define GL_SCREEN_COORDINATES_REND 0x8490 -#define GL_INVERTED_SCREEN_W_REND 0x8491 -#endif - -#ifndef GL_EXT_coordinate_frame -#define GL_TANGENT_ARRAY_EXT 0x8439 -#define GL_BINORMAL_ARRAY_EXT 0x843A -#define GL_CURRENT_TANGENT_EXT 0x843B -#define GL_CURRENT_BINORMAL_EXT 0x843C -#define GL_TANGENT_ARRAY_TYPE_EXT 0x843E -#define GL_TANGENT_ARRAY_STRIDE_EXT 0x843F -#define GL_BINORMAL_ARRAY_TYPE_EXT 0x8440 -#define GL_BINORMAL_ARRAY_STRIDE_EXT 0x8441 -#define GL_TANGENT_ARRAY_POINTER_EXT 0x8442 -#define GL_BINORMAL_ARRAY_POINTER_EXT 0x8443 -#define GL_MAP1_TANGENT_EXT 0x8444 -#define GL_MAP2_TANGENT_EXT 0x8445 -#define GL_MAP1_BINORMAL_EXT 0x8446 -#define GL_MAP2_BINORMAL_EXT 0x8447 -#endif - -#ifndef GL_EXT_texture_env_combine -#define GL_COMBINE_EXT 0x8570 -#define GL_COMBINE_RGB_EXT 0x8571 -#define GL_COMBINE_ALPHA_EXT 0x8572 -#define GL_RGB_SCALE_EXT 0x8573 -#define GL_ADD_SIGNED_EXT 0x8574 -#define GL_INTERPOLATE_EXT 0x8575 -#define GL_CONSTANT_EXT 0x8576 -#define GL_PRIMARY_COLOR_EXT 0x8577 -#define GL_PREVIOUS_EXT 0x8578 -#define GL_SOURCE0_RGB_EXT 0x8580 -#define GL_SOURCE1_RGB_EXT 0x8581 -#define GL_SOURCE2_RGB_EXT 0x8582 -#define GL_SOURCE0_ALPHA_EXT 0x8588 -#define GL_SOURCE1_ALPHA_EXT 0x8589 -#define GL_SOURCE2_ALPHA_EXT 0x858A -#define GL_OPERAND0_RGB_EXT 0x8590 -#define GL_OPERAND1_RGB_EXT 0x8591 -#define GL_OPERAND2_RGB_EXT 0x8592 -#define GL_OPERAND0_ALPHA_EXT 0x8598 -#define GL_OPERAND1_ALPHA_EXT 0x8599 -#define GL_OPERAND2_ALPHA_EXT 0x859A -#endif - -#ifndef GL_APPLE_specular_vector -#define GL_LIGHT_MODEL_SPECULAR_VECTOR_APPLE 0x85B0 -#endif - -#ifndef GL_APPLE_transform_hint -#define GL_TRANSFORM_HINT_APPLE 0x85B1 -#endif - -#ifndef GL_SGIX_fog_scale -#define GL_FOG_SCALE_SGIX 0x81FC -#define GL_FOG_SCALE_VALUE_SGIX 0x81FD -#endif - -#ifndef GL_SUNX_constant_data -#define GL_UNPACK_CONSTANT_DATA_SUNX 0x81D5 -#define GL_TEXTURE_CONSTANT_DATA_SUNX 0x81D6 -#endif - -#ifndef GL_SUN_global_alpha -#define GL_GLOBAL_ALPHA_SUN 0x81D9 -#define GL_GLOBAL_ALPHA_FACTOR_SUN 0x81DA -#endif - -#ifndef GL_SUN_triangle_list -#define GL_RESTART_SUN 0x0001 -#define GL_REPLACE_MIDDLE_SUN 0x0002 -#define GL_REPLACE_OLDEST_SUN 0x0003 -#define GL_TRIANGLE_LIST_SUN 0x81D7 -#define GL_REPLACEMENT_CODE_SUN 0x81D8 -#define GL_REPLACEMENT_CODE_ARRAY_SUN 0x85C0 -#define GL_REPLACEMENT_CODE_ARRAY_TYPE_SUN 0x85C1 -#define GL_REPLACEMENT_CODE_ARRAY_STRIDE_SUN 0x85C2 -#define GL_REPLACEMENT_CODE_ARRAY_POINTER_SUN 0x85C3 -#define GL_R1UI_V3F_SUN 0x85C4 -#define GL_R1UI_C4UB_V3F_SUN 0x85C5 -#define GL_R1UI_C3F_V3F_SUN 0x85C6 -#define GL_R1UI_N3F_V3F_SUN 0x85C7 -#define GL_R1UI_C4F_N3F_V3F_SUN 0x85C8 -#define GL_R1UI_T2F_V3F_SUN 0x85C9 -#define GL_R1UI_T2F_N3F_V3F_SUN 0x85CA -#define GL_R1UI_T2F_C4F_N3F_V3F_SUN 0x85CB -#endif - -#ifndef GL_SUN_vertex -#endif - -#ifndef GL_EXT_blend_func_separate -#define GL_BLEND_DST_RGB_EXT 0x80C8 -#define GL_BLEND_SRC_RGB_EXT 0x80C9 -#define GL_BLEND_DST_ALPHA_EXT 0x80CA -#define GL_BLEND_SRC_ALPHA_EXT 0x80CB -#endif - -#ifndef GL_INGR_color_clamp -#define GL_RED_MIN_CLAMP_INGR 0x8560 -#define GL_GREEN_MIN_CLAMP_INGR 0x8561 -#define GL_BLUE_MIN_CLAMP_INGR 0x8562 -#define GL_ALPHA_MIN_CLAMP_INGR 0x8563 -#define GL_RED_MAX_CLAMP_INGR 0x8564 -#define GL_GREEN_MAX_CLAMP_INGR 0x8565 -#define GL_BLUE_MAX_CLAMP_INGR 0x8566 -#define GL_ALPHA_MAX_CLAMP_INGR 0x8567 -#endif - -#ifndef GL_INGR_interlace_read -#define GL_INTERLACE_READ_INGR 0x8568 -#endif - -#ifndef GL_EXT_stencil_wrap -#define GL_INCR_WRAP_EXT 0x8507 -#define GL_DECR_WRAP_EXT 0x8508 -#endif - -#ifndef GL_EXT_422_pixels -#define GL_422_EXT 0x80CC -#define GL_422_REV_EXT 0x80CD -#define GL_422_AVERAGE_EXT 0x80CE -#define GL_422_REV_AVERAGE_EXT 0x80CF -#endif - -#ifndef GL_NV_texgen_reflection -#define GL_NORMAL_MAP_NV 0x8511 -#define GL_REFLECTION_MAP_NV 0x8512 -#endif - -#ifndef GL_EXT_texture_cube_map -#define GL_NORMAL_MAP_EXT 0x8511 -#define GL_REFLECTION_MAP_EXT 0x8512 -#define GL_TEXTURE_CUBE_MAP_EXT 0x8513 -#define GL_TEXTURE_BINDING_CUBE_MAP_EXT 0x8514 -#define GL_TEXTURE_CUBE_MAP_POSITIVE_X_EXT 0x8515 -#define GL_TEXTURE_CUBE_MAP_NEGATIVE_X_EXT 0x8516 -#define GL_TEXTURE_CUBE_MAP_POSITIVE_Y_EXT 0x8517 -#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Y_EXT 0x8518 -#define GL_TEXTURE_CUBE_MAP_POSITIVE_Z_EXT 0x8519 -#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z_EXT 0x851A -#define GL_PROXY_TEXTURE_CUBE_MAP_EXT 0x851B -#define GL_MAX_CUBE_MAP_TEXTURE_SIZE_EXT 0x851C -#endif - -#ifndef GL_SUN_convolution_border_modes -#define GL_WRAP_BORDER_SUN 0x81D4 -#endif - -#ifndef GL_EXT_texture_env_add -#endif - -#ifndef GL_EXT_texture_lod_bias -#define GL_MAX_TEXTURE_LOD_BIAS_EXT 0x84FD -#define GL_TEXTURE_FILTER_CONTROL_EXT 0x8500 -#define GL_TEXTURE_LOD_BIAS_EXT 0x8501 -#endif - -#ifndef GL_EXT_texture_filter_anisotropic -#define GL_TEXTURE_MAX_ANISOTROPY_EXT 0x84FE -#define GL_MAX_TEXTURE_MAX_ANISOTROPY_EXT 0x84FF -#endif - -#ifndef GL_EXT_vertex_weighting -#define GL_MODELVIEW0_STACK_DEPTH_EXT GL_MODELVIEW_STACK_DEPTH -#define GL_MODELVIEW1_STACK_DEPTH_EXT 0x8502 -#define GL_MODELVIEW0_MATRIX_EXT GL_MODELVIEW_MATRIX -#define GL_MODELVIEW1_MATRIX_EXT 0x8506 -#define GL_VERTEX_WEIGHTING_EXT 0x8509 -#define GL_MODELVIEW0_EXT GL_MODELVIEW -#define GL_MODELVIEW1_EXT 0x850A -#define GL_CURRENT_VERTEX_WEIGHT_EXT 0x850B -#define GL_VERTEX_WEIGHT_ARRAY_EXT 0x850C -#define GL_VERTEX_WEIGHT_ARRAY_SIZE_EXT 0x850D -#define GL_VERTEX_WEIGHT_ARRAY_TYPE_EXT 0x850E -#define GL_VERTEX_WEIGHT_ARRAY_STRIDE_EXT 0x850F -#define GL_VERTEX_WEIGHT_ARRAY_POINTER_EXT 0x8510 -#endif - -#ifndef GL_NV_light_max_exponent -#define GL_MAX_SHININESS_NV 0x8504 -#define GL_MAX_SPOT_EXPONENT_NV 0x8505 -#endif - -#ifndef GL_NV_vertex_array_range -#define GL_VERTEX_ARRAY_RANGE_NV 0x851D -#define GL_VERTEX_ARRAY_RANGE_LENGTH_NV 0x851E -#define GL_VERTEX_ARRAY_RANGE_VALID_NV 0x851F -#define GL_MAX_VERTEX_ARRAY_RANGE_ELEMENT_NV 0x8520 -#define GL_VERTEX_ARRAY_RANGE_POINTER_NV 0x8521 -#endif - -#ifndef GL_NV_register_combiners -#define GL_REGISTER_COMBINERS_NV 0x8522 -#define GL_VARIABLE_A_NV 0x8523 -#define GL_VARIABLE_B_NV 0x8524 -#define GL_VARIABLE_C_NV 0x8525 -#define GL_VARIABLE_D_NV 0x8526 -#define GL_VARIABLE_E_NV 0x8527 -#define GL_VARIABLE_F_NV 0x8528 -#define GL_VARIABLE_G_NV 0x8529 -#define GL_CONSTANT_COLOR0_NV 0x852A -#define GL_CONSTANT_COLOR1_NV 0x852B -#define GL_PRIMARY_COLOR_NV 0x852C -#define GL_SECONDARY_COLOR_NV 0x852D -#define GL_SPARE0_NV 0x852E -#define GL_SPARE1_NV 0x852F -#define GL_DISCARD_NV 0x8530 -#define GL_E_TIMES_F_NV 0x8531 -#define GL_SPARE0_PLUS_SECONDARY_COLOR_NV 0x8532 -#define GL_UNSIGNED_IDENTITY_NV 0x8536 -#define GL_UNSIGNED_INVERT_NV 0x8537 -#define GL_EXPAND_NORMAL_NV 0x8538 -#define GL_EXPAND_NEGATE_NV 0x8539 -#define GL_HALF_BIAS_NORMAL_NV 0x853A -#define GL_HALF_BIAS_NEGATE_NV 0x853B -#define GL_SIGNED_IDENTITY_NV 0x853C -#define GL_SIGNED_NEGATE_NV 0x853D -#define GL_SCALE_BY_TWO_NV 0x853E -#define GL_SCALE_BY_FOUR_NV 0x853F -#define GL_SCALE_BY_ONE_HALF_NV 0x8540 -#define GL_BIAS_BY_NEGATIVE_ONE_HALF_NV 0x8541 -#define GL_COMBINER_INPUT_NV 0x8542 -#define GL_COMBINER_MAPPING_NV 0x8543 -#define GL_COMBINER_COMPONENT_USAGE_NV 0x8544 -#define GL_COMBINER_AB_DOT_PRODUCT_NV 0x8545 -#define GL_COMBINER_CD_DOT_PRODUCT_NV 0x8546 -#define GL_COMBINER_MUX_SUM_NV 0x8547 -#define GL_COMBINER_SCALE_NV 0x8548 -#define GL_COMBINER_BIAS_NV 0x8549 -#define GL_COMBINER_AB_OUTPUT_NV 0x854A -#define GL_COMBINER_CD_OUTPUT_NV 0x854B -#define GL_COMBINER_SUM_OUTPUT_NV 0x854C -#define GL_MAX_GENERAL_COMBINERS_NV 0x854D -#define GL_NUM_GENERAL_COMBINERS_NV 0x854E -#define GL_COLOR_SUM_CLAMP_NV 0x854F -#define GL_COMBINER0_NV 0x8550 -#define GL_COMBINER1_NV 0x8551 -#define GL_COMBINER2_NV 0x8552 -#define GL_COMBINER3_NV 0x8553 -#define GL_COMBINER4_NV 0x8554 -#define GL_COMBINER5_NV 0x8555 -#define GL_COMBINER6_NV 0x8556 -#define GL_COMBINER7_NV 0x8557 -/* reuse GL_TEXTURE0_ARB */ -/* reuse GL_TEXTURE1_ARB */ -/* reuse GL_ZERO */ -/* reuse GL_NONE */ -/* reuse GL_FOG */ -#endif - -#ifndef GL_NV_fog_distance -#define GL_FOG_DISTANCE_MODE_NV 0x855A -#define GL_EYE_RADIAL_NV 0x855B -#define GL_EYE_PLANE_ABSOLUTE_NV 0x855C -/* reuse GL_EYE_PLANE */ -#endif - -#ifndef GL_NV_texgen_emboss -#define GL_EMBOSS_LIGHT_NV 0x855D -#define GL_EMBOSS_CONSTANT_NV 0x855E -#define GL_EMBOSS_MAP_NV 0x855F -#endif - -#ifndef GL_NV_blend_square -#endif - -#ifndef GL_NV_texture_env_combine4 -#define GL_COMBINE4_NV 0x8503 -#define GL_SOURCE3_RGB_NV 0x8583 -#define GL_SOURCE3_ALPHA_NV 0x858B -#define GL_OPERAND3_RGB_NV 0x8593 -#define GL_OPERAND3_ALPHA_NV 0x859B -#endif - -#ifndef GL_MESA_resize_buffers -#endif - -#ifndef GL_MESA_window_pos -#endif - -#ifndef GL_EXT_texture_compression_s3tc -#define GL_COMPRESSED_RGB_S3TC_DXT1_EXT 0x83F0 -#define GL_COMPRESSED_RGBA_S3TC_DXT1_EXT 0x83F1 -#define GL_COMPRESSED_RGBA_S3TC_DXT3_EXT 0x83F2 -#define GL_COMPRESSED_RGBA_S3TC_DXT5_EXT 0x83F3 -#endif - -#ifndef GL_IBM_cull_vertex -#define GL_CULL_VERTEX_IBM 103050 -#endif - -#ifndef GL_IBM_multimode_draw_arrays -#endif - -#ifndef GL_IBM_vertex_array_lists -#define GL_VERTEX_ARRAY_LIST_IBM 103070 -#define GL_NORMAL_ARRAY_LIST_IBM 103071 -#define GL_COLOR_ARRAY_LIST_IBM 103072 -#define GL_INDEX_ARRAY_LIST_IBM 103073 -#define GL_TEXTURE_COORD_ARRAY_LIST_IBM 103074 -#define GL_EDGE_FLAG_ARRAY_LIST_IBM 103075 -#define GL_FOG_COORDINATE_ARRAY_LIST_IBM 103076 -#define GL_SECONDARY_COLOR_ARRAY_LIST_IBM 103077 -#define GL_VERTEX_ARRAY_LIST_STRIDE_IBM 103080 -#define GL_NORMAL_ARRAY_LIST_STRIDE_IBM 103081 -#define GL_COLOR_ARRAY_LIST_STRIDE_IBM 103082 -#define GL_INDEX_ARRAY_LIST_STRIDE_IBM 103083 -#define GL_TEXTURE_COORD_ARRAY_LIST_STRIDE_IBM 103084 -#define GL_EDGE_FLAG_ARRAY_LIST_STRIDE_IBM 103085 -#define GL_FOG_COORDINATE_ARRAY_LIST_STRIDE_IBM 103086 -#define GL_SECONDARY_COLOR_ARRAY_LIST_STRIDE_IBM 103087 -#endif - -#ifndef GL_SGIX_subsample -#define GL_PACK_SUBSAMPLE_RATE_SGIX 0x85A0 -#define GL_UNPACK_SUBSAMPLE_RATE_SGIX 0x85A1 -#define GL_PIXEL_SUBSAMPLE_4444_SGIX 0x85A2 -#define GL_PIXEL_SUBSAMPLE_2424_SGIX 0x85A3 -#define GL_PIXEL_SUBSAMPLE_4242_SGIX 0x85A4 -#endif - -#ifndef GL_SGIX_ycrcb_subsample -#endif - -#ifndef GL_SGIX_ycrcba -#define GL_YCRCB_SGIX 0x8318 -#define GL_YCRCBA_SGIX 0x8319 -#endif - -#ifndef GL_SGI_depth_pass_instrument -#define GL_DEPTH_PASS_INSTRUMENT_SGIX 0x8310 -#define GL_DEPTH_PASS_INSTRUMENT_COUNTERS_SGIX 0x8311 -#define GL_DEPTH_PASS_INSTRUMENT_MAX_SGIX 0x8312 -#endif - -#ifndef GL_3DFX_texture_compression_FXT1 -#define GL_COMPRESSED_RGB_FXT1_3DFX 0x86B0 -#define GL_COMPRESSED_RGBA_FXT1_3DFX 0x86B1 -#endif - -#ifndef GL_3DFX_multisample -#define GL_MULTISAMPLE_3DFX 0x86B2 -#define GL_SAMPLE_BUFFERS_3DFX 0x86B3 -#define GL_SAMPLES_3DFX 0x86B4 -#define GL_MULTISAMPLE_BIT_3DFX 0x20000000 -#endif - -#ifndef GL_3DFX_tbuffer -#endif - -#ifndef GL_EXT_multisample -#define GL_MULTISAMPLE_EXT 0x809D -#define GL_SAMPLE_ALPHA_TO_MASK_EXT 0x809E -#define GL_SAMPLE_ALPHA_TO_ONE_EXT 0x809F -#define GL_SAMPLE_MASK_EXT 0x80A0 -#define GL_1PASS_EXT 0x80A1 -#define GL_2PASS_0_EXT 0x80A2 -#define GL_2PASS_1_EXT 0x80A3 -#define GL_4PASS_0_EXT 0x80A4 -#define GL_4PASS_1_EXT 0x80A5 -#define GL_4PASS_2_EXT 0x80A6 -#define GL_4PASS_3_EXT 0x80A7 -#define GL_SAMPLE_BUFFERS_EXT 0x80A8 -#define GL_SAMPLES_EXT 0x80A9 -#define GL_SAMPLE_MASK_VALUE_EXT 0x80AA -#define GL_SAMPLE_MASK_INVERT_EXT 0x80AB -#define GL_SAMPLE_PATTERN_EXT 0x80AC -#define GL_MULTISAMPLE_BIT_EXT 0x20000000 -#endif - -#ifndef GL_SGIX_vertex_preclip -#define GL_VERTEX_PRECLIP_SGIX 0x83EE -#define GL_VERTEX_PRECLIP_HINT_SGIX 0x83EF -#endif - -#ifndef GL_SGIX_convolution_accuracy -#define GL_CONVOLUTION_HINT_SGIX 0x8316 -#endif - -#ifndef GL_SGIX_resample -#define GL_PACK_RESAMPLE_SGIX 0x842C -#define GL_UNPACK_RESAMPLE_SGIX 0x842D -#define GL_RESAMPLE_REPLICATE_SGIX 0x842E -#define GL_RESAMPLE_ZERO_FILL_SGIX 0x842F -#define GL_RESAMPLE_DECIMATE_SGIX 0x8430 -#endif - -#ifndef GL_SGIS_point_line_texgen -#define GL_EYE_DISTANCE_TO_POINT_SGIS 0x81F0 -#define GL_OBJECT_DISTANCE_TO_POINT_SGIS 0x81F1 -#define GL_EYE_DISTANCE_TO_LINE_SGIS 0x81F2 -#define GL_OBJECT_DISTANCE_TO_LINE_SGIS 0x81F3 -#define GL_EYE_POINT_SGIS 0x81F4 -#define GL_OBJECT_POINT_SGIS 0x81F5 -#define GL_EYE_LINE_SGIS 0x81F6 -#define GL_OBJECT_LINE_SGIS 0x81F7 -#endif - -#ifndef GL_SGIS_texture_color_mask -#define GL_TEXTURE_COLOR_WRITEMASK_SGIS 0x81EF -#endif - -#ifndef GL_EXT_texture_env_dot3 -#define GL_DOT3_RGB_EXT 0x8740 -#define GL_DOT3_RGBA_EXT 0x8741 -#endif - -#ifndef GL_ATI_texture_mirror_once -#define GL_MIRROR_CLAMP_ATI 0x8742 -#define GL_MIRROR_CLAMP_TO_EDGE_ATI 0x8743 -#endif - -#ifndef GL_NV_fence -#define GL_ALL_COMPLETED_NV 0x84F2 -#define GL_FENCE_STATUS_NV 0x84F3 -#define GL_FENCE_CONDITION_NV 0x84F4 -#endif - -#ifndef GL_IBM_texture_mirrored_repeat -#define GL_MIRRORED_REPEAT_IBM 0x8370 -#endif - -#ifndef GL_NV_evaluators -#define GL_EVAL_2D_NV 0x86C0 -#define GL_EVAL_TRIANGULAR_2D_NV 0x86C1 -#define GL_MAP_TESSELLATION_NV 0x86C2 -#define GL_MAP_ATTRIB_U_ORDER_NV 0x86C3 -#define GL_MAP_ATTRIB_V_ORDER_NV 0x86C4 -#define GL_EVAL_FRACTIONAL_TESSELLATION_NV 0x86C5 -#define GL_EVAL_VERTEX_ATTRIB0_NV 0x86C6 -#define GL_EVAL_VERTEX_ATTRIB1_NV 0x86C7 -#define GL_EVAL_VERTEX_ATTRIB2_NV 0x86C8 -#define GL_EVAL_VERTEX_ATTRIB3_NV 0x86C9 -#define GL_EVAL_VERTEX_ATTRIB4_NV 0x86CA -#define GL_EVAL_VERTEX_ATTRIB5_NV 0x86CB -#define GL_EVAL_VERTEX_ATTRIB6_NV 0x86CC -#define GL_EVAL_VERTEX_ATTRIB7_NV 0x86CD -#define GL_EVAL_VERTEX_ATTRIB8_NV 0x86CE -#define GL_EVAL_VERTEX_ATTRIB9_NV 0x86CF -#define GL_EVAL_VERTEX_ATTRIB10_NV 0x86D0 -#define GL_EVAL_VERTEX_ATTRIB11_NV 0x86D1 -#define GL_EVAL_VERTEX_ATTRIB12_NV 0x86D2 -#define GL_EVAL_VERTEX_ATTRIB13_NV 0x86D3 -#define GL_EVAL_VERTEX_ATTRIB14_NV 0x86D4 -#define GL_EVAL_VERTEX_ATTRIB15_NV 0x86D5 -#define GL_MAX_MAP_TESSELLATION_NV 0x86D6 -#define GL_MAX_RATIONAL_EVAL_ORDER_NV 0x86D7 -#endif - -#ifndef GL_NV_packed_depth_stencil -#define GL_DEPTH_STENCIL_NV 0x84F9 -#define GL_UNSIGNED_INT_24_8_NV 0x84FA -#endif - -#ifndef GL_NV_register_combiners2 -#define GL_PER_STAGE_CONSTANTS_NV 0x8535 -#endif - -#ifndef GL_NV_texture_compression_vtc -#endif - -#ifndef GL_NV_texture_rectangle -#define GL_TEXTURE_RECTANGLE_NV 0x84F5 -#define GL_TEXTURE_BINDING_RECTANGLE_NV 0x84F6 -#define GL_PROXY_TEXTURE_RECTANGLE_NV 0x84F7 -#define GL_MAX_RECTANGLE_TEXTURE_SIZE_NV 0x84F8 -#endif - -#ifndef GL_NV_texture_shader -#define GL_OFFSET_TEXTURE_RECTANGLE_NV 0x864C -#define GL_OFFSET_TEXTURE_RECTANGLE_SCALE_NV 0x864D -#define GL_DOT_PRODUCT_TEXTURE_RECTANGLE_NV 0x864E -#define GL_RGBA_UNSIGNED_DOT_PRODUCT_MAPPING_NV 0x86D9 -#define GL_UNSIGNED_INT_S8_S8_8_8_NV 0x86DA -#define GL_UNSIGNED_INT_8_8_S8_S8_REV_NV 0x86DB -#define GL_DSDT_MAG_INTENSITY_NV 0x86DC -#define GL_SHADER_CONSISTENT_NV 0x86DD -#define GL_TEXTURE_SHADER_NV 0x86DE -#define GL_SHADER_OPERATION_NV 0x86DF -#define GL_CULL_MODES_NV 0x86E0 -#define GL_OFFSET_TEXTURE_MATRIX_NV 0x86E1 -#define GL_OFFSET_TEXTURE_SCALE_NV 0x86E2 -#define GL_OFFSET_TEXTURE_BIAS_NV 0x86E3 -#define GL_OFFSET_TEXTURE_2D_MATRIX_NV GL_OFFSET_TEXTURE_MATRIX_NV -#define GL_OFFSET_TEXTURE_2D_SCALE_NV GL_OFFSET_TEXTURE_SCALE_NV -#define GL_OFFSET_TEXTURE_2D_BIAS_NV GL_OFFSET_TEXTURE_BIAS_NV -#define GL_PREVIOUS_TEXTURE_INPUT_NV 0x86E4 -#define GL_CONST_EYE_NV 0x86E5 -#define GL_PASS_THROUGH_NV 0x86E6 -#define GL_CULL_FRAGMENT_NV 0x86E7 -#define GL_OFFSET_TEXTURE_2D_NV 0x86E8 -#define GL_DEPENDENT_AR_TEXTURE_2D_NV 0x86E9 -#define GL_DEPENDENT_GB_TEXTURE_2D_NV 0x86EA -#define GL_DOT_PRODUCT_NV 0x86EC -#define GL_DOT_PRODUCT_DEPTH_REPLACE_NV 0x86ED -#define GL_DOT_PRODUCT_TEXTURE_2D_NV 0x86EE -#define GL_DOT_PRODUCT_TEXTURE_CUBE_MAP_NV 0x86F0 -#define GL_DOT_PRODUCT_DIFFUSE_CUBE_MAP_NV 0x86F1 -#define GL_DOT_PRODUCT_REFLECT_CUBE_MAP_NV 0x86F2 -#define GL_DOT_PRODUCT_CONST_EYE_REFLECT_CUBE_MAP_NV 0x86F3 -#define GL_HILO_NV 0x86F4 -#define GL_DSDT_NV 0x86F5 -#define GL_DSDT_MAG_NV 0x86F6 -#define GL_DSDT_MAG_VIB_NV 0x86F7 -#define GL_HILO16_NV 0x86F8 -#define GL_SIGNED_HILO_NV 0x86F9 -#define GL_SIGNED_HILO16_NV 0x86FA -#define GL_SIGNED_RGBA_NV 0x86FB -#define GL_SIGNED_RGBA8_NV 0x86FC -#define GL_SIGNED_RGB_NV 0x86FE -#define GL_SIGNED_RGB8_NV 0x86FF -#define GL_SIGNED_LUMINANCE_NV 0x8701 -#define GL_SIGNED_LUMINANCE8_NV 0x8702 -#define GL_SIGNED_LUMINANCE_ALPHA_NV 0x8703 -#define GL_SIGNED_LUMINANCE8_ALPHA8_NV 0x8704 -#define GL_SIGNED_ALPHA_NV 0x8705 -#define GL_SIGNED_ALPHA8_NV 0x8706 -#define GL_SIGNED_INTENSITY_NV 0x8707 -#define GL_SIGNED_INTENSITY8_NV 0x8708 -#define GL_DSDT8_NV 0x8709 -#define GL_DSDT8_MAG8_NV 0x870A -#define GL_DSDT8_MAG8_INTENSITY8_NV 0x870B -#define GL_SIGNED_RGB_UNSIGNED_ALPHA_NV 0x870C -#define GL_SIGNED_RGB8_UNSIGNED_ALPHA8_NV 0x870D -#define GL_HI_SCALE_NV 0x870E -#define GL_LO_SCALE_NV 0x870F -#define GL_DS_SCALE_NV 0x8710 -#define GL_DT_SCALE_NV 0x8711 -#define GL_MAGNITUDE_SCALE_NV 0x8712 -#define GL_VIBRANCE_SCALE_NV 0x8713 -#define GL_HI_BIAS_NV 0x8714 -#define GL_LO_BIAS_NV 0x8715 -#define GL_DS_BIAS_NV 0x8716 -#define GL_DT_BIAS_NV 0x8717 -#define GL_MAGNITUDE_BIAS_NV 0x8718 -#define GL_VIBRANCE_BIAS_NV 0x8719 -#define GL_TEXTURE_BORDER_VALUES_NV 0x871A -#define GL_TEXTURE_HI_SIZE_NV 0x871B -#define GL_TEXTURE_LO_SIZE_NV 0x871C -#define GL_TEXTURE_DS_SIZE_NV 0x871D -#define GL_TEXTURE_DT_SIZE_NV 0x871E -#define GL_TEXTURE_MAG_SIZE_NV 0x871F -#endif - -#ifndef GL_NV_texture_shader2 -#define GL_DOT_PRODUCT_TEXTURE_3D_NV 0x86EF -#endif - -#ifndef GL_NV_vertex_array_range2 -#define GL_VERTEX_ARRAY_RANGE_WITHOUT_FLUSH_NV 0x8533 -#endif - -#ifndef GL_NV_vertex_program -#define GL_VERTEX_PROGRAM_NV 0x8620 -#define GL_VERTEX_STATE_PROGRAM_NV 0x8621 -#define GL_ATTRIB_ARRAY_SIZE_NV 0x8623 -#define GL_ATTRIB_ARRAY_STRIDE_NV 0x8624 -#define GL_ATTRIB_ARRAY_TYPE_NV 0x8625 -#define GL_CURRENT_ATTRIB_NV 0x8626 -#define GL_PROGRAM_LENGTH_NV 0x8627 -#define GL_PROGRAM_STRING_NV 0x8628 -#define GL_MODELVIEW_PROJECTION_NV 0x8629 -#define GL_IDENTITY_NV 0x862A -#define GL_INVERSE_NV 0x862B -#define GL_TRANSPOSE_NV 0x862C -#define GL_INVERSE_TRANSPOSE_NV 0x862D -#define GL_MAX_TRACK_MATRIX_STACK_DEPTH_NV 0x862E -#define GL_MAX_TRACK_MATRICES_NV 0x862F -#define GL_MATRIX0_NV 0x8630 -#define GL_MATRIX1_NV 0x8631 -#define GL_MATRIX2_NV 0x8632 -#define GL_MATRIX3_NV 0x8633 -#define GL_MATRIX4_NV 0x8634 -#define GL_MATRIX5_NV 0x8635 -#define GL_MATRIX6_NV 0x8636 -#define GL_MATRIX7_NV 0x8637 -#define GL_CURRENT_MATRIX_STACK_DEPTH_NV 0x8640 -#define GL_CURRENT_MATRIX_NV 0x8641 -#define GL_VERTEX_PROGRAM_POINT_SIZE_NV 0x8642 -#define GL_VERTEX_PROGRAM_TWO_SIDE_NV 0x8643 -#define GL_PROGRAM_PARAMETER_NV 0x8644 -#define GL_ATTRIB_ARRAY_POINTER_NV 0x8645 -#define GL_PROGRAM_TARGET_NV 0x8646 -#define GL_PROGRAM_RESIDENT_NV 0x8647 -#define GL_TRACK_MATRIX_NV 0x8648 -#define GL_TRACK_MATRIX_TRANSFORM_NV 0x8649 -#define GL_VERTEX_PROGRAM_BINDING_NV 0x864A -#define GL_PROGRAM_ERROR_POSITION_NV 0x864B -#define GL_VERTEX_ATTRIB_ARRAY0_NV 0x8650 -#define GL_VERTEX_ATTRIB_ARRAY1_NV 0x8651 -#define GL_VERTEX_ATTRIB_ARRAY2_NV 0x8652 -#define GL_VERTEX_ATTRIB_ARRAY3_NV 0x8653 -#define GL_VERTEX_ATTRIB_ARRAY4_NV 0x8654 -#define GL_VERTEX_ATTRIB_ARRAY5_NV 0x8655 -#define GL_VERTEX_ATTRIB_ARRAY6_NV 0x8656 -#define GL_VERTEX_ATTRIB_ARRAY7_NV 0x8657 -#define GL_VERTEX_ATTRIB_ARRAY8_NV 0x8658 -#define GL_VERTEX_ATTRIB_ARRAY9_NV 0x8659 -#define GL_VERTEX_ATTRIB_ARRAY10_NV 0x865A -#define GL_VERTEX_ATTRIB_ARRAY11_NV 0x865B -#define GL_VERTEX_ATTRIB_ARRAY12_NV 0x865C -#define GL_VERTEX_ATTRIB_ARRAY13_NV 0x865D -#define GL_VERTEX_ATTRIB_ARRAY14_NV 0x865E -#define GL_VERTEX_ATTRIB_ARRAY15_NV 0x865F -#define GL_MAP1_VERTEX_ATTRIB0_4_NV 0x8660 -#define GL_MAP1_VERTEX_ATTRIB1_4_NV 0x8661 -#define GL_MAP1_VERTEX_ATTRIB2_4_NV 0x8662 -#define GL_MAP1_VERTEX_ATTRIB3_4_NV 0x8663 -#define GL_MAP1_VERTEX_ATTRIB4_4_NV 0x8664 -#define GL_MAP1_VERTEX_ATTRIB5_4_NV 0x8665 -#define GL_MAP1_VERTEX_ATTRIB6_4_NV 0x8666 -#define GL_MAP1_VERTEX_ATTRIB7_4_NV 0x8667 -#define GL_MAP1_VERTEX_ATTRIB8_4_NV 0x8668 -#define GL_MAP1_VERTEX_ATTRIB9_4_NV 0x8669 -#define GL_MAP1_VERTEX_ATTRIB10_4_NV 0x866A -#define GL_MAP1_VERTEX_ATTRIB11_4_NV 0x866B -#define GL_MAP1_VERTEX_ATTRIB12_4_NV 0x866C -#define GL_MAP1_VERTEX_ATTRIB13_4_NV 0x866D -#define GL_MAP1_VERTEX_ATTRIB14_4_NV 0x866E -#define GL_MAP1_VERTEX_ATTRIB15_4_NV 0x866F -#define GL_MAP2_VERTEX_ATTRIB0_4_NV 0x8670 -#define GL_MAP2_VERTEX_ATTRIB1_4_NV 0x8671 -#define GL_MAP2_VERTEX_ATTRIB2_4_NV 0x8672 -#define GL_MAP2_VERTEX_ATTRIB3_4_NV 0x8673 -#define GL_MAP2_VERTEX_ATTRIB4_4_NV 0x8674 -#define GL_MAP2_VERTEX_ATTRIB5_4_NV 0x8675 -#define GL_MAP2_VERTEX_ATTRIB6_4_NV 0x8676 -#define GL_MAP2_VERTEX_ATTRIB7_4_NV 0x8677 -#define GL_MAP2_VERTEX_ATTRIB8_4_NV 0x8678 -#define GL_MAP2_VERTEX_ATTRIB9_4_NV 0x8679 -#define GL_MAP2_VERTEX_ATTRIB10_4_NV 0x867A -#define GL_MAP2_VERTEX_ATTRIB11_4_NV 0x867B -#define GL_MAP2_VERTEX_ATTRIB12_4_NV 0x867C -#define GL_MAP2_VERTEX_ATTRIB13_4_NV 0x867D -#define GL_MAP2_VERTEX_ATTRIB14_4_NV 0x867E -#define GL_MAP2_VERTEX_ATTRIB15_4_NV 0x867F -#endif - -#ifndef GL_SGIX_texture_coordinate_clamp -#define GL_TEXTURE_MAX_CLAMP_S_SGIX 0x8369 -#define GL_TEXTURE_MAX_CLAMP_T_SGIX 0x836A -#define GL_TEXTURE_MAX_CLAMP_R_SGIX 0x836B -#endif - -#ifndef GL_SGIX_scalebias_hint -#define GL_SCALEBIAS_HINT_SGIX 0x8322 -#endif - -#ifndef GL_OML_interlace -#define GL_INTERLACE_OML 0x8980 -#define GL_INTERLACE_READ_OML 0x8981 -#endif - -#ifndef GL_OML_subsample -#define GL_FORMAT_SUBSAMPLE_24_24_OML 0x8982 -#define GL_FORMAT_SUBSAMPLE_244_244_OML 0x8983 -#endif - -#ifndef GL_OML_resample -#define GL_PACK_RESAMPLE_OML 0x8984 -#define GL_UNPACK_RESAMPLE_OML 0x8985 -#define GL_RESAMPLE_REPLICATE_OML 0x8986 -#define GL_RESAMPLE_ZERO_FILL_OML 0x8987 -#define GL_RESAMPLE_AVERAGE_OML 0x8988 -#define GL_RESAMPLE_DECIMATE_OML 0x8989 -#endif - -#ifndef GL_NV_copy_depth_to_color -#define GL_DEPTH_STENCIL_TO_RGBA_NV 0x886E -#define GL_DEPTH_STENCIL_TO_BGRA_NV 0x886F -#endif - -#ifndef GL_ATI_envmap_bumpmap -#define GL_BUMP_ROT_MATRIX_ATI 0x8775 -#define GL_BUMP_ROT_MATRIX_SIZE_ATI 0x8776 -#define GL_BUMP_NUM_TEX_UNITS_ATI 0x8777 -#define GL_BUMP_TEX_UNITS_ATI 0x8778 -#define GL_DUDV_ATI 0x8779 -#define GL_DU8DV8_ATI 0x877A -#define GL_BUMP_ENVMAP_ATI 0x877B -#define GL_BUMP_TARGET_ATI 0x877C -#endif - -#ifndef GL_ATI_fragment_shader -#define GL_FRAGMENT_SHADER_ATI 0x8920 -#define GL_REG_0_ATI 0x8921 -#define GL_REG_1_ATI 0x8922 -#define GL_REG_2_ATI 0x8923 -#define GL_REG_3_ATI 0x8924 -#define GL_REG_4_ATI 0x8925 -#define GL_REG_5_ATI 0x8926 -#define GL_REG_6_ATI 0x8927 -#define GL_REG_7_ATI 0x8928 -#define GL_REG_8_ATI 0x8929 -#define GL_REG_9_ATI 0x892A -#define GL_REG_10_ATI 0x892B -#define GL_REG_11_ATI 0x892C -#define GL_REG_12_ATI 0x892D -#define GL_REG_13_ATI 0x892E -#define GL_REG_14_ATI 0x892F -#define GL_REG_15_ATI 0x8930 -#define GL_REG_16_ATI 0x8931 -#define GL_REG_17_ATI 0x8932 -#define GL_REG_18_ATI 0x8933 -#define GL_REG_19_ATI 0x8934 -#define GL_REG_20_ATI 0x8935 -#define GL_REG_21_ATI 0x8936 -#define GL_REG_22_ATI 0x8937 -#define GL_REG_23_ATI 0x8938 -#define GL_REG_24_ATI 0x8939 -#define GL_REG_25_ATI 0x893A -#define GL_REG_26_ATI 0x893B -#define GL_REG_27_ATI 0x893C -#define GL_REG_28_ATI 0x893D -#define GL_REG_29_ATI 0x893E -#define GL_REG_30_ATI 0x893F -#define GL_REG_31_ATI 0x8940 -#define GL_CON_0_ATI 0x8941 -#define GL_CON_1_ATI 0x8942 -#define GL_CON_2_ATI 0x8943 -#define GL_CON_3_ATI 0x8944 -#define GL_CON_4_ATI 0x8945 -#define GL_CON_5_ATI 0x8946 -#define GL_CON_6_ATI 0x8947 -#define GL_CON_7_ATI 0x8948 -#define GL_CON_8_ATI 0x8949 -#define GL_CON_9_ATI 0x894A -#define GL_CON_10_ATI 0x894B -#define GL_CON_11_ATI 0x894C -#define GL_CON_12_ATI 0x894D -#define GL_CON_13_ATI 0x894E -#define GL_CON_14_ATI 0x894F -#define GL_CON_15_ATI 0x8950 -#define GL_CON_16_ATI 0x8951 -#define GL_CON_17_ATI 0x8952 -#define GL_CON_18_ATI 0x8953 -#define GL_CON_19_ATI 0x8954 -#define GL_CON_20_ATI 0x8955 -#define GL_CON_21_ATI 0x8956 -#define GL_CON_22_ATI 0x8957 -#define GL_CON_23_ATI 0x8958 -#define GL_CON_24_ATI 0x8959 -#define GL_CON_25_ATI 0x895A -#define GL_CON_26_ATI 0x895B -#define GL_CON_27_ATI 0x895C -#define GL_CON_28_ATI 0x895D -#define GL_CON_29_ATI 0x895E -#define GL_CON_30_ATI 0x895F -#define GL_CON_31_ATI 0x8960 -#define GL_MOV_ATI 0x8961 -#define GL_ADD_ATI 0x8963 -#define GL_MUL_ATI 0x8964 -#define GL_SUB_ATI 0x8965 -#define GL_DOT3_ATI 0x8966 -#define GL_DOT4_ATI 0x8967 -#define GL_MAD_ATI 0x8968 -#define GL_LERP_ATI 0x8969 -#define GL_CND_ATI 0x896A -#define GL_CND0_ATI 0x896B -#define GL_DOT2_ADD_ATI 0x896C -#define GL_SECONDARY_INTERPOLATOR_ATI 0x896D -#define GL_NUM_FRAGMENT_REGISTERS_ATI 0x896E -#define GL_NUM_FRAGMENT_CONSTANTS_ATI 0x896F -#define GL_NUM_PASSES_ATI 0x8970 -#define GL_NUM_INSTRUCTIONS_PER_PASS_ATI 0x8971 -#define GL_NUM_INSTRUCTIONS_TOTAL_ATI 0x8972 -#define GL_NUM_INPUT_INTERPOLATOR_COMPONENTS_ATI 0x8973 -#define GL_NUM_LOOPBACK_COMPONENTS_ATI 0x8974 -#define GL_COLOR_ALPHA_PAIRING_ATI 0x8975 -#define GL_SWIZZLE_STR_ATI 0x8976 -#define GL_SWIZZLE_STQ_ATI 0x8977 -#define GL_SWIZZLE_STR_DR_ATI 0x8978 -#define GL_SWIZZLE_STQ_DQ_ATI 0x8979 -#define GL_SWIZZLE_STRQ_ATI 0x897A -#define GL_SWIZZLE_STRQ_DQ_ATI 0x897B -#define GL_RED_BIT_ATI 0x00000001 -#define GL_GREEN_BIT_ATI 0x00000002 -#define GL_BLUE_BIT_ATI 0x00000004 -#define GL_2X_BIT_ATI 0x00000001 -#define GL_4X_BIT_ATI 0x00000002 -#define GL_8X_BIT_ATI 0x00000004 -#define GL_HALF_BIT_ATI 0x00000008 -#define GL_QUARTER_BIT_ATI 0x00000010 -#define GL_EIGHTH_BIT_ATI 0x00000020 -#define GL_SATURATE_BIT_ATI 0x00000040 -#define GL_COMP_BIT_ATI 0x00000002 -#define GL_NEGATE_BIT_ATI 0x00000004 -#define GL_BIAS_BIT_ATI 0x00000008 -#endif - -#ifndef GL_ATI_pn_triangles -#define GL_PN_TRIANGLES_ATI 0x87F0 -#define GL_MAX_PN_TRIANGLES_TESSELATION_LEVEL_ATI 0x87F1 -#define GL_PN_TRIANGLES_POINT_MODE_ATI 0x87F2 -#define GL_PN_TRIANGLES_NORMAL_MODE_ATI 0x87F3 -#define GL_PN_TRIANGLES_TESSELATION_LEVEL_ATI 0x87F4 -#define GL_PN_TRIANGLES_POINT_MODE_LINEAR_ATI 0x87F5 -#define GL_PN_TRIANGLES_POINT_MODE_CUBIC_ATI 0x87F6 -#define GL_PN_TRIANGLES_NORMAL_MODE_LINEAR_ATI 0x87F7 -#define GL_PN_TRIANGLES_NORMAL_MODE_QUADRATIC_ATI 0x87F8 -#endif - -#ifndef GL_ATI_vertex_array_object -#define GL_STATIC_ATI 0x8760 -#define GL_DYNAMIC_ATI 0x8761 -#define GL_PRESERVE_ATI 0x8762 -#define GL_DISCARD_ATI 0x8763 -#define GL_OBJECT_BUFFER_SIZE_ATI 0x8764 -#define GL_OBJECT_BUFFER_USAGE_ATI 0x8765 -#define GL_ARRAY_OBJECT_BUFFER_ATI 0x8766 -#define GL_ARRAY_OBJECT_OFFSET_ATI 0x8767 -#endif - -#ifndef GL_EXT_vertex_shader -#define GL_VERTEX_SHADER_EXT 0x8780 -#define GL_VERTEX_SHADER_BINDING_EXT 0x8781 -#define GL_OP_INDEX_EXT 0x8782 -#define GL_OP_NEGATE_EXT 0x8783 -#define GL_OP_DOT3_EXT 0x8784 -#define GL_OP_DOT4_EXT 0x8785 -#define GL_OP_MUL_EXT 0x8786 -#define GL_OP_ADD_EXT 0x8787 -#define GL_OP_MADD_EXT 0x8788 -#define GL_OP_FRAC_EXT 0x8789 -#define GL_OP_MAX_EXT 0x878A -#define GL_OP_MIN_EXT 0x878B -#define GL_OP_SET_GE_EXT 0x878C -#define GL_OP_SET_LT_EXT 0x878D -#define GL_OP_CLAMP_EXT 0x878E -#define GL_OP_FLOOR_EXT 0x878F -#define GL_OP_ROUND_EXT 0x8790 -#define GL_OP_EXP_BASE_2_EXT 0x8791 -#define GL_OP_LOG_BASE_2_EXT 0x8792 -#define GL_OP_POWER_EXT 0x8793 -#define GL_OP_RECIP_EXT 0x8794 -#define GL_OP_RECIP_SQRT_EXT 0x8795 -#define GL_OP_SUB_EXT 0x8796 -#define GL_OP_CROSS_PRODUCT_EXT 0x8797 -#define GL_OP_MULTIPLY_MATRIX_EXT 0x8798 -#define GL_OP_MOV_EXT 0x8799 -#define GL_OUTPUT_VERTEX_EXT 0x879A -#define GL_OUTPUT_COLOR0_EXT 0x879B -#define GL_OUTPUT_COLOR1_EXT 0x879C -#define GL_OUTPUT_TEXTURE_COORD0_EXT 0x879D -#define GL_OUTPUT_TEXTURE_COORD1_EXT 0x879E -#define GL_OUTPUT_TEXTURE_COORD2_EXT 0x879F -#define GL_OUTPUT_TEXTURE_COORD3_EXT 0x87A0 -#define GL_OUTPUT_TEXTURE_COORD4_EXT 0x87A1 -#define GL_OUTPUT_TEXTURE_COORD5_EXT 0x87A2 -#define GL_OUTPUT_TEXTURE_COORD6_EXT 0x87A3 -#define GL_OUTPUT_TEXTURE_COORD7_EXT 0x87A4 -#define GL_OUTPUT_TEXTURE_COORD8_EXT 0x87A5 -#define GL_OUTPUT_TEXTURE_COORD9_EXT 0x87A6 -#define GL_OUTPUT_TEXTURE_COORD10_EXT 0x87A7 -#define GL_OUTPUT_TEXTURE_COORD11_EXT 0x87A8 -#define GL_OUTPUT_TEXTURE_COORD12_EXT 0x87A9 -#define GL_OUTPUT_TEXTURE_COORD13_EXT 0x87AA -#define GL_OUTPUT_TEXTURE_COORD14_EXT 0x87AB -#define GL_OUTPUT_TEXTURE_COORD15_EXT 0x87AC -#define GL_OUTPUT_TEXTURE_COORD16_EXT 0x87AD -#define GL_OUTPUT_TEXTURE_COORD17_EXT 0x87AE -#define GL_OUTPUT_TEXTURE_COORD18_EXT 0x87AF -#define GL_OUTPUT_TEXTURE_COORD19_EXT 0x87B0 -#define GL_OUTPUT_TEXTURE_COORD20_EXT 0x87B1 -#define GL_OUTPUT_TEXTURE_COORD21_EXT 0x87B2 -#define GL_OUTPUT_TEXTURE_COORD22_EXT 0x87B3 -#define GL_OUTPUT_TEXTURE_COORD23_EXT 0x87B4 -#define GL_OUTPUT_TEXTURE_COORD24_EXT 0x87B5 -#define GL_OUTPUT_TEXTURE_COORD25_EXT 0x87B6 -#define GL_OUTPUT_TEXTURE_COORD26_EXT 0x87B7 -#define GL_OUTPUT_TEXTURE_COORD27_EXT 0x87B8 -#define GL_OUTPUT_TEXTURE_COORD28_EXT 0x87B9 -#define GL_OUTPUT_TEXTURE_COORD29_EXT 0x87BA -#define GL_OUTPUT_TEXTURE_COORD30_EXT 0x87BB -#define GL_OUTPUT_TEXTURE_COORD31_EXT 0x87BC -#define GL_OUTPUT_FOG_EXT 0x87BD -#define GL_SCALAR_EXT 0x87BE -#define GL_VECTOR_EXT 0x87BF -#define GL_MATRIX_EXT 0x87C0 -#define GL_VARIANT_EXT 0x87C1 -#define GL_INVARIANT_EXT 0x87C2 -#define GL_LOCAL_CONSTANT_EXT 0x87C3 -#define GL_LOCAL_EXT 0x87C4 -#define GL_MAX_VERTEX_SHADER_INSTRUCTIONS_EXT 0x87C5 -#define GL_MAX_VERTEX_SHADER_VARIANTS_EXT 0x87C6 -#define GL_MAX_VERTEX_SHADER_INVARIANTS_EXT 0x87C7 -#define GL_MAX_VERTEX_SHADER_LOCAL_CONSTANTS_EXT 0x87C8 -#define GL_MAX_VERTEX_SHADER_LOCALS_EXT 0x87C9 -#define GL_MAX_OPTIMIZED_VERTEX_SHADER_INSTRUCTIONS_EXT 0x87CA -#define GL_MAX_OPTIMIZED_VERTEX_SHADER_VARIANTS_EXT 0x87CB -#define GL_MAX_OPTIMIZED_VERTEX_SHADER_LOCAL_CONSTANTS_EXT 0x87CC -#define GL_MAX_OPTIMIZED_VERTEX_SHADER_INVARIANTS_EXT 0x87CD -#define GL_MAX_OPTIMIZED_VERTEX_SHADER_LOCALS_EXT 0x87CE -#define GL_VERTEX_SHADER_INSTRUCTIONS_EXT 0x87CF -#define GL_VERTEX_SHADER_VARIANTS_EXT 0x87D0 -#define GL_VERTEX_SHADER_INVARIANTS_EXT 0x87D1 -#define GL_VERTEX_SHADER_LOCAL_CONSTANTS_EXT 0x87D2 -#define GL_VERTEX_SHADER_LOCALS_EXT 0x87D3 -#define GL_VERTEX_SHADER_OPTIMIZED_EXT 0x87D4 -#define GL_X_EXT 0x87D5 -#define GL_Y_EXT 0x87D6 -#define GL_Z_EXT 0x87D7 -#define GL_W_EXT 0x87D8 -#define GL_NEGATIVE_X_EXT 0x87D9 -#define GL_NEGATIVE_Y_EXT 0x87DA -#define GL_NEGATIVE_Z_EXT 0x87DB -#define GL_NEGATIVE_W_EXT 0x87DC -#define GL_ZERO_EXT 0x87DD -#define GL_ONE_EXT 0x87DE -#define GL_NEGATIVE_ONE_EXT 0x87DF -#define GL_NORMALIZED_RANGE_EXT 0x87E0 -#define GL_FULL_RANGE_EXT 0x87E1 -#define GL_CURRENT_VERTEX_EXT 0x87E2 -#define GL_MVP_MATRIX_EXT 0x87E3 -#define GL_VARIANT_VALUE_EXT 0x87E4 -#define GL_VARIANT_DATATYPE_EXT 0x87E5 -#define GL_VARIANT_ARRAY_STRIDE_EXT 0x87E6 -#define GL_VARIANT_ARRAY_TYPE_EXT 0x87E7 -#define GL_VARIANT_ARRAY_EXT 0x87E8 -#define GL_VARIANT_ARRAY_POINTER_EXT 0x87E9 -#define GL_INVARIANT_VALUE_EXT 0x87EA -#define GL_INVARIANT_DATATYPE_EXT 0x87EB -#define GL_LOCAL_CONSTANT_VALUE_EXT 0x87EC -#define GL_LOCAL_CONSTANT_DATATYPE_EXT 0x87ED -#endif - -#ifndef GL_ATI_vertex_streams -#define GL_MAX_VERTEX_STREAMS_ATI 0x876B -#define GL_VERTEX_STREAM0_ATI 0x876C -#define GL_VERTEX_STREAM1_ATI 0x876D -#define GL_VERTEX_STREAM2_ATI 0x876E -#define GL_VERTEX_STREAM3_ATI 0x876F -#define GL_VERTEX_STREAM4_ATI 0x8770 -#define GL_VERTEX_STREAM5_ATI 0x8771 -#define GL_VERTEX_STREAM6_ATI 0x8772 -#define GL_VERTEX_STREAM7_ATI 0x8773 -#define GL_VERTEX_SOURCE_ATI 0x8774 -#endif - -#ifndef GL_ATI_element_array -#define GL_ELEMENT_ARRAY_ATI 0x8768 -#define GL_ELEMENT_ARRAY_TYPE_ATI 0x8769 -#define GL_ELEMENT_ARRAY_POINTER_ATI 0x876A -#endif - -#ifndef GL_SUN_mesh_array -#define GL_QUAD_MESH_SUN 0x8614 -#define GL_TRIANGLE_MESH_SUN 0x8615 -#endif - -#ifndef GL_SUN_slice_accum -#define GL_SLICE_ACCUM_SUN 0x85CC -#endif - -#ifndef GL_NV_multisample_filter_hint -#define GL_MULTISAMPLE_FILTER_HINT_NV 0x8534 -#endif - -#ifndef GL_NV_depth_clamp -#define GL_DEPTH_CLAMP_NV 0x864F -#endif - -#ifndef GL_NV_occlusion_query -#define GL_PIXEL_COUNTER_BITS_NV 0x8864 -#define GL_CURRENT_OCCLUSION_QUERY_ID_NV 0x8865 -#define GL_PIXEL_COUNT_NV 0x8866 -#define GL_PIXEL_COUNT_AVAILABLE_NV 0x8867 -#endif - -#ifndef GL_NV_point_sprite -#define GL_POINT_SPRITE_NV 0x8861 -#define GL_COORD_REPLACE_NV 0x8862 -#define GL_POINT_SPRITE_R_MODE_NV 0x8863 -#endif - -#ifndef GL_NV_texture_shader3 -#define GL_OFFSET_PROJECTIVE_TEXTURE_2D_NV 0x8850 -#define GL_OFFSET_PROJECTIVE_TEXTURE_2D_SCALE_NV 0x8851 -#define GL_OFFSET_PROJECTIVE_TEXTURE_RECTANGLE_NV 0x8852 -#define GL_OFFSET_PROJECTIVE_TEXTURE_RECTANGLE_SCALE_NV 0x8853 -#define GL_OFFSET_HILO_TEXTURE_2D_NV 0x8854 -#define GL_OFFSET_HILO_TEXTURE_RECTANGLE_NV 0x8855 -#define GL_OFFSET_HILO_PROJECTIVE_TEXTURE_2D_NV 0x8856 -#define GL_OFFSET_HILO_PROJECTIVE_TEXTURE_RECTANGLE_NV 0x8857 -#define GL_DEPENDENT_HILO_TEXTURE_2D_NV 0x8858 -#define GL_DEPENDENT_RGB_TEXTURE_3D_NV 0x8859 -#define GL_DEPENDENT_RGB_TEXTURE_CUBE_MAP_NV 0x885A -#define GL_DOT_PRODUCT_PASS_THROUGH_NV 0x885B -#define GL_DOT_PRODUCT_TEXTURE_1D_NV 0x885C -#define GL_DOT_PRODUCT_AFFINE_DEPTH_REPLACE_NV 0x885D -#define GL_HILO8_NV 0x885E -#define GL_SIGNED_HILO8_NV 0x885F -#define GL_FORCE_BLUE_TO_ONE_NV 0x8860 -#endif - -#ifndef GL_NV_vertex_program1_1 -#endif - -#ifndef GL_EXT_shadow_funcs -#endif - -#ifndef GL_EXT_stencil_two_side -#define GL_STENCIL_TEST_TWO_SIDE_EXT 0x8910 -#define GL_ACTIVE_STENCIL_FACE_EXT 0x8911 -#endif - -#ifndef GL_ATI_text_fragment_shader -#define GL_TEXT_FRAGMENT_SHADER_ATI 0x8200 -#endif - -#ifndef GL_APPLE_client_storage -#define GL_UNPACK_CLIENT_STORAGE_APPLE 0x85B2 -#endif - -#ifndef GL_APPLE_element_array -#define GL_ELEMENT_ARRAY_APPLE 0x8768 -#define GL_ELEMENT_ARRAY_TYPE_APPLE 0x8769 -#define GL_ELEMENT_ARRAY_POINTER_APPLE 0x876A -#endif - -#ifndef GL_APPLE_fence -#define GL_DRAW_PIXELS_APPLE 0x8A0A -#define GL_FENCE_APPLE 0x8A0B -#endif - -#ifndef GL_APPLE_vertex_array_object -#define GL_VERTEX_ARRAY_BINDING_APPLE 0x85B5 -#endif - -#ifndef GL_APPLE_vertex_array_range -#define GL_VERTEX_ARRAY_RANGE_APPLE 0x851D -#define GL_VERTEX_ARRAY_RANGE_LENGTH_APPLE 0x851E -#define GL_VERTEX_ARRAY_STORAGE_HINT_APPLE 0x851F -#define GL_VERTEX_ARRAY_RANGE_POINTER_APPLE 0x8521 -#define GL_STORAGE_CACHED_APPLE 0x85BE -#define GL_STORAGE_SHARED_APPLE 0x85BF -#endif - -#ifndef GL_APPLE_ycbcr_422 -#define GL_YCBCR_422_APPLE 0x85B9 -#define GL_UNSIGNED_SHORT_8_8_APPLE 0x85BA -#define GL_UNSIGNED_SHORT_8_8_REV_APPLE 0x85BB -#endif - -#ifndef GL_S3_s3tc -#define GL_RGB_S3TC 0x83A0 -#define GL_RGB4_S3TC 0x83A1 -#define GL_RGBA_S3TC 0x83A2 -#define GL_RGBA4_S3TC 0x83A3 -#endif - -#ifndef GL_ATI_draw_buffers -#define GL_MAX_DRAW_BUFFERS_ATI 0x8824 -#define GL_DRAW_BUFFER0_ATI 0x8825 -#define GL_DRAW_BUFFER1_ATI 0x8826 -#define GL_DRAW_BUFFER2_ATI 0x8827 -#define GL_DRAW_BUFFER3_ATI 0x8828 -#define GL_DRAW_BUFFER4_ATI 0x8829 -#define GL_DRAW_BUFFER5_ATI 0x882A -#define GL_DRAW_BUFFER6_ATI 0x882B -#define GL_DRAW_BUFFER7_ATI 0x882C -#define GL_DRAW_BUFFER8_ATI 0x882D -#define GL_DRAW_BUFFER9_ATI 0x882E -#define GL_DRAW_BUFFER10_ATI 0x882F -#define GL_DRAW_BUFFER11_ATI 0x8830 -#define GL_DRAW_BUFFER12_ATI 0x8831 -#define GL_DRAW_BUFFER13_ATI 0x8832 -#define GL_DRAW_BUFFER14_ATI 0x8833 -#define GL_DRAW_BUFFER15_ATI 0x8834 -#endif - -#ifndef GL_ATI_pixel_format_float -#define GL_TYPE_RGBA_FLOAT_ATI 0x8820 -#define GL_COLOR_CLEAR_UNCLAMPED_VALUE_ATI 0x8835 -#endif - -#ifndef GL_ATI_texture_env_combine3 -#define GL_MODULATE_ADD_ATI 0x8744 -#define GL_MODULATE_SIGNED_ADD_ATI 0x8745 -#define GL_MODULATE_SUBTRACT_ATI 0x8746 -#endif - -#ifndef GL_ATI_texture_float -#define GL_RGBA_FLOAT32_ATI 0x8814 -#define GL_RGB_FLOAT32_ATI 0x8815 -#define GL_ALPHA_FLOAT32_ATI 0x8816 -#define GL_INTENSITY_FLOAT32_ATI 0x8817 -#define GL_LUMINANCE_FLOAT32_ATI 0x8818 -#define GL_LUMINANCE_ALPHA_FLOAT32_ATI 0x8819 -#define GL_RGBA_FLOAT16_ATI 0x881A -#define GL_RGB_FLOAT16_ATI 0x881B -#define GL_ALPHA_FLOAT16_ATI 0x881C -#define GL_INTENSITY_FLOAT16_ATI 0x881D -#define GL_LUMINANCE_FLOAT16_ATI 0x881E -#define GL_LUMINANCE_ALPHA_FLOAT16_ATI 0x881F -#endif - -#ifndef GL_NV_float_buffer -#define GL_FLOAT_R_NV 0x8880 -#define GL_FLOAT_RG_NV 0x8881 -#define GL_FLOAT_RGB_NV 0x8882 -#define GL_FLOAT_RGBA_NV 0x8883 -#define GL_FLOAT_R16_NV 0x8884 -#define GL_FLOAT_R32_NV 0x8885 -#define GL_FLOAT_RG16_NV 0x8886 -#define GL_FLOAT_RG32_NV 0x8887 -#define GL_FLOAT_RGB16_NV 0x8888 -#define GL_FLOAT_RGB32_NV 0x8889 -#define GL_FLOAT_RGBA16_NV 0x888A -#define GL_FLOAT_RGBA32_NV 0x888B -#define GL_TEXTURE_FLOAT_COMPONENTS_NV 0x888C -#define GL_FLOAT_CLEAR_COLOR_VALUE_NV 0x888D -#define GL_FLOAT_RGBA_MODE_NV 0x888E -#endif - -#ifndef GL_NV_fragment_program -#define GL_MAX_FRAGMENT_PROGRAM_LOCAL_PARAMETERS_NV 0x8868 -#define GL_FRAGMENT_PROGRAM_NV 0x8870 -#define GL_MAX_TEXTURE_COORDS_NV 0x8871 -#define GL_MAX_TEXTURE_IMAGE_UNITS_NV 0x8872 -#define GL_FRAGMENT_PROGRAM_BINDING_NV 0x8873 -#define GL_PROGRAM_ERROR_STRING_NV 0x8874 -#endif - -#ifndef GL_NV_half_float -#define GL_HALF_FLOAT_NV 0x140B -#endif - -#ifndef GL_NV_pixel_data_range -#define GL_WRITE_PIXEL_DATA_RANGE_NV 0x8878 -#define GL_READ_PIXEL_DATA_RANGE_NV 0x8879 -#define GL_WRITE_PIXEL_DATA_RANGE_LENGTH_NV 0x887A -#define GL_READ_PIXEL_DATA_RANGE_LENGTH_NV 0x887B -#define GL_WRITE_PIXEL_DATA_RANGE_POINTER_NV 0x887C -#define GL_READ_PIXEL_DATA_RANGE_POINTER_NV 0x887D -#endif - -#ifndef GL_NV_primitive_restart -#define GL_PRIMITIVE_RESTART_NV 0x8558 -#define GL_PRIMITIVE_RESTART_INDEX_NV 0x8559 -#endif - -#ifndef GL_NV_texture_expand_normal -#define GL_TEXTURE_UNSIGNED_REMAP_MODE_NV 0x888F -#endif - -#ifndef GL_NV_vertex_program2 -#endif - -#ifndef GL_ATI_map_object_buffer -#endif - -#ifndef GL_ATI_separate_stencil -#define GL_STENCIL_BACK_FUNC_ATI 0x8800 -#define GL_STENCIL_BACK_FAIL_ATI 0x8801 -#define GL_STENCIL_BACK_PASS_DEPTH_FAIL_ATI 0x8802 -#define GL_STENCIL_BACK_PASS_DEPTH_PASS_ATI 0x8803 -#endif - -#ifndef GL_ATI_vertex_attrib_array_object -#endif - -#ifndef GL_OES_read_format -#define GL_IMPLEMENTATION_COLOR_READ_TYPE_OES 0x8B9A -#define GL_IMPLEMENTATION_COLOR_READ_FORMAT_OES 0x8B9B -#endif - -#ifndef GL_EXT_depth_bounds_test -#define GL_DEPTH_BOUNDS_TEST_EXT 0x8890 -#define GL_DEPTH_BOUNDS_EXT 0x8891 -#endif - -#ifndef GL_EXT_texture_mirror_clamp -#define GL_MIRROR_CLAMP_EXT 0x8742 -#define GL_MIRROR_CLAMP_TO_EDGE_EXT 0x8743 -#define GL_MIRROR_CLAMP_TO_BORDER_EXT 0x8912 -#endif - -#ifndef GL_EXT_blend_equation_separate -#define GL_BLEND_EQUATION_RGB_EXT GL_BLEND_EQUATION -#define GL_BLEND_EQUATION_ALPHA_EXT 0x883D -#endif - -#ifndef GL_MESA_pack_invert -#define GL_PACK_INVERT_MESA 0x8758 -#endif - -#ifndef GL_MESA_ycbcr_texture -#define GL_UNSIGNED_SHORT_8_8_MESA 0x85BA -#define GL_UNSIGNED_SHORT_8_8_REV_MESA 0x85BB -#define GL_YCBCR_MESA 0x8757 -#endif - -#ifndef GL_EXT_pixel_buffer_object -#define GL_PIXEL_PACK_BUFFER_EXT 0x88EB -#define GL_PIXEL_UNPACK_BUFFER_EXT 0x88EC -#define GL_PIXEL_PACK_BUFFER_BINDING_EXT 0x88ED -#define GL_PIXEL_UNPACK_BUFFER_BINDING_EXT 0x88EF -#endif - -#ifndef GL_NV_fragment_program_option -#endif - -#ifndef GL_NV_fragment_program2 -#define GL_MAX_PROGRAM_EXEC_INSTRUCTIONS_NV 0x88F4 -#define GL_MAX_PROGRAM_CALL_DEPTH_NV 0x88F5 -#define GL_MAX_PROGRAM_IF_DEPTH_NV 0x88F6 -#define GL_MAX_PROGRAM_LOOP_DEPTH_NV 0x88F7 -#define GL_MAX_PROGRAM_LOOP_COUNT_NV 0x88F8 -#endif - -#ifndef GL_NV_vertex_program2_option -/* reuse GL_MAX_PROGRAM_EXEC_INSTRUCTIONS_NV */ -/* reuse GL_MAX_PROGRAM_CALL_DEPTH_NV */ -#endif - -#ifndef GL_NV_vertex_program3 -/* reuse GL_MAX_VERTEX_TEXTURE_IMAGE_UNITS_ARB */ -#endif - -#ifndef GL_EXT_framebuffer_object -#define GL_INVALID_FRAMEBUFFER_OPERATION_EXT 0x0506 -#define GL_MAX_RENDERBUFFER_SIZE_EXT 0x84E8 -#define GL_FRAMEBUFFER_BINDING_EXT 0x8CA6 -#define GL_RENDERBUFFER_BINDING_EXT 0x8CA7 -#define GL_FRAMEBUFFER_ATTACHMENT_OBJECT_TYPE_EXT 0x8CD0 -#define GL_FRAMEBUFFER_ATTACHMENT_OBJECT_NAME_EXT 0x8CD1 -#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_LEVEL_EXT 0x8CD2 -#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_CUBE_MAP_FACE_EXT 0x8CD3 -#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_3D_ZOFFSET_EXT 0x8CD4 -#define GL_FRAMEBUFFER_COMPLETE_EXT 0x8CD5 -#define GL_FRAMEBUFFER_INCOMPLETE_ATTACHMENT_EXT 0x8CD6 -#define GL_FRAMEBUFFER_INCOMPLETE_MISSING_ATTACHMENT_EXT 0x8CD7 -#define GL_FRAMEBUFFER_INCOMPLETE_DIMENSIONS_EXT 0x8CD9 -#define GL_FRAMEBUFFER_INCOMPLETE_FORMATS_EXT 0x8CDA -#define GL_FRAMEBUFFER_INCOMPLETE_DRAW_BUFFER_EXT 0x8CDB -#define GL_FRAMEBUFFER_INCOMPLETE_READ_BUFFER_EXT 0x8CDC -#define GL_FRAMEBUFFER_UNSUPPORTED_EXT 0x8CDD -#define GL_MAX_COLOR_ATTACHMENTS_EXT 0x8CDF -#define GL_COLOR_ATTACHMENT0_EXT 0x8CE0 -#define GL_COLOR_ATTACHMENT1_EXT 0x8CE1 -#define GL_COLOR_ATTACHMENT2_EXT 0x8CE2 -#define GL_COLOR_ATTACHMENT3_EXT 0x8CE3 -#define GL_COLOR_ATTACHMENT4_EXT 0x8CE4 -#define GL_COLOR_ATTACHMENT5_EXT 0x8CE5 -#define GL_COLOR_ATTACHMENT6_EXT 0x8CE6 -#define GL_COLOR_ATTACHMENT7_EXT 0x8CE7 -#define GL_COLOR_ATTACHMENT8_EXT 0x8CE8 -#define GL_COLOR_ATTACHMENT9_EXT 0x8CE9 -#define GL_COLOR_ATTACHMENT10_EXT 0x8CEA -#define GL_COLOR_ATTACHMENT11_EXT 0x8CEB -#define GL_COLOR_ATTACHMENT12_EXT 0x8CEC -#define GL_COLOR_ATTACHMENT13_EXT 0x8CED -#define GL_COLOR_ATTACHMENT14_EXT 0x8CEE -#define GL_COLOR_ATTACHMENT15_EXT 0x8CEF -#define GL_DEPTH_ATTACHMENT_EXT 0x8D00 -#define GL_STENCIL_ATTACHMENT_EXT 0x8D20 -#define GL_FRAMEBUFFER_EXT 0x8D40 -#define GL_RENDERBUFFER_EXT 0x8D41 -#define GL_RENDERBUFFER_WIDTH_EXT 0x8D42 -#define GL_RENDERBUFFER_HEIGHT_EXT 0x8D43 -#define GL_RENDERBUFFER_INTERNAL_FORMAT_EXT 0x8D44 -#define GL_STENCIL_INDEX1_EXT 0x8D46 -#define GL_STENCIL_INDEX4_EXT 0x8D47 -#define GL_STENCIL_INDEX8_EXT 0x8D48 -#define GL_STENCIL_INDEX16_EXT 0x8D49 -#define GL_RENDERBUFFER_RED_SIZE_EXT 0x8D50 -#define GL_RENDERBUFFER_GREEN_SIZE_EXT 0x8D51 -#define GL_RENDERBUFFER_BLUE_SIZE_EXT 0x8D52 -#define GL_RENDERBUFFER_ALPHA_SIZE_EXT 0x8D53 -#define GL_RENDERBUFFER_DEPTH_SIZE_EXT 0x8D54 -#define GL_RENDERBUFFER_STENCIL_SIZE_EXT 0x8D55 -#endif - -#ifndef GL_GREMEDY_string_marker -#endif - -#ifndef GL_EXT_packed_depth_stencil -#define GL_DEPTH_STENCIL_EXT 0x84F9 -#define GL_UNSIGNED_INT_24_8_EXT 0x84FA -#define GL_DEPTH24_STENCIL8_EXT 0x88F0 -#define GL_TEXTURE_STENCIL_SIZE_EXT 0x88F1 -#endif - -#ifndef GL_EXT_stencil_clear_tag -#define GL_STENCIL_TAG_BITS_EXT 0x88F2 -#define GL_STENCIL_CLEAR_TAG_VALUE_EXT 0x88F3 -#endif - -#ifndef GL_EXT_texture_sRGB -#define GL_SRGB_EXT 0x8C40 -#define GL_SRGB8_EXT 0x8C41 -#define GL_SRGB_ALPHA_EXT 0x8C42 -#define GL_SRGB8_ALPHA8_EXT 0x8C43 -#define GL_SLUMINANCE_ALPHA_EXT 0x8C44 -#define GL_SLUMINANCE8_ALPHA8_EXT 0x8C45 -#define GL_SLUMINANCE_EXT 0x8C46 -#define GL_SLUMINANCE8_EXT 0x8C47 -#define GL_COMPRESSED_SRGB_EXT 0x8C48 -#define GL_COMPRESSED_SRGB_ALPHA_EXT 0x8C49 -#define GL_COMPRESSED_SLUMINANCE_EXT 0x8C4A -#define GL_COMPRESSED_SLUMINANCE_ALPHA_EXT 0x8C4B -#define GL_COMPRESSED_SRGB_S3TC_DXT1_EXT 0x8C4C -#define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT1_EXT 0x8C4D -#define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT3_EXT 0x8C4E -#define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT5_EXT 0x8C4F -#endif - -#ifndef GL_EXT_framebuffer_blit -#define GL_READ_FRAMEBUFFER_EXT 0x8CA8 -#define GL_DRAW_FRAMEBUFFER_EXT 0x8CA9 -#define GL_READ_FRAMEBUFFER_BINDING_EXT GL_FRAMEBUFFER_BINDING_EXT -#define GL_DRAW_FRAMEBUFFER_BINDING_EXT 0x8CAA -#endif - -#ifndef GL_EXT_framebuffer_multisample -#define GL_RENDERBUFFER_SAMPLES_EXT 0x8CAB -#define GL_FRAMEBUFFER_INCOMPLETE_MULTISAMPLE_EXT 0x8D56 -#define GL_MAX_SAMPLES_EXT 0x8D57 -#endif - -#ifndef GL_MESAX_texture_stack -#define GL_TEXTURE_1D_STACK_MESAX 0x8759 -#define GL_TEXTURE_2D_STACK_MESAX 0x875A -#define GL_PROXY_TEXTURE_1D_STACK_MESAX 0x875B -#define GL_PROXY_TEXTURE_2D_STACK_MESAX 0x875C -#define GL_TEXTURE_1D_STACK_BINDING_MESAX 0x875D -#define GL_TEXTURE_2D_STACK_BINDING_MESAX 0x875E -#endif - -#ifndef GL_EXT_timer_query -#define GL_TIME_ELAPSED_EXT 0x88BF -#endif - -#ifndef GL_EXT_gpu_program_parameters -#endif - -#ifndef GL_APPLE_flush_buffer_range -#define GL_BUFFER_SERIALIZED_MODIFY_APPLE 0x8A12 -#define GL_BUFFER_FLUSHING_UNMAP_APPLE 0x8A13 -#endif - -#ifndef GL_NV_gpu_program4 -#define GL_MIN_PROGRAM_TEXEL_OFFSET_NV 0x8904 -#define GL_MAX_PROGRAM_TEXEL_OFFSET_NV 0x8905 -#define GL_PROGRAM_ATTRIB_COMPONENTS_NV 0x8906 -#define GL_PROGRAM_RESULT_COMPONENTS_NV 0x8907 -#define GL_MAX_PROGRAM_ATTRIB_COMPONENTS_NV 0x8908 -#define GL_MAX_PROGRAM_RESULT_COMPONENTS_NV 0x8909 -#define GL_MAX_PROGRAM_GENERIC_ATTRIBS_NV 0x8DA5 -#define GL_MAX_PROGRAM_GENERIC_RESULTS_NV 0x8DA6 -#endif - -#ifndef GL_NV_geometry_program4 -#define GL_LINES_ADJACENCY_EXT 0x000A -#define GL_LINE_STRIP_ADJACENCY_EXT 0x000B -#define GL_TRIANGLES_ADJACENCY_EXT 0x000C -#define GL_TRIANGLE_STRIP_ADJACENCY_EXT 0x000D -#define GL_GEOMETRY_PROGRAM_NV 0x8C26 -#define GL_MAX_PROGRAM_OUTPUT_VERTICES_NV 0x8C27 -#define GL_MAX_PROGRAM_TOTAL_OUTPUT_COMPONENTS_NV 0x8C28 -#define GL_GEOMETRY_VERTICES_OUT_EXT 0x8DDA -#define GL_GEOMETRY_INPUT_TYPE_EXT 0x8DDB -#define GL_GEOMETRY_OUTPUT_TYPE_EXT 0x8DDC -#define GL_MAX_GEOMETRY_TEXTURE_IMAGE_UNITS_EXT 0x8C29 -#define GL_FRAMEBUFFER_ATTACHMENT_LAYERED_EXT 0x8DA7 -#define GL_FRAMEBUFFER_INCOMPLETE_LAYER_TARGETS_EXT 0x8DA8 -#define GL_FRAMEBUFFER_INCOMPLETE_LAYER_COUNT_EXT 0x8DA9 -#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_LAYER_EXT 0x8CD4 -#define GL_PROGRAM_POINT_SIZE_EXT 0x8642 -#endif - -#ifndef GL_EXT_geometry_shader4 -#define GL_GEOMETRY_SHADER_EXT 0x8DD9 -/* reuse GL_GEOMETRY_VERTICES_OUT_EXT */ -/* reuse GL_GEOMETRY_INPUT_TYPE_EXT */ -/* reuse GL_GEOMETRY_OUTPUT_TYPE_EXT */ -/* reuse GL_MAX_GEOMETRY_TEXTURE_IMAGE_UNITS_EXT */ -#define GL_MAX_GEOMETRY_VARYING_COMPONENTS_EXT 0x8DDD -#define GL_MAX_VERTEX_VARYING_COMPONENTS_EXT 0x8DDE -#define GL_MAX_VARYING_COMPONENTS_EXT 0x8B4B -#define GL_MAX_GEOMETRY_UNIFORM_COMPONENTS_EXT 0x8DDF -#define GL_MAX_GEOMETRY_OUTPUT_VERTICES_EXT 0x8DE0 -#define GL_MAX_GEOMETRY_TOTAL_OUTPUT_COMPONENTS_EXT 0x8DE1 -/* reuse GL_LINES_ADJACENCY_EXT */ -/* reuse GL_LINE_STRIP_ADJACENCY_EXT */ -/* reuse GL_TRIANGLES_ADJACENCY_EXT */ -/* reuse GL_TRIANGLE_STRIP_ADJACENCY_EXT */ -/* reuse GL_FRAMEBUFFER_INCOMPLETE_LAYER_TARGETS_EXT */ -/* reuse GL_FRAMEBUFFER_INCOMPLETE_LAYER_COUNT_EXT */ -/* reuse GL_FRAMEBUFFER_ATTACHMENT_LAYERED_EXT */ -/* reuse GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_LAYER_EXT */ -/* reuse GL_PROGRAM_POINT_SIZE_EXT */ -#endif - -#ifndef GL_NV_vertex_program4 -#define GL_VERTEX_ATTRIB_ARRAY_INTEGER_NV 0x88FD -#endif - -#ifndef GL_EXT_gpu_shader4 -#define GL_SAMPLER_1D_ARRAY_EXT 0x8DC0 -#define GL_SAMPLER_2D_ARRAY_EXT 0x8DC1 -#define GL_SAMPLER_BUFFER_EXT 0x8DC2 -#define GL_SAMPLER_1D_ARRAY_SHADOW_EXT 0x8DC3 -#define GL_SAMPLER_2D_ARRAY_SHADOW_EXT 0x8DC4 -#define GL_SAMPLER_CUBE_SHADOW_EXT 0x8DC5 -#define GL_UNSIGNED_INT_VEC2_EXT 0x8DC6 -#define GL_UNSIGNED_INT_VEC3_EXT 0x8DC7 -#define GL_UNSIGNED_INT_VEC4_EXT 0x8DC8 -#define GL_INT_SAMPLER_1D_EXT 0x8DC9 -#define GL_INT_SAMPLER_2D_EXT 0x8DCA -#define GL_INT_SAMPLER_3D_EXT 0x8DCB -#define GL_INT_SAMPLER_CUBE_EXT 0x8DCC -#define GL_INT_SAMPLER_2D_RECT_EXT 0x8DCD -#define GL_INT_SAMPLER_1D_ARRAY_EXT 0x8DCE -#define GL_INT_SAMPLER_2D_ARRAY_EXT 0x8DCF -#define GL_INT_SAMPLER_BUFFER_EXT 0x8DD0 -#define GL_UNSIGNED_INT_SAMPLER_1D_EXT 0x8DD1 -#define GL_UNSIGNED_INT_SAMPLER_2D_EXT 0x8DD2 -#define GL_UNSIGNED_INT_SAMPLER_3D_EXT 0x8DD3 -#define GL_UNSIGNED_INT_SAMPLER_CUBE_EXT 0x8DD4 -#define GL_UNSIGNED_INT_SAMPLER_2D_RECT_EXT 0x8DD5 -#define GL_UNSIGNED_INT_SAMPLER_1D_ARRAY_EXT 0x8DD6 -#define GL_UNSIGNED_INT_SAMPLER_2D_ARRAY_EXT 0x8DD7 -#define GL_UNSIGNED_INT_SAMPLER_BUFFER_EXT 0x8DD8 -#endif - -#ifndef GL_EXT_draw_instanced -#endif - -#ifndef GL_EXT_packed_float -#define GL_R11F_G11F_B10F_EXT 0x8C3A -#define GL_UNSIGNED_INT_10F_11F_11F_REV_EXT 0x8C3B -#define GL_RGBA_SIGNED_COMPONENTS_EXT 0x8C3C -#endif - -#ifndef GL_EXT_texture_array -#define GL_TEXTURE_1D_ARRAY_EXT 0x8C18 -#define GL_PROXY_TEXTURE_1D_ARRAY_EXT 0x8C19 -#define GL_TEXTURE_2D_ARRAY_EXT 0x8C1A -#define GL_PROXY_TEXTURE_2D_ARRAY_EXT 0x8C1B -#define GL_TEXTURE_BINDING_1D_ARRAY_EXT 0x8C1C -#define GL_TEXTURE_BINDING_2D_ARRAY_EXT 0x8C1D -#define GL_MAX_ARRAY_TEXTURE_LAYERS_EXT 0x88FF -#define GL_COMPARE_REF_DEPTH_TO_TEXTURE_EXT 0x884E -/* reuse GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_LAYER_EXT */ -#endif - -#ifndef GL_EXT_texture_buffer_object -#define GL_TEXTURE_BUFFER_EXT 0x8C2A -#define GL_MAX_TEXTURE_BUFFER_SIZE_EXT 0x8C2B -#define GL_TEXTURE_BINDING_BUFFER_EXT 0x8C2C -#define GL_TEXTURE_BUFFER_DATA_STORE_BINDING_EXT 0x8C2D -#define GL_TEXTURE_BUFFER_FORMAT_EXT 0x8C2E -#endif - -#ifndef GL_EXT_texture_compression_latc -#define GL_COMPRESSED_LUMINANCE_LATC1_EXT 0x8C70 -#define GL_COMPRESSED_SIGNED_LUMINANCE_LATC1_EXT 0x8C71 -#define GL_COMPRESSED_LUMINANCE_ALPHA_LATC2_EXT 0x8C72 -#define GL_COMPRESSED_SIGNED_LUMINANCE_ALPHA_LATC2_EXT 0x8C73 -#endif - -#ifndef GL_EXT_texture_compression_rgtc -#define GL_COMPRESSED_RED_RGTC1_EXT 0x8DBB -#define GL_COMPRESSED_SIGNED_RED_RGTC1_EXT 0x8DBC -#define GL_COMPRESSED_RED_GREEN_RGTC2_EXT 0x8DBD -#define GL_COMPRESSED_SIGNED_RED_GREEN_RGTC2_EXT 0x8DBE -#endif - -#ifndef GL_EXT_texture_shared_exponent -#define GL_RGB9_E5_EXT 0x8C3D -#define GL_UNSIGNED_INT_5_9_9_9_REV_EXT 0x8C3E -#define GL_TEXTURE_SHARED_SIZE_EXT 0x8C3F -#endif - -#ifndef GL_NV_depth_buffer_float -#define GL_DEPTH_COMPONENT32F_NV 0x8DAB -#define GL_DEPTH32F_STENCIL8_NV 0x8DAC -#define GL_FLOAT_32_UNSIGNED_INT_24_8_REV_NV 0x8DAD -#define GL_DEPTH_BUFFER_FLOAT_MODE_NV 0x8DAF -#endif - -#ifndef GL_NV_fragment_program4 -#endif - -#ifndef GL_NV_framebuffer_multisample_coverage -#define GL_RENDERBUFFER_COVERAGE_SAMPLES_NV 0x8CAB -#define GL_RENDERBUFFER_COLOR_SAMPLES_NV 0x8E10 -#define GL_MAX_MULTISAMPLE_COVERAGE_MODES_NV 0x8E11 -#define GL_MULTISAMPLE_COVERAGE_MODES_NV 0x8E12 -#endif - -#ifndef GL_EXT_framebuffer_sRGB -#define GL_FRAMEBUFFER_SRGB_EXT 0x8DB9 -#define GL_FRAMEBUFFER_SRGB_CAPABLE_EXT 0x8DBA -#endif - -#ifndef GL_NV_geometry_shader4 -#endif - -#ifndef GL_NV_parameter_buffer_object -#define GL_MAX_PROGRAM_PARAMETER_BUFFER_BINDINGS_NV 0x8DA0 -#define GL_MAX_PROGRAM_PARAMETER_BUFFER_SIZE_NV 0x8DA1 -#define GL_VERTEX_PROGRAM_PARAMETER_BUFFER_NV 0x8DA2 -#define GL_GEOMETRY_PROGRAM_PARAMETER_BUFFER_NV 0x8DA3 -#define GL_FRAGMENT_PROGRAM_PARAMETER_BUFFER_NV 0x8DA4 -#endif - -#ifndef GL_EXT_draw_buffers2 -#endif - -#ifndef GL_NV_transform_feedback -#define GL_BACK_PRIMARY_COLOR_NV 0x8C77 -#define GL_BACK_SECONDARY_COLOR_NV 0x8C78 -#define GL_TEXTURE_COORD_NV 0x8C79 -#define GL_CLIP_DISTANCE_NV 0x8C7A -#define GL_VERTEX_ID_NV 0x8C7B -#define GL_PRIMITIVE_ID_NV 0x8C7C -#define GL_GENERIC_ATTRIB_NV 0x8C7D -#define GL_TRANSFORM_FEEDBACK_ATTRIBS_NV 0x8C7E -#define GL_TRANSFORM_FEEDBACK_BUFFER_MODE_NV 0x8C7F -#define GL_MAX_TRANSFORM_FEEDBACK_SEPARATE_COMPONENTS_NV 0x8C80 -#define GL_ACTIVE_VARYINGS_NV 0x8C81 -#define GL_ACTIVE_VARYING_MAX_LENGTH_NV 0x8C82 -#define GL_TRANSFORM_FEEDBACK_VARYINGS_NV 0x8C83 -#define GL_TRANSFORM_FEEDBACK_BUFFER_START_NV 0x8C84 -#define GL_TRANSFORM_FEEDBACK_BUFFER_SIZE_NV 0x8C85 -#define GL_TRANSFORM_FEEDBACK_RECORD_NV 0x8C86 -#define GL_PRIMITIVES_GENERATED_NV 0x8C87 -#define GL_TRANSFORM_FEEDBACK_PRIMITIVES_WRITTEN_NV 0x8C88 -#define GL_RASTERIZER_DISCARD_NV 0x8C89 -#define GL_MAX_TRANSFORM_FEEDBACK_INTERLEAVED_ATTRIBS_NV 0x8C8A -#define GL_MAX_TRANSFORM_FEEDBACK_SEPARATE_ATTRIBS_NV 0x8C8B -#define GL_INTERLEAVED_ATTRIBS_NV 0x8C8C -#define GL_SEPARATE_ATTRIBS_NV 0x8C8D -#define GL_TRANSFORM_FEEDBACK_BUFFER_NV 0x8C8E -#define GL_TRANSFORM_FEEDBACK_BUFFER_BINDING_NV 0x8C8F -#endif - -#ifndef GL_EXT_bindable_uniform -#define GL_MAX_VERTEX_BINDABLE_UNIFORMS_EXT 0x8DE2 -#define GL_MAX_FRAGMENT_BINDABLE_UNIFORMS_EXT 0x8DE3 -#define GL_MAX_GEOMETRY_BINDABLE_UNIFORMS_EXT 0x8DE4 -#define GL_MAX_BINDABLE_UNIFORM_SIZE_EXT 0x8DED -#define GL_UNIFORM_BUFFER_EXT 0x8DEE -#define GL_UNIFORM_BUFFER_BINDING_EXT 0x8DEF -#endif - -#ifndef GL_EXT_texture_integer -#define GL_RGBA32UI_EXT 0x8D70 -#define GL_RGB32UI_EXT 0x8D71 -#define GL_ALPHA32UI_EXT 0x8D72 -#define GL_INTENSITY32UI_EXT 0x8D73 -#define GL_LUMINANCE32UI_EXT 0x8D74 -#define GL_LUMINANCE_ALPHA32UI_EXT 0x8D75 -#define GL_RGBA16UI_EXT 0x8D76 -#define GL_RGB16UI_EXT 0x8D77 -#define GL_ALPHA16UI_EXT 0x8D78 -#define GL_INTENSITY16UI_EXT 0x8D79 -#define GL_LUMINANCE16UI_EXT 0x8D7A -#define GL_LUMINANCE_ALPHA16UI_EXT 0x8D7B -#define GL_RGBA8UI_EXT 0x8D7C -#define GL_RGB8UI_EXT 0x8D7D -#define GL_ALPHA8UI_EXT 0x8D7E -#define GL_INTENSITY8UI_EXT 0x8D7F -#define GL_LUMINANCE8UI_EXT 0x8D80 -#define GL_LUMINANCE_ALPHA8UI_EXT 0x8D81 -#define GL_RGBA32I_EXT 0x8D82 -#define GL_RGB32I_EXT 0x8D83 -#define GL_ALPHA32I_EXT 0x8D84 -#define GL_INTENSITY32I_EXT 0x8D85 -#define GL_LUMINANCE32I_EXT 0x8D86 -#define GL_LUMINANCE_ALPHA32I_EXT 0x8D87 -#define GL_RGBA16I_EXT 0x8D88 -#define GL_RGB16I_EXT 0x8D89 -#define GL_ALPHA16I_EXT 0x8D8A -#define GL_INTENSITY16I_EXT 0x8D8B -#define GL_LUMINANCE16I_EXT 0x8D8C -#define GL_LUMINANCE_ALPHA16I_EXT 0x8D8D -#define GL_RGBA8I_EXT 0x8D8E -#define GL_RGB8I_EXT 0x8D8F -#define GL_ALPHA8I_EXT 0x8D90 -#define GL_INTENSITY8I_EXT 0x8D91 -#define GL_LUMINANCE8I_EXT 0x8D92 -#define GL_LUMINANCE_ALPHA8I_EXT 0x8D93 -#define GL_RED_INTEGER_EXT 0x8D94 -#define GL_GREEN_INTEGER_EXT 0x8D95 -#define GL_BLUE_INTEGER_EXT 0x8D96 -#define GL_ALPHA_INTEGER_EXT 0x8D97 -#define GL_RGB_INTEGER_EXT 0x8D98 -#define GL_RGBA_INTEGER_EXT 0x8D99 -#define GL_BGR_INTEGER_EXT 0x8D9A -#define GL_BGRA_INTEGER_EXT 0x8D9B -#define GL_LUMINANCE_INTEGER_EXT 0x8D9C -#define GL_LUMINANCE_ALPHA_INTEGER_EXT 0x8D9D -#define GL_RGBA_INTEGER_MODE_EXT 0x8D9E -#endif - -#ifndef GL_GREMEDY_frame_terminator -#endif - - -/*************************************************************/ - -#include -#ifndef GL_VERSION_2_0 -/* GL type for program/shader text */ -typedef char GLchar; /* native character */ -#endif - -#ifndef GL_VERSION_1_5 -/* GL types for handling large vertex buffer objects */ -typedef ptrdiff_t GLintptr; -typedef ptrdiff_t GLsizeiptr; -#endif - -#ifndef GL_ARB_vertex_buffer_object -/* GL types for handling large vertex buffer objects */ -typedef ptrdiff_t GLintptrARB; -typedef ptrdiff_t GLsizeiptrARB; -#endif - -#ifndef GL_ARB_shader_objects -/* GL types for handling shader object handles and program/shader text */ -typedef char GLcharARB; /* native character */ -typedef unsigned int GLhandleARB; /* shader object handle */ -#endif - -/* GL types for "half" precision (s10e5) float data in host memory */ -#ifndef GL_ARB_half_float_pixel -typedef unsigned short GLhalfARB; -#endif - -#ifndef GL_NV_half_float -typedef unsigned short GLhalfNV; -#endif - -#ifndef GLEXT_64_TYPES_DEFINED -/* This code block is duplicated in glext.h, so must be protected */ -#define GLEXT_64_TYPES_DEFINED -/* Define int32_t, int64_t, and uint64_t types for UST/MSC */ -/* (as used in the GL_EXT_timer_query extension). */ -#if defined(__STDC_VERSION__) && __STDC_VERSION__ >= 199901L -#include -#elif defined(__sun__) -#include -#if defined(__STDC__) -#if defined(__arch64__) -typedef long int int64_t; -typedef unsigned long int uint64_t; -#else -typedef long long int int64_t; -typedef unsigned long long int uint64_t; -#endif /* __arch64__ */ -#endif /* __STDC__ */ -#elif defined( __VMS ) -#include -#elif defined(__SCO__) || defined(__USLC__) -#include -#elif defined(__UNIXOS2__) || defined(__SOL64__) -typedef long int int32_t; -typedef long long int int64_t; -typedef unsigned long long int uint64_t; -#elif defined(_WIN32) && defined(__GNUC__) -#include -#elif defined(_WIN32) -typedef __int32 int32_t; -typedef __int64 int64_t; -typedef unsigned __int64 uint64_t; -#else -#include /* Fallback option */ -#endif -#endif - -#ifndef GL_EXT_timer_query -typedef int64_t GLint64EXT; -typedef uint64_t GLuint64EXT; -#endif - -#ifndef GL_VERSION_1_2 -#define GL_VERSION_1_2 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glBlendColor (GLclampf, GLclampf, GLclampf, GLclampf); -GLAPI void APIENTRY glBlendEquation (GLenum); -GLAPI void APIENTRY glDrawRangeElements (GLenum, GLuint, GLuint, GLsizei, GLenum, const GLvoid *); -GLAPI void APIENTRY glColorTable (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *); -GLAPI void APIENTRY glColorTableParameterfv (GLenum, GLenum, const GLfloat *); -GLAPI void APIENTRY glColorTableParameteriv (GLenum, GLenum, const GLint *); -GLAPI void APIENTRY glCopyColorTable (GLenum, GLenum, GLint, GLint, GLsizei); -GLAPI void APIENTRY glGetColorTable (GLenum, GLenum, GLenum, GLvoid *); -GLAPI void APIENTRY glGetColorTableParameterfv (GLenum, GLenum, GLfloat *); -GLAPI void APIENTRY glGetColorTableParameteriv (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glColorSubTable (GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); -GLAPI void APIENTRY glCopyColorSubTable (GLenum, GLsizei, GLint, GLint, GLsizei); -GLAPI void APIENTRY glConvolutionFilter1D (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *); -GLAPI void APIENTRY glConvolutionFilter2D (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); -GLAPI void APIENTRY glConvolutionParameterf (GLenum, GLenum, GLfloat); -GLAPI void APIENTRY glConvolutionParameterfv (GLenum, GLenum, const GLfloat *); -GLAPI void APIENTRY glConvolutionParameteri (GLenum, GLenum, GLint); -GLAPI void APIENTRY glConvolutionParameteriv (GLenum, GLenum, const GLint *); -GLAPI void APIENTRY glCopyConvolutionFilter1D (GLenum, GLenum, GLint, GLint, GLsizei); -GLAPI void APIENTRY glCopyConvolutionFilter2D (GLenum, GLenum, GLint, GLint, GLsizei, GLsizei); -GLAPI void APIENTRY glGetConvolutionFilter (GLenum, GLenum, GLenum, GLvoid *); -GLAPI void APIENTRY glGetConvolutionParameterfv (GLenum, GLenum, GLfloat *); -GLAPI void APIENTRY glGetConvolutionParameteriv (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glGetSeparableFilter (GLenum, GLenum, GLenum, GLvoid *, GLvoid *, GLvoid *); -GLAPI void APIENTRY glSeparableFilter2D (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *, const GLvoid *); -GLAPI void APIENTRY glGetHistogram (GLenum, GLboolean, GLenum, GLenum, GLvoid *); -GLAPI void APIENTRY glGetHistogramParameterfv (GLenum, GLenum, GLfloat *); -GLAPI void APIENTRY glGetHistogramParameteriv (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glGetMinmax (GLenum, GLboolean, GLenum, GLenum, GLvoid *); -GLAPI void APIENTRY glGetMinmaxParameterfv (GLenum, GLenum, GLfloat *); -GLAPI void APIENTRY glGetMinmaxParameteriv (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glHistogram (GLenum, GLsizei, GLenum, GLboolean); -GLAPI void APIENTRY glMinmax (GLenum, GLenum, GLboolean); -GLAPI void APIENTRY glResetHistogram (GLenum); -GLAPI void APIENTRY glResetMinmax (GLenum); -GLAPI void APIENTRY glTexImage3D (GLenum, GLint, GLint, GLsizei, GLsizei, GLsizei, GLint, GLenum, GLenum, const GLvoid *); -GLAPI void APIENTRY glTexSubImage3D (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); -GLAPI void APIENTRY glCopyTexSubImage3D (GLenum, GLint, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLBLENDCOLORPROC) (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha); -typedef void (APIENTRYP PFNGLBLENDEQUATIONPROC) (GLenum mode); -typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices); -typedef void (APIENTRYP PFNGLCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *table); -typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params); -typedef void (APIENTRYP PFNGLCOPYCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); -typedef void (APIENTRYP PFNGLGETCOLORTABLEPROC) (GLenum target, GLenum format, GLenum type, GLvoid *table); -typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOPYCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width); -typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *image); -typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *image); -typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFPROC) (GLenum target, GLenum pname, GLfloat params); -typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIPROC) (GLenum target, GLenum pname, GLint params); -typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params); -typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); -typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height); -typedef void (APIENTRYP PFNGLGETCONVOLUTIONFILTERPROC) (GLenum target, GLenum format, GLenum type, GLvoid *image); -typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETSEPARABLEFILTERPROC) (GLenum target, GLenum format, GLenum type, GLvoid *row, GLvoid *column, GLvoid *span); -typedef void (APIENTRYP PFNGLSEPARABLEFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *row, const GLvoid *column); -typedef void (APIENTRYP PFNGLGETHISTOGRAMPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); -typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETMINMAXPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); -typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLHISTOGRAMPROC) (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink); -typedef void (APIENTRYP PFNGLMINMAXPROC) (GLenum target, GLenum internalformat, GLboolean sink); -typedef void (APIENTRYP PFNGLRESETHISTOGRAMPROC) (GLenum target); -typedef void (APIENTRYP PFNGLRESETMINMAXPROC) (GLenum target); -typedef void (APIENTRYP PFNGLTEXIMAGE3DPROC) (GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); -#endif - -#ifndef GL_VERSION_1_3 -#define GL_VERSION_1_3 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glActiveTexture (GLenum); -GLAPI void APIENTRY glClientActiveTexture (GLenum); -GLAPI void APIENTRY glMultiTexCoord1d (GLenum, GLdouble); -GLAPI void APIENTRY glMultiTexCoord1dv (GLenum, const GLdouble *); -GLAPI void APIENTRY glMultiTexCoord1f (GLenum, GLfloat); -GLAPI void APIENTRY glMultiTexCoord1fv (GLenum, const GLfloat *); -GLAPI void APIENTRY glMultiTexCoord1i (GLenum, GLint); -GLAPI void APIENTRY glMultiTexCoord1iv (GLenum, const GLint *); -GLAPI void APIENTRY glMultiTexCoord1s (GLenum, GLshort); -GLAPI void APIENTRY glMultiTexCoord1sv (GLenum, const GLshort *); -GLAPI void APIENTRY glMultiTexCoord2d (GLenum, GLdouble, GLdouble); -GLAPI void APIENTRY glMultiTexCoord2dv (GLenum, const GLdouble *); -GLAPI void APIENTRY glMultiTexCoord2f (GLenum, GLfloat, GLfloat); -GLAPI void APIENTRY glMultiTexCoord2fv (GLenum, const GLfloat *); -GLAPI void APIENTRY glMultiTexCoord2i (GLenum, GLint, GLint); -GLAPI void APIENTRY glMultiTexCoord2iv (GLenum, const GLint *); -GLAPI void APIENTRY glMultiTexCoord2s (GLenum, GLshort, GLshort); -GLAPI void APIENTRY glMultiTexCoord2sv (GLenum, const GLshort *); -GLAPI void APIENTRY glMultiTexCoord3d (GLenum, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glMultiTexCoord3dv (GLenum, const GLdouble *); -GLAPI void APIENTRY glMultiTexCoord3f (GLenum, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glMultiTexCoord3fv (GLenum, const GLfloat *); -GLAPI void APIENTRY glMultiTexCoord3i (GLenum, GLint, GLint, GLint); -GLAPI void APIENTRY glMultiTexCoord3iv (GLenum, const GLint *); -GLAPI void APIENTRY glMultiTexCoord3s (GLenum, GLshort, GLshort, GLshort); -GLAPI void APIENTRY glMultiTexCoord3sv (GLenum, const GLshort *); -GLAPI void APIENTRY glMultiTexCoord4d (GLenum, GLdouble, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glMultiTexCoord4dv (GLenum, const GLdouble *); -GLAPI void APIENTRY glMultiTexCoord4f (GLenum, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glMultiTexCoord4fv (GLenum, const GLfloat *); -GLAPI void APIENTRY glMultiTexCoord4i (GLenum, GLint, GLint, GLint, GLint); -GLAPI void APIENTRY glMultiTexCoord4iv (GLenum, const GLint *); -GLAPI void APIENTRY glMultiTexCoord4s (GLenum, GLshort, GLshort, GLshort, GLshort); -GLAPI void APIENTRY glMultiTexCoord4sv (GLenum, const GLshort *); -GLAPI void APIENTRY glLoadTransposeMatrixf (const GLfloat *); -GLAPI void APIENTRY glLoadTransposeMatrixd (const GLdouble *); -GLAPI void APIENTRY glMultTransposeMatrixf (const GLfloat *); -GLAPI void APIENTRY glMultTransposeMatrixd (const GLdouble *); -GLAPI void APIENTRY glSampleCoverage (GLclampf, GLboolean); -GLAPI void APIENTRY glCompressedTexImage3D (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *); -GLAPI void APIENTRY glCompressedTexImage2D (GLenum, GLint, GLenum, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *); -GLAPI void APIENTRY glCompressedTexImage1D (GLenum, GLint, GLenum, GLsizei, GLint, GLsizei, const GLvoid *); -GLAPI void APIENTRY glCompressedTexSubImage3D (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *); -GLAPI void APIENTRY glCompressedTexSubImage2D (GLenum, GLint, GLint, GLint, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *); -GLAPI void APIENTRY glCompressedTexSubImage1D (GLenum, GLint, GLint, GLsizei, GLenum, GLsizei, const GLvoid *); -GLAPI void APIENTRY glGetCompressedTexImage (GLenum, GLint, GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLACTIVETEXTUREPROC) (GLenum texture); -typedef void (APIENTRYP PFNGLCLIENTACTIVETEXTUREPROC) (GLenum texture); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1DPROC) (GLenum target, GLdouble s); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1DVPROC) (GLenum target, const GLdouble *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1FPROC) (GLenum target, GLfloat s); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1FVPROC) (GLenum target, const GLfloat *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1IPROC) (GLenum target, GLint s); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1IVPROC) (GLenum target, const GLint *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1SPROC) (GLenum target, GLshort s); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1SVPROC) (GLenum target, const GLshort *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2DPROC) (GLenum target, GLdouble s, GLdouble t); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2DVPROC) (GLenum target, const GLdouble *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2FPROC) (GLenum target, GLfloat s, GLfloat t); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2FVPROC) (GLenum target, const GLfloat *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2IPROC) (GLenum target, GLint s, GLint t); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2IVPROC) (GLenum target, const GLint *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2SPROC) (GLenum target, GLshort s, GLshort t); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2SVPROC) (GLenum target, const GLshort *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3DPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3DVPROC) (GLenum target, const GLdouble *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3FPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3FVPROC) (GLenum target, const GLfloat *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3IPROC) (GLenum target, GLint s, GLint t, GLint r); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3IVPROC) (GLenum target, const GLint *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3SPROC) (GLenum target, GLshort s, GLshort t, GLshort r); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3SVPROC) (GLenum target, const GLshort *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4DPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4DVPROC) (GLenum target, const GLdouble *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4FPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4FVPROC) (GLenum target, const GLfloat *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4IPROC) (GLenum target, GLint s, GLint t, GLint r, GLint q); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4IVPROC) (GLenum target, const GLint *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4SPROC) (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4SVPROC) (GLenum target, const GLshort *v); -typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXFPROC) (const GLfloat *m); -typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXDPROC) (const GLdouble *m); -typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXFPROC) (const GLfloat *m); -typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXDPROC) (const GLdouble *m); -typedef void (APIENTRYP PFNGLSAMPLECOVERAGEPROC) (GLclampf value, GLboolean invert); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE3DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE2DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE1DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE2DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE1DPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXIMAGEPROC) (GLenum target, GLint level, GLvoid *img); -#endif - -#ifndef GL_VERSION_1_4 -#define GL_VERSION_1_4 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glBlendFuncSeparate (GLenum, GLenum, GLenum, GLenum); -GLAPI void APIENTRY glFogCoordf (GLfloat); -GLAPI void APIENTRY glFogCoordfv (const GLfloat *); -GLAPI void APIENTRY glFogCoordd (GLdouble); -GLAPI void APIENTRY glFogCoorddv (const GLdouble *); -GLAPI void APIENTRY glFogCoordPointer (GLenum, GLsizei, const GLvoid *); -GLAPI void APIENTRY glMultiDrawArrays (GLenum, GLint *, GLsizei *, GLsizei); -GLAPI void APIENTRY glMultiDrawElements (GLenum, const GLsizei *, GLenum, const GLvoid* *, GLsizei); -GLAPI void APIENTRY glPointParameterf (GLenum, GLfloat); -GLAPI void APIENTRY glPointParameterfv (GLenum, const GLfloat *); -GLAPI void APIENTRY glPointParameteri (GLenum, GLint); -GLAPI void APIENTRY glPointParameteriv (GLenum, const GLint *); -GLAPI void APIENTRY glSecondaryColor3b (GLbyte, GLbyte, GLbyte); -GLAPI void APIENTRY glSecondaryColor3bv (const GLbyte *); -GLAPI void APIENTRY glSecondaryColor3d (GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glSecondaryColor3dv (const GLdouble *); -GLAPI void APIENTRY glSecondaryColor3f (GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glSecondaryColor3fv (const GLfloat *); -GLAPI void APIENTRY glSecondaryColor3i (GLint, GLint, GLint); -GLAPI void APIENTRY glSecondaryColor3iv (const GLint *); -GLAPI void APIENTRY glSecondaryColor3s (GLshort, GLshort, GLshort); -GLAPI void APIENTRY glSecondaryColor3sv (const GLshort *); -GLAPI void APIENTRY glSecondaryColor3ub (GLubyte, GLubyte, GLubyte); -GLAPI void APIENTRY glSecondaryColor3ubv (const GLubyte *); -GLAPI void APIENTRY glSecondaryColor3ui (GLuint, GLuint, GLuint); -GLAPI void APIENTRY glSecondaryColor3uiv (const GLuint *); -GLAPI void APIENTRY glSecondaryColor3us (GLushort, GLushort, GLushort); -GLAPI void APIENTRY glSecondaryColor3usv (const GLushort *); -GLAPI void APIENTRY glSecondaryColorPointer (GLint, GLenum, GLsizei, const GLvoid *); -GLAPI void APIENTRY glWindowPos2d (GLdouble, GLdouble); -GLAPI void APIENTRY glWindowPos2dv (const GLdouble *); -GLAPI void APIENTRY glWindowPos2f (GLfloat, GLfloat); -GLAPI void APIENTRY glWindowPos2fv (const GLfloat *); -GLAPI void APIENTRY glWindowPos2i (GLint, GLint); -GLAPI void APIENTRY glWindowPos2iv (const GLint *); -GLAPI void APIENTRY glWindowPos2s (GLshort, GLshort); -GLAPI void APIENTRY glWindowPos2sv (const GLshort *); -GLAPI void APIENTRY glWindowPos3d (GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glWindowPos3dv (const GLdouble *); -GLAPI void APIENTRY glWindowPos3f (GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glWindowPos3fv (const GLfloat *); -GLAPI void APIENTRY glWindowPos3i (GLint, GLint, GLint); -GLAPI void APIENTRY glWindowPos3iv (const GLint *); -GLAPI void APIENTRY glWindowPos3s (GLshort, GLshort, GLshort); -GLAPI void APIENTRY glWindowPos3sv (const GLshort *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); -typedef void (APIENTRYP PFNGLFOGCOORDFPROC) (GLfloat coord); -typedef void (APIENTRYP PFNGLFOGCOORDFVPROC) (const GLfloat *coord); -typedef void (APIENTRYP PFNGLFOGCOORDDPROC) (GLdouble coord); -typedef void (APIENTRYP PFNGLFOGCOORDDVPROC) (const GLdouble *coord); -typedef void (APIENTRYP PFNGLFOGCOORDPOINTERPROC) (GLenum type, GLsizei stride, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSPROC) (GLenum mode, GLint *first, GLsizei *count, GLsizei primcount); -typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSPROC) (GLenum mode, const GLsizei *count, GLenum type, const GLvoid* *indices, GLsizei primcount); -typedef void (APIENTRYP PFNGLPOINTPARAMETERFPROC) (GLenum pname, GLfloat param); -typedef void (APIENTRYP PFNGLPOINTPARAMETERFVPROC) (GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLPOINTPARAMETERIPROC) (GLenum pname, GLint param); -typedef void (APIENTRYP PFNGLPOINTPARAMETERIVPROC) (GLenum pname, const GLint *params); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BPROC) (GLbyte red, GLbyte green, GLbyte blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BVPROC) (const GLbyte *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DPROC) (GLdouble red, GLdouble green, GLdouble blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DVPROC) (const GLdouble *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FPROC) (GLfloat red, GLfloat green, GLfloat blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FVPROC) (const GLfloat *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IPROC) (GLint red, GLint green, GLint blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IVPROC) (const GLint *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SPROC) (GLshort red, GLshort green, GLshort blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SVPROC) (const GLshort *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBPROC) (GLubyte red, GLubyte green, GLubyte blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBVPROC) (const GLubyte *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIPROC) (GLuint red, GLuint green, GLuint blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIVPROC) (const GLuint *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USPROC) (GLushort red, GLushort green, GLushort blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USVPROC) (const GLushort *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTERPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLWINDOWPOS2DPROC) (GLdouble x, GLdouble y); -typedef void (APIENTRYP PFNGLWINDOWPOS2DVPROC) (const GLdouble *v); -typedef void (APIENTRYP PFNGLWINDOWPOS2FPROC) (GLfloat x, GLfloat y); -typedef void (APIENTRYP PFNGLWINDOWPOS2FVPROC) (const GLfloat *v); -typedef void (APIENTRYP PFNGLWINDOWPOS2IPROC) (GLint x, GLint y); -typedef void (APIENTRYP PFNGLWINDOWPOS2IVPROC) (const GLint *v); -typedef void (APIENTRYP PFNGLWINDOWPOS2SPROC) (GLshort x, GLshort y); -typedef void (APIENTRYP PFNGLWINDOWPOS2SVPROC) (const GLshort *v); -typedef void (APIENTRYP PFNGLWINDOWPOS3DPROC) (GLdouble x, GLdouble y, GLdouble z); -typedef void (APIENTRYP PFNGLWINDOWPOS3DVPROC) (const GLdouble *v); -typedef void (APIENTRYP PFNGLWINDOWPOS3FPROC) (GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLWINDOWPOS3FVPROC) (const GLfloat *v); -typedef void (APIENTRYP PFNGLWINDOWPOS3IPROC) (GLint x, GLint y, GLint z); -typedef void (APIENTRYP PFNGLWINDOWPOS3IVPROC) (const GLint *v); -typedef void (APIENTRYP PFNGLWINDOWPOS3SPROC) (GLshort x, GLshort y, GLshort z); -typedef void (APIENTRYP PFNGLWINDOWPOS3SVPROC) (const GLshort *v); -#endif - -#ifndef GL_VERSION_1_5 -#define GL_VERSION_1_5 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glGenQueries (GLsizei, GLuint *); -GLAPI void APIENTRY glDeleteQueries (GLsizei, const GLuint *); -GLAPI GLboolean APIENTRY glIsQuery (GLuint); -GLAPI void APIENTRY glBeginQuery (GLenum, GLuint); -GLAPI void APIENTRY glEndQuery (GLenum); -GLAPI void APIENTRY glGetQueryiv (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glGetQueryObjectiv (GLuint, GLenum, GLint *); -GLAPI void APIENTRY glGetQueryObjectuiv (GLuint, GLenum, GLuint *); -GLAPI void APIENTRY glBindBuffer (GLenum, GLuint); -GLAPI void APIENTRY glDeleteBuffers (GLsizei, const GLuint *); -GLAPI void APIENTRY glGenBuffers (GLsizei, GLuint *); -GLAPI GLboolean APIENTRY glIsBuffer (GLuint); -GLAPI void APIENTRY glBufferData (GLenum, GLsizeiptr, const GLvoid *, GLenum); -GLAPI void APIENTRY glBufferSubData (GLenum, GLintptr, GLsizeiptr, const GLvoid *); -GLAPI void APIENTRY glGetBufferSubData (GLenum, GLintptr, GLsizeiptr, GLvoid *); -GLAPI GLvoid* APIENTRY glMapBuffer (GLenum, GLenum); -GLAPI GLboolean APIENTRY glUnmapBuffer (GLenum); -GLAPI void APIENTRY glGetBufferParameteriv (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glGetBufferPointerv (GLenum, GLenum, GLvoid* *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLGENQUERIESPROC) (GLsizei n, GLuint *ids); -typedef void (APIENTRYP PFNGLDELETEQUERIESPROC) (GLsizei n, const GLuint *ids); -typedef GLboolean (APIENTRYP PFNGLISQUERYPROC) (GLuint id); -typedef void (APIENTRYP PFNGLBEGINQUERYPROC) (GLenum target, GLuint id); -typedef void (APIENTRYP PFNGLENDQUERYPROC) (GLenum target); -typedef void (APIENTRYP PFNGLGETQUERYIVPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETQUERYOBJECTIVPROC) (GLuint id, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETQUERYOBJECTUIVPROC) (GLuint id, GLenum pname, GLuint *params); -typedef void (APIENTRYP PFNGLBINDBUFFERPROC) (GLenum target, GLuint buffer); -typedef void (APIENTRYP PFNGLDELETEBUFFERSPROC) (GLsizei n, const GLuint *buffers); -typedef void (APIENTRYP PFNGLGENBUFFERSPROC) (GLsizei n, GLuint *buffers); -typedef GLboolean (APIENTRYP PFNGLISBUFFERPROC) (GLuint buffer); -typedef void (APIENTRYP PFNGLBUFFERDATAPROC) (GLenum target, GLsizeiptr size, const GLvoid *data, GLenum usage); -typedef void (APIENTRYP PFNGLBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, const GLvoid *data); -typedef void (APIENTRYP PFNGLGETBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, GLvoid *data); -typedef GLvoid* (APIENTRYP PFNGLMAPBUFFERPROC) (GLenum target, GLenum access); -typedef GLboolean (APIENTRYP PFNGLUNMAPBUFFERPROC) (GLenum target); -typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETBUFFERPOINTERVPROC) (GLenum target, GLenum pname, GLvoid* *params); -#endif - -#ifndef GL_VERSION_2_0 -#define GL_VERSION_2_0 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glBlendEquationSeparate (GLenum, GLenum); -GLAPI void APIENTRY glDrawBuffers (GLsizei, const GLenum *); -GLAPI void APIENTRY glStencilOpSeparate (GLenum, GLenum, GLenum, GLenum); -GLAPI void APIENTRY glStencilFuncSeparate (GLenum, GLenum, GLint, GLuint); -GLAPI void APIENTRY glStencilMaskSeparate (GLenum, GLuint); -GLAPI void APIENTRY glAttachShader (GLuint, GLuint); -GLAPI void APIENTRY glBindAttribLocation (GLuint, GLuint, const GLchar *); -GLAPI void APIENTRY glCompileShader (GLuint); -GLAPI GLuint APIENTRY glCreateProgram (void); -GLAPI GLuint APIENTRY glCreateShader (GLenum); -GLAPI void APIENTRY glDeleteProgram (GLuint); -GLAPI void APIENTRY glDeleteShader (GLuint); -GLAPI void APIENTRY glDetachShader (GLuint, GLuint); -GLAPI void APIENTRY glDisableVertexAttribArray (GLuint); -GLAPI void APIENTRY glEnableVertexAttribArray (GLuint); -GLAPI void APIENTRY glGetActiveAttrib (GLuint, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLchar *); -GLAPI void APIENTRY glGetActiveUniform (GLuint, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLchar *); -GLAPI void APIENTRY glGetAttachedShaders (GLuint, GLsizei, GLsizei *, GLuint *); -GLAPI GLint APIENTRY glGetAttribLocation (GLuint, const GLchar *); -GLAPI void APIENTRY glGetProgramiv (GLuint, GLenum, GLint *); -GLAPI void APIENTRY glGetProgramInfoLog (GLuint, GLsizei, GLsizei *, GLchar *); -GLAPI void APIENTRY glGetShaderiv (GLuint, GLenum, GLint *); -GLAPI void APIENTRY glGetShaderInfoLog (GLuint, GLsizei, GLsizei *, GLchar *); -GLAPI void APIENTRY glGetShaderSource (GLuint, GLsizei, GLsizei *, GLchar *); -GLAPI GLint APIENTRY glGetUniformLocation (GLuint, const GLchar *); -GLAPI void APIENTRY glGetUniformfv (GLuint, GLint, GLfloat *); -GLAPI void APIENTRY glGetUniformiv (GLuint, GLint, GLint *); -GLAPI void APIENTRY glGetVertexAttribdv (GLuint, GLenum, GLdouble *); -GLAPI void APIENTRY glGetVertexAttribfv (GLuint, GLenum, GLfloat *); -GLAPI void APIENTRY glGetVertexAttribiv (GLuint, GLenum, GLint *); -GLAPI void APIENTRY glGetVertexAttribPointerv (GLuint, GLenum, GLvoid* *); -GLAPI GLboolean APIENTRY glIsProgram (GLuint); -GLAPI GLboolean APIENTRY glIsShader (GLuint); -GLAPI void APIENTRY glLinkProgram (GLuint); -GLAPI void APIENTRY glShaderSource (GLuint, GLsizei, const GLchar* *, const GLint *); -GLAPI void APIENTRY glUseProgram (GLuint); -GLAPI void APIENTRY glUniform1f (GLint, GLfloat); -GLAPI void APIENTRY glUniform2f (GLint, GLfloat, GLfloat); -GLAPI void APIENTRY glUniform3f (GLint, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glUniform4f (GLint, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glUniform1i (GLint, GLint); -GLAPI void APIENTRY glUniform2i (GLint, GLint, GLint); -GLAPI void APIENTRY glUniform3i (GLint, GLint, GLint, GLint); -GLAPI void APIENTRY glUniform4i (GLint, GLint, GLint, GLint, GLint); -GLAPI void APIENTRY glUniform1fv (GLint, GLsizei, const GLfloat *); -GLAPI void APIENTRY glUniform2fv (GLint, GLsizei, const GLfloat *); -GLAPI void APIENTRY glUniform3fv (GLint, GLsizei, const GLfloat *); -GLAPI void APIENTRY glUniform4fv (GLint, GLsizei, const GLfloat *); -GLAPI void APIENTRY glUniform1iv (GLint, GLsizei, const GLint *); -GLAPI void APIENTRY glUniform2iv (GLint, GLsizei, const GLint *); -GLAPI void APIENTRY glUniform3iv (GLint, GLsizei, const GLint *); -GLAPI void APIENTRY glUniform4iv (GLint, GLsizei, const GLint *); -GLAPI void APIENTRY glUniformMatrix2fv (GLint, GLsizei, GLboolean, const GLfloat *); -GLAPI void APIENTRY glUniformMatrix3fv (GLint, GLsizei, GLboolean, const GLfloat *); -GLAPI void APIENTRY glUniformMatrix4fv (GLint, GLsizei, GLboolean, const GLfloat *); -GLAPI void APIENTRY glValidateProgram (GLuint); -GLAPI void APIENTRY glVertexAttrib1d (GLuint, GLdouble); -GLAPI void APIENTRY glVertexAttrib1dv (GLuint, const GLdouble *); -GLAPI void APIENTRY glVertexAttrib1f (GLuint, GLfloat); -GLAPI void APIENTRY glVertexAttrib1fv (GLuint, const GLfloat *); -GLAPI void APIENTRY glVertexAttrib1s (GLuint, GLshort); -GLAPI void APIENTRY glVertexAttrib1sv (GLuint, const GLshort *); -GLAPI void APIENTRY glVertexAttrib2d (GLuint, GLdouble, GLdouble); -GLAPI void APIENTRY glVertexAttrib2dv (GLuint, const GLdouble *); -GLAPI void APIENTRY glVertexAttrib2f (GLuint, GLfloat, GLfloat); -GLAPI void APIENTRY glVertexAttrib2fv (GLuint, const GLfloat *); -GLAPI void APIENTRY glVertexAttrib2s (GLuint, GLshort, GLshort); -GLAPI void APIENTRY glVertexAttrib2sv (GLuint, const GLshort *); -GLAPI void APIENTRY glVertexAttrib3d (GLuint, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glVertexAttrib3dv (GLuint, const GLdouble *); -GLAPI void APIENTRY glVertexAttrib3f (GLuint, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glVertexAttrib3fv (GLuint, const GLfloat *); -GLAPI void APIENTRY glVertexAttrib3s (GLuint, GLshort, GLshort, GLshort); -GLAPI void APIENTRY glVertexAttrib3sv (GLuint, const GLshort *); -GLAPI void APIENTRY glVertexAttrib4Nbv (GLuint, const GLbyte *); -GLAPI void APIENTRY glVertexAttrib4Niv (GLuint, const GLint *); -GLAPI void APIENTRY glVertexAttrib4Nsv (GLuint, const GLshort *); -GLAPI void APIENTRY glVertexAttrib4Nub (GLuint, GLubyte, GLubyte, GLubyte, GLubyte); -GLAPI void APIENTRY glVertexAttrib4Nubv (GLuint, const GLubyte *); -GLAPI void APIENTRY glVertexAttrib4Nuiv (GLuint, const GLuint *); -GLAPI void APIENTRY glVertexAttrib4Nusv (GLuint, const GLushort *); -GLAPI void APIENTRY glVertexAttrib4bv (GLuint, const GLbyte *); -GLAPI void APIENTRY glVertexAttrib4d (GLuint, GLdouble, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glVertexAttrib4dv (GLuint, const GLdouble *); -GLAPI void APIENTRY glVertexAttrib4f (GLuint, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glVertexAttrib4fv (GLuint, const GLfloat *); -GLAPI void APIENTRY glVertexAttrib4iv (GLuint, const GLint *); -GLAPI void APIENTRY glVertexAttrib4s (GLuint, GLshort, GLshort, GLshort, GLshort); -GLAPI void APIENTRY glVertexAttrib4sv (GLuint, const GLshort *); -GLAPI void APIENTRY glVertexAttrib4ubv (GLuint, const GLubyte *); -GLAPI void APIENTRY glVertexAttrib4uiv (GLuint, const GLuint *); -GLAPI void APIENTRY glVertexAttrib4usv (GLuint, const GLushort *); -GLAPI void APIENTRY glVertexAttribPointer (GLuint, GLint, GLenum, GLboolean, GLsizei, const GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLBLENDEQUATIONSEPARATEPROC) (GLenum modeRGB, GLenum modeAlpha); -typedef void (APIENTRYP PFNGLDRAWBUFFERSPROC) (GLsizei n, const GLenum *bufs); -typedef void (APIENTRYP PFNGLSTENCILOPSEPARATEPROC) (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass); -typedef void (APIENTRYP PFNGLSTENCILFUNCSEPARATEPROC) (GLenum frontfunc, GLenum backfunc, GLint ref, GLuint mask); -typedef void (APIENTRYP PFNGLSTENCILMASKSEPARATEPROC) (GLenum face, GLuint mask); -typedef void (APIENTRYP PFNGLATTACHSHADERPROC) (GLuint program, GLuint shader); -typedef void (APIENTRYP PFNGLBINDATTRIBLOCATIONPROC) (GLuint program, GLuint index, const GLchar *name); -typedef void (APIENTRYP PFNGLCOMPILESHADERPROC) (GLuint shader); -typedef GLuint (APIENTRYP PFNGLCREATEPROGRAMPROC) (void); -typedef GLuint (APIENTRYP PFNGLCREATESHADERPROC) (GLenum type); -typedef void (APIENTRYP PFNGLDELETEPROGRAMPROC) (GLuint program); -typedef void (APIENTRYP PFNGLDELETESHADERPROC) (GLuint shader); -typedef void (APIENTRYP PFNGLDETACHSHADERPROC) (GLuint program, GLuint shader); -typedef void (APIENTRYP PFNGLDISABLEVERTEXATTRIBARRAYPROC) (GLuint index); -typedef void (APIENTRYP PFNGLENABLEVERTEXATTRIBARRAYPROC) (GLuint index); -typedef void (APIENTRYP PFNGLGETACTIVEATTRIBPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLint *size, GLenum *type, GLchar *name); -typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLint *size, GLenum *type, GLchar *name); -typedef void (APIENTRYP PFNGLGETATTACHEDSHADERSPROC) (GLuint program, GLsizei maxCount, GLsizei *count, GLuint *obj); -typedef GLint (APIENTRYP PFNGLGETATTRIBLOCATIONPROC) (GLuint program, const GLchar *name); -typedef void (APIENTRYP PFNGLGETPROGRAMIVPROC) (GLuint program, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETPROGRAMINFOLOGPROC) (GLuint program, GLsizei bufSize, GLsizei *length, GLchar *infoLog); -typedef void (APIENTRYP PFNGLGETSHADERIVPROC) (GLuint shader, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETSHADERINFOLOGPROC) (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *infoLog); -typedef void (APIENTRYP PFNGLGETSHADERSOURCEPROC) (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *source); -typedef GLint (APIENTRYP PFNGLGETUNIFORMLOCATIONPROC) (GLuint program, const GLchar *name); -typedef void (APIENTRYP PFNGLGETUNIFORMFVPROC) (GLuint program, GLint location, GLfloat *params); -typedef void (APIENTRYP PFNGLGETUNIFORMIVPROC) (GLuint program, GLint location, GLint *params); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVPROC) (GLuint index, GLenum pname, GLdouble *params); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVPROC) (GLuint index, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVPROC) (GLuint index, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVPROC) (GLuint index, GLenum pname, GLvoid* *pointer); -typedef GLboolean (APIENTRYP PFNGLISPROGRAMPROC) (GLuint program); -typedef GLboolean (APIENTRYP PFNGLISSHADERPROC) (GLuint shader); -typedef void (APIENTRYP PFNGLLINKPROGRAMPROC) (GLuint program); -typedef void (APIENTRYP PFNGLSHADERSOURCEPROC) (GLuint shader, GLsizei count, const GLchar* *string, const GLint *length); -typedef void (APIENTRYP PFNGLUSEPROGRAMPROC) (GLuint program); -typedef void (APIENTRYP PFNGLUNIFORM1FPROC) (GLint location, GLfloat v0); -typedef void (APIENTRYP PFNGLUNIFORM2FPROC) (GLint location, GLfloat v0, GLfloat v1); -typedef void (APIENTRYP PFNGLUNIFORM3FPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2); -typedef void (APIENTRYP PFNGLUNIFORM4FPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); -typedef void (APIENTRYP PFNGLUNIFORM1IPROC) (GLint location, GLint v0); -typedef void (APIENTRYP PFNGLUNIFORM2IPROC) (GLint location, GLint v0, GLint v1); -typedef void (APIENTRYP PFNGLUNIFORM3IPROC) (GLint location, GLint v0, GLint v1, GLint v2); -typedef void (APIENTRYP PFNGLUNIFORM4IPROC) (GLint location, GLint v0, GLint v1, GLint v2, GLint v3); -typedef void (APIENTRYP PFNGLUNIFORM1FVPROC) (GLint location, GLsizei count, const GLfloat *value); -typedef void (APIENTRYP PFNGLUNIFORM2FVPROC) (GLint location, GLsizei count, const GLfloat *value); -typedef void (APIENTRYP PFNGLUNIFORM3FVPROC) (GLint location, GLsizei count, const GLfloat *value); -typedef void (APIENTRYP PFNGLUNIFORM4FVPROC) (GLint location, GLsizei count, const GLfloat *value); -typedef void (APIENTRYP PFNGLUNIFORM1IVPROC) (GLint location, GLsizei count, const GLint *value); -typedef void (APIENTRYP PFNGLUNIFORM2IVPROC) (GLint location, GLsizei count, const GLint *value); -typedef void (APIENTRYP PFNGLUNIFORM3IVPROC) (GLint location, GLsizei count, const GLint *value); -typedef void (APIENTRYP PFNGLUNIFORM4IVPROC) (GLint location, GLsizei count, const GLint *value); -typedef void (APIENTRYP PFNGLUNIFORMMATRIX2FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); -typedef void (APIENTRYP PFNGLUNIFORMMATRIX3FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); -typedef void (APIENTRYP PFNGLUNIFORMMATRIX4FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); -typedef void (APIENTRYP PFNGLVALIDATEPROGRAMPROC) (GLuint program); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1DPROC) (GLuint index, GLdouble x); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1DVPROC) (GLuint index, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1FPROC) (GLuint index, GLfloat x); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1FVPROC) (GLuint index, const GLfloat *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1SPROC) (GLuint index, GLshort x); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1SVPROC) (GLuint index, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2DPROC) (GLuint index, GLdouble x, GLdouble y); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2DVPROC) (GLuint index, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2FPROC) (GLuint index, GLfloat x, GLfloat y); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2FVPROC) (GLuint index, const GLfloat *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2SPROC) (GLuint index, GLshort x, GLshort y); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2SVPROC) (GLuint index, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3DVPROC) (GLuint index, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3FPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3FVPROC) (GLuint index, const GLfloat *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3SPROC) (GLuint index, GLshort x, GLshort y, GLshort z); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3SVPROC) (GLuint index, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4NBVPROC) (GLuint index, const GLbyte *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4NIVPROC) (GLuint index, const GLint *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4NSVPROC) (GLuint index, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBVPROC) (GLuint index, const GLubyte *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUIVPROC) (GLuint index, const GLuint *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUSVPROC) (GLuint index, const GLushort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4BVPROC) (GLuint index, const GLbyte *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4DVPROC) (GLuint index, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4FPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4FVPROC) (GLuint index, const GLfloat *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4IVPROC) (GLuint index, const GLint *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4SPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVPROC) (GLuint index, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVPROC) (GLuint index, const GLubyte *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4UIVPROC) (GLuint index, const GLuint *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4USVPROC) (GLuint index, const GLushort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const GLvoid *pointer); -#endif - -#ifndef GL_VERSION_2_1 -#define GL_VERSION_2_1 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glUniformMatrix2x3fv (GLint, GLsizei, GLboolean, const GLfloat *); -GLAPI void APIENTRY glUniformMatrix3x2fv (GLint, GLsizei, GLboolean, const GLfloat *); -GLAPI void APIENTRY glUniformMatrix2x4fv (GLint, GLsizei, GLboolean, const GLfloat *); -GLAPI void APIENTRY glUniformMatrix4x2fv (GLint, GLsizei, GLboolean, const GLfloat *); -GLAPI void APIENTRY glUniformMatrix3x4fv (GLint, GLsizei, GLboolean, const GLfloat *); -GLAPI void APIENTRY glUniformMatrix4x3fv (GLint, GLsizei, GLboolean, const GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLUNIFORMMATRIX2X3FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); -typedef void (APIENTRYP PFNGLUNIFORMMATRIX3X2FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); -typedef void (APIENTRYP PFNGLUNIFORMMATRIX2X4FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); -typedef void (APIENTRYP PFNGLUNIFORMMATRIX4X2FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); -typedef void (APIENTRYP PFNGLUNIFORMMATRIX3X4FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); -typedef void (APIENTRYP PFNGLUNIFORMMATRIX4X3FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); -#endif - -#ifndef GL_ARB_multitexture -#define GL_ARB_multitexture 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glActiveTextureARB (GLenum); -GLAPI void APIENTRY glClientActiveTextureARB (GLenum); -GLAPI void APIENTRY glMultiTexCoord1dARB (GLenum, GLdouble); -GLAPI void APIENTRY glMultiTexCoord1dvARB (GLenum, const GLdouble *); -GLAPI void APIENTRY glMultiTexCoord1fARB (GLenum, GLfloat); -GLAPI void APIENTRY glMultiTexCoord1fvARB (GLenum, const GLfloat *); -GLAPI void APIENTRY glMultiTexCoord1iARB (GLenum, GLint); -GLAPI void APIENTRY glMultiTexCoord1ivARB (GLenum, const GLint *); -GLAPI void APIENTRY glMultiTexCoord1sARB (GLenum, GLshort); -GLAPI void APIENTRY glMultiTexCoord1svARB (GLenum, const GLshort *); -GLAPI void APIENTRY glMultiTexCoord2dARB (GLenum, GLdouble, GLdouble); -GLAPI void APIENTRY glMultiTexCoord2dvARB (GLenum, const GLdouble *); -GLAPI void APIENTRY glMultiTexCoord2fARB (GLenum, GLfloat, GLfloat); -GLAPI void APIENTRY glMultiTexCoord2fvARB (GLenum, const GLfloat *); -GLAPI void APIENTRY glMultiTexCoord2iARB (GLenum, GLint, GLint); -GLAPI void APIENTRY glMultiTexCoord2ivARB (GLenum, const GLint *); -GLAPI void APIENTRY glMultiTexCoord2sARB (GLenum, GLshort, GLshort); -GLAPI void APIENTRY glMultiTexCoord2svARB (GLenum, const GLshort *); -GLAPI void APIENTRY glMultiTexCoord3dARB (GLenum, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glMultiTexCoord3dvARB (GLenum, const GLdouble *); -GLAPI void APIENTRY glMultiTexCoord3fARB (GLenum, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glMultiTexCoord3fvARB (GLenum, const GLfloat *); -GLAPI void APIENTRY glMultiTexCoord3iARB (GLenum, GLint, GLint, GLint); -GLAPI void APIENTRY glMultiTexCoord3ivARB (GLenum, const GLint *); -GLAPI void APIENTRY glMultiTexCoord3sARB (GLenum, GLshort, GLshort, GLshort); -GLAPI void APIENTRY glMultiTexCoord3svARB (GLenum, const GLshort *); -GLAPI void APIENTRY glMultiTexCoord4dARB (GLenum, GLdouble, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glMultiTexCoord4dvARB (GLenum, const GLdouble *); -GLAPI void APIENTRY glMultiTexCoord4fARB (GLenum, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glMultiTexCoord4fvARB (GLenum, const GLfloat *); -GLAPI void APIENTRY glMultiTexCoord4iARB (GLenum, GLint, GLint, GLint, GLint); -GLAPI void APIENTRY glMultiTexCoord4ivARB (GLenum, const GLint *); -GLAPI void APIENTRY glMultiTexCoord4sARB (GLenum, GLshort, GLshort, GLshort, GLshort); -GLAPI void APIENTRY glMultiTexCoord4svARB (GLenum, const GLshort *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLACTIVETEXTUREARBPROC) (GLenum texture); -typedef void (APIENTRYP PFNGLCLIENTACTIVETEXTUREARBPROC) (GLenum texture); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1DARBPROC) (GLenum target, GLdouble s); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1DVARBPROC) (GLenum target, const GLdouble *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1FARBPROC) (GLenum target, GLfloat s); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1FVARBPROC) (GLenum target, const GLfloat *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1IARBPROC) (GLenum target, GLint s); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1IVARBPROC) (GLenum target, const GLint *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1SARBPROC) (GLenum target, GLshort s); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1SVARBPROC) (GLenum target, const GLshort *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2DARBPROC) (GLenum target, GLdouble s, GLdouble t); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2DVARBPROC) (GLenum target, const GLdouble *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2FARBPROC) (GLenum target, GLfloat s, GLfloat t); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2FVARBPROC) (GLenum target, const GLfloat *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2IARBPROC) (GLenum target, GLint s, GLint t); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2IVARBPROC) (GLenum target, const GLint *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2SARBPROC) (GLenum target, GLshort s, GLshort t); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2SVARBPROC) (GLenum target, const GLshort *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3DARBPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3DVARBPROC) (GLenum target, const GLdouble *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3FARBPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3FVARBPROC) (GLenum target, const GLfloat *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3IARBPROC) (GLenum target, GLint s, GLint t, GLint r); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3IVARBPROC) (GLenum target, const GLint *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3SARBPROC) (GLenum target, GLshort s, GLshort t, GLshort r); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3SVARBPROC) (GLenum target, const GLshort *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4DARBPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4DVARBPROC) (GLenum target, const GLdouble *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4FARBPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4FVARBPROC) (GLenum target, const GLfloat *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4IARBPROC) (GLenum target, GLint s, GLint t, GLint r, GLint q); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4IVARBPROC) (GLenum target, const GLint *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4SARBPROC) (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4SVARBPROC) (GLenum target, const GLshort *v); -#endif - -#ifndef GL_ARB_transpose_matrix -#define GL_ARB_transpose_matrix 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glLoadTransposeMatrixfARB (const GLfloat *); -GLAPI void APIENTRY glLoadTransposeMatrixdARB (const GLdouble *); -GLAPI void APIENTRY glMultTransposeMatrixfARB (const GLfloat *); -GLAPI void APIENTRY glMultTransposeMatrixdARB (const GLdouble *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXFARBPROC) (const GLfloat *m); -typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXDARBPROC) (const GLdouble *m); -typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXFARBPROC) (const GLfloat *m); -typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXDARBPROC) (const GLdouble *m); -#endif - -#ifndef GL_ARB_multisample -#define GL_ARB_multisample 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glSampleCoverageARB (GLclampf, GLboolean); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLSAMPLECOVERAGEARBPROC) (GLclampf value, GLboolean invert); -#endif - -#ifndef GL_ARB_texture_env_add -#define GL_ARB_texture_env_add 1 -#endif - -#ifndef GL_ARB_texture_cube_map -#define GL_ARB_texture_cube_map 1 -#endif - -#ifndef GL_ARB_texture_compression -#define GL_ARB_texture_compression 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glCompressedTexImage3DARB (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *); -GLAPI void APIENTRY glCompressedTexImage2DARB (GLenum, GLint, GLenum, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *); -GLAPI void APIENTRY glCompressedTexImage1DARB (GLenum, GLint, GLenum, GLsizei, GLint, GLsizei, const GLvoid *); -GLAPI void APIENTRY glCompressedTexSubImage3DARB (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *); -GLAPI void APIENTRY glCompressedTexSubImage2DARB (GLenum, GLint, GLint, GLint, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *); -GLAPI void APIENTRY glCompressedTexSubImage1DARB (GLenum, GLint, GLint, GLsizei, GLenum, GLsizei, const GLvoid *); -GLAPI void APIENTRY glGetCompressedTexImageARB (GLenum, GLint, GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE3DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE2DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE1DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE3DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE2DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE1DARBPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXIMAGEARBPROC) (GLenum target, GLint level, GLvoid *img); -#endif - -#ifndef GL_ARB_texture_border_clamp -#define GL_ARB_texture_border_clamp 1 -#endif - -#ifndef GL_ARB_point_parameters -#define GL_ARB_point_parameters 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glPointParameterfARB (GLenum, GLfloat); -GLAPI void APIENTRY glPointParameterfvARB (GLenum, const GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLPOINTPARAMETERFARBPROC) (GLenum pname, GLfloat param); -typedef void (APIENTRYP PFNGLPOINTPARAMETERFVARBPROC) (GLenum pname, const GLfloat *params); -#endif - -#ifndef GL_ARB_vertex_blend -#define GL_ARB_vertex_blend 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glWeightbvARB (GLint, const GLbyte *); -GLAPI void APIENTRY glWeightsvARB (GLint, const GLshort *); -GLAPI void APIENTRY glWeightivARB (GLint, const GLint *); -GLAPI void APIENTRY glWeightfvARB (GLint, const GLfloat *); -GLAPI void APIENTRY glWeightdvARB (GLint, const GLdouble *); -GLAPI void APIENTRY glWeightubvARB (GLint, const GLubyte *); -GLAPI void APIENTRY glWeightusvARB (GLint, const GLushort *); -GLAPI void APIENTRY glWeightuivARB (GLint, const GLuint *); -GLAPI void APIENTRY glWeightPointerARB (GLint, GLenum, GLsizei, const GLvoid *); -GLAPI void APIENTRY glVertexBlendARB (GLint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLWEIGHTBVARBPROC) (GLint size, const GLbyte *weights); -typedef void (APIENTRYP PFNGLWEIGHTSVARBPROC) (GLint size, const GLshort *weights); -typedef void (APIENTRYP PFNGLWEIGHTIVARBPROC) (GLint size, const GLint *weights); -typedef void (APIENTRYP PFNGLWEIGHTFVARBPROC) (GLint size, const GLfloat *weights); -typedef void (APIENTRYP PFNGLWEIGHTDVARBPROC) (GLint size, const GLdouble *weights); -typedef void (APIENTRYP PFNGLWEIGHTUBVARBPROC) (GLint size, const GLubyte *weights); -typedef void (APIENTRYP PFNGLWEIGHTUSVARBPROC) (GLint size, const GLushort *weights); -typedef void (APIENTRYP PFNGLWEIGHTUIVARBPROC) (GLint size, const GLuint *weights); -typedef void (APIENTRYP PFNGLWEIGHTPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLVERTEXBLENDARBPROC) (GLint count); -#endif - -#ifndef GL_ARB_matrix_palette -#define GL_ARB_matrix_palette 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glCurrentPaletteMatrixARB (GLint); -GLAPI void APIENTRY glMatrixIndexubvARB (GLint, const GLubyte *); -GLAPI void APIENTRY glMatrixIndexusvARB (GLint, const GLushort *); -GLAPI void APIENTRY glMatrixIndexuivARB (GLint, const GLuint *); -GLAPI void APIENTRY glMatrixIndexPointerARB (GLint, GLenum, GLsizei, const GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLCURRENTPALETTEMATRIXARBPROC) (GLint index); -typedef void (APIENTRYP PFNGLMATRIXINDEXUBVARBPROC) (GLint size, const GLubyte *indices); -typedef void (APIENTRYP PFNGLMATRIXINDEXUSVARBPROC) (GLint size, const GLushort *indices); -typedef void (APIENTRYP PFNGLMATRIXINDEXUIVARBPROC) (GLint size, const GLuint *indices); -typedef void (APIENTRYP PFNGLMATRIXINDEXPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); -#endif - -#ifndef GL_ARB_texture_env_combine -#define GL_ARB_texture_env_combine 1 -#endif - -#ifndef GL_ARB_texture_env_crossbar -#define GL_ARB_texture_env_crossbar 1 -#endif - -#ifndef GL_ARB_texture_env_dot3 -#define GL_ARB_texture_env_dot3 1 -#endif - -#ifndef GL_ARB_texture_mirrored_repeat -#define GL_ARB_texture_mirrored_repeat 1 -#endif - -#ifndef GL_ARB_depth_texture -#define GL_ARB_depth_texture 1 -#endif - -#ifndef GL_ARB_shadow -#define GL_ARB_shadow 1 -#endif - -#ifndef GL_ARB_shadow_ambient -#define GL_ARB_shadow_ambient 1 -#endif - -#ifndef GL_ARB_window_pos -#define GL_ARB_window_pos 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glWindowPos2dARB (GLdouble, GLdouble); -GLAPI void APIENTRY glWindowPos2dvARB (const GLdouble *); -GLAPI void APIENTRY glWindowPos2fARB (GLfloat, GLfloat); -GLAPI void APIENTRY glWindowPos2fvARB (const GLfloat *); -GLAPI void APIENTRY glWindowPos2iARB (GLint, GLint); -GLAPI void APIENTRY glWindowPos2ivARB (const GLint *); -GLAPI void APIENTRY glWindowPos2sARB (GLshort, GLshort); -GLAPI void APIENTRY glWindowPos2svARB (const GLshort *); -GLAPI void APIENTRY glWindowPos3dARB (GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glWindowPos3dvARB (const GLdouble *); -GLAPI void APIENTRY glWindowPos3fARB (GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glWindowPos3fvARB (const GLfloat *); -GLAPI void APIENTRY glWindowPos3iARB (GLint, GLint, GLint); -GLAPI void APIENTRY glWindowPos3ivARB (const GLint *); -GLAPI void APIENTRY glWindowPos3sARB (GLshort, GLshort, GLshort); -GLAPI void APIENTRY glWindowPos3svARB (const GLshort *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLWINDOWPOS2DARBPROC) (GLdouble x, GLdouble y); -typedef void (APIENTRYP PFNGLWINDOWPOS2DVARBPROC) (const GLdouble *v); -typedef void (APIENTRYP PFNGLWINDOWPOS2FARBPROC) (GLfloat x, GLfloat y); -typedef void (APIENTRYP PFNGLWINDOWPOS2FVARBPROC) (const GLfloat *v); -typedef void (APIENTRYP PFNGLWINDOWPOS2IARBPROC) (GLint x, GLint y); -typedef void (APIENTRYP PFNGLWINDOWPOS2IVARBPROC) (const GLint *v); -typedef void (APIENTRYP PFNGLWINDOWPOS2SARBPROC) (GLshort x, GLshort y); -typedef void (APIENTRYP PFNGLWINDOWPOS2SVARBPROC) (const GLshort *v); -typedef void (APIENTRYP PFNGLWINDOWPOS3DARBPROC) (GLdouble x, GLdouble y, GLdouble z); -typedef void (APIENTRYP PFNGLWINDOWPOS3DVARBPROC) (const GLdouble *v); -typedef void (APIENTRYP PFNGLWINDOWPOS3FARBPROC) (GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLWINDOWPOS3FVARBPROC) (const GLfloat *v); -typedef void (APIENTRYP PFNGLWINDOWPOS3IARBPROC) (GLint x, GLint y, GLint z); -typedef void (APIENTRYP PFNGLWINDOWPOS3IVARBPROC) (const GLint *v); -typedef void (APIENTRYP PFNGLWINDOWPOS3SARBPROC) (GLshort x, GLshort y, GLshort z); -typedef void (APIENTRYP PFNGLWINDOWPOS3SVARBPROC) (const GLshort *v); -#endif - -#ifndef GL_ARB_vertex_program -#define GL_ARB_vertex_program 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glVertexAttrib1dARB (GLuint, GLdouble); -GLAPI void APIENTRY glVertexAttrib1dvARB (GLuint, const GLdouble *); -GLAPI void APIENTRY glVertexAttrib1fARB (GLuint, GLfloat); -GLAPI void APIENTRY glVertexAttrib1fvARB (GLuint, const GLfloat *); -GLAPI void APIENTRY glVertexAttrib1sARB (GLuint, GLshort); -GLAPI void APIENTRY glVertexAttrib1svARB (GLuint, const GLshort *); -GLAPI void APIENTRY glVertexAttrib2dARB (GLuint, GLdouble, GLdouble); -GLAPI void APIENTRY glVertexAttrib2dvARB (GLuint, const GLdouble *); -GLAPI void APIENTRY glVertexAttrib2fARB (GLuint, GLfloat, GLfloat); -GLAPI void APIENTRY glVertexAttrib2fvARB (GLuint, const GLfloat *); -GLAPI void APIENTRY glVertexAttrib2sARB (GLuint, GLshort, GLshort); -GLAPI void APIENTRY glVertexAttrib2svARB (GLuint, const GLshort *); -GLAPI void APIENTRY glVertexAttrib3dARB (GLuint, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glVertexAttrib3dvARB (GLuint, const GLdouble *); -GLAPI void APIENTRY glVertexAttrib3fARB (GLuint, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glVertexAttrib3fvARB (GLuint, const GLfloat *); -GLAPI void APIENTRY glVertexAttrib3sARB (GLuint, GLshort, GLshort, GLshort); -GLAPI void APIENTRY glVertexAttrib3svARB (GLuint, const GLshort *); -GLAPI void APIENTRY glVertexAttrib4NbvARB (GLuint, const GLbyte *); -GLAPI void APIENTRY glVertexAttrib4NivARB (GLuint, const GLint *); -GLAPI void APIENTRY glVertexAttrib4NsvARB (GLuint, const GLshort *); -GLAPI void APIENTRY glVertexAttrib4NubARB (GLuint, GLubyte, GLubyte, GLubyte, GLubyte); -GLAPI void APIENTRY glVertexAttrib4NubvARB (GLuint, const GLubyte *); -GLAPI void APIENTRY glVertexAttrib4NuivARB (GLuint, const GLuint *); -GLAPI void APIENTRY glVertexAttrib4NusvARB (GLuint, const GLushort *); -GLAPI void APIENTRY glVertexAttrib4bvARB (GLuint, const GLbyte *); -GLAPI void APIENTRY glVertexAttrib4dARB (GLuint, GLdouble, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glVertexAttrib4dvARB (GLuint, const GLdouble *); -GLAPI void APIENTRY glVertexAttrib4fARB (GLuint, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glVertexAttrib4fvARB (GLuint, const GLfloat *); -GLAPI void APIENTRY glVertexAttrib4ivARB (GLuint, const GLint *); -GLAPI void APIENTRY glVertexAttrib4sARB (GLuint, GLshort, GLshort, GLshort, GLshort); -GLAPI void APIENTRY glVertexAttrib4svARB (GLuint, const GLshort *); -GLAPI void APIENTRY glVertexAttrib4ubvARB (GLuint, const GLubyte *); -GLAPI void APIENTRY glVertexAttrib4uivARB (GLuint, const GLuint *); -GLAPI void APIENTRY glVertexAttrib4usvARB (GLuint, const GLushort *); -GLAPI void APIENTRY glVertexAttribPointerARB (GLuint, GLint, GLenum, GLboolean, GLsizei, const GLvoid *); -GLAPI void APIENTRY glEnableVertexAttribArrayARB (GLuint); -GLAPI void APIENTRY glDisableVertexAttribArrayARB (GLuint); -GLAPI void APIENTRY glProgramStringARB (GLenum, GLenum, GLsizei, const GLvoid *); -GLAPI void APIENTRY glBindProgramARB (GLenum, GLuint); -GLAPI void APIENTRY glDeleteProgramsARB (GLsizei, const GLuint *); -GLAPI void APIENTRY glGenProgramsARB (GLsizei, GLuint *); -GLAPI void APIENTRY glProgramEnvParameter4dARB (GLenum, GLuint, GLdouble, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glProgramEnvParameter4dvARB (GLenum, GLuint, const GLdouble *); -GLAPI void APIENTRY glProgramEnvParameter4fARB (GLenum, GLuint, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glProgramEnvParameter4fvARB (GLenum, GLuint, const GLfloat *); -GLAPI void APIENTRY glProgramLocalParameter4dARB (GLenum, GLuint, GLdouble, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glProgramLocalParameter4dvARB (GLenum, GLuint, const GLdouble *); -GLAPI void APIENTRY glProgramLocalParameter4fARB (GLenum, GLuint, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glProgramLocalParameter4fvARB (GLenum, GLuint, const GLfloat *); -GLAPI void APIENTRY glGetProgramEnvParameterdvARB (GLenum, GLuint, GLdouble *); -GLAPI void APIENTRY glGetProgramEnvParameterfvARB (GLenum, GLuint, GLfloat *); -GLAPI void APIENTRY glGetProgramLocalParameterdvARB (GLenum, GLuint, GLdouble *); -GLAPI void APIENTRY glGetProgramLocalParameterfvARB (GLenum, GLuint, GLfloat *); -GLAPI void APIENTRY glGetProgramivARB (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glGetProgramStringARB (GLenum, GLenum, GLvoid *); -GLAPI void APIENTRY glGetVertexAttribdvARB (GLuint, GLenum, GLdouble *); -GLAPI void APIENTRY glGetVertexAttribfvARB (GLuint, GLenum, GLfloat *); -GLAPI void APIENTRY glGetVertexAttribivARB (GLuint, GLenum, GLint *); -GLAPI void APIENTRY glGetVertexAttribPointervARB (GLuint, GLenum, GLvoid* *); -GLAPI GLboolean APIENTRY glIsProgramARB (GLuint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLVERTEXATTRIB1DARBPROC) (GLuint index, GLdouble x); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1DVARBPROC) (GLuint index, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1FARBPROC) (GLuint index, GLfloat x); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1FVARBPROC) (GLuint index, const GLfloat *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1SARBPROC) (GLuint index, GLshort x); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1SVARBPROC) (GLuint index, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2DARBPROC) (GLuint index, GLdouble x, GLdouble y); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2DVARBPROC) (GLuint index, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2FARBPROC) (GLuint index, GLfloat x, GLfloat y); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2FVARBPROC) (GLuint index, const GLfloat *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2SARBPROC) (GLuint index, GLshort x, GLshort y); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2SVARBPROC) (GLuint index, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3DARBPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3DVARBPROC) (GLuint index, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3FARBPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3FVARBPROC) (GLuint index, const GLfloat *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3SARBPROC) (GLuint index, GLshort x, GLshort y, GLshort z); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3SVARBPROC) (GLuint index, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4NBVARBPROC) (GLuint index, const GLbyte *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4NIVARBPROC) (GLuint index, const GLint *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4NSVARBPROC) (GLuint index, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBARBPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBVARBPROC) (GLuint index, const GLubyte *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUIVARBPROC) (GLuint index, const GLuint *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUSVARBPROC) (GLuint index, const GLushort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4BVARBPROC) (GLuint index, const GLbyte *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4DARBPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4DVARBPROC) (GLuint index, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4FARBPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4FVARBPROC) (GLuint index, const GLfloat *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4IVARBPROC) (GLuint index, const GLint *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4SARBPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVARBPROC) (GLuint index, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVARBPROC) (GLuint index, const GLubyte *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4UIVARBPROC) (GLuint index, const GLuint *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4USVARBPROC) (GLuint index, const GLushort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERARBPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLENABLEVERTEXATTRIBARRAYARBPROC) (GLuint index); -typedef void (APIENTRYP PFNGLDISABLEVERTEXATTRIBARRAYARBPROC) (GLuint index); -typedef void (APIENTRYP PFNGLPROGRAMSTRINGARBPROC) (GLenum target, GLenum format, GLsizei len, const GLvoid *string); -typedef void (APIENTRYP PFNGLBINDPROGRAMARBPROC) (GLenum target, GLuint program); -typedef void (APIENTRYP PFNGLDELETEPROGRAMSARBPROC) (GLsizei n, const GLuint *programs); -typedef void (APIENTRYP PFNGLGENPROGRAMSARBPROC) (GLsizei n, GLuint *programs); -typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4DARBPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); -typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4DVARBPROC) (GLenum target, GLuint index, const GLdouble *params); -typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4FARBPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); -typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4FVARBPROC) (GLenum target, GLuint index, const GLfloat *params); -typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4DARBPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); -typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4DVARBPROC) (GLenum target, GLuint index, const GLdouble *params); -typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4FARBPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); -typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4FVARBPROC) (GLenum target, GLuint index, const GLfloat *params); -typedef void (APIENTRYP PFNGLGETPROGRAMENVPARAMETERDVARBPROC) (GLenum target, GLuint index, GLdouble *params); -typedef void (APIENTRYP PFNGLGETPROGRAMENVPARAMETERFVARBPROC) (GLenum target, GLuint index, GLfloat *params); -typedef void (APIENTRYP PFNGLGETPROGRAMLOCALPARAMETERDVARBPROC) (GLenum target, GLuint index, GLdouble *params); -typedef void (APIENTRYP PFNGLGETPROGRAMLOCALPARAMETERFVARBPROC) (GLenum target, GLuint index, GLfloat *params); -typedef void (APIENTRYP PFNGLGETPROGRAMIVARBPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETPROGRAMSTRINGARBPROC) (GLenum target, GLenum pname, GLvoid *string); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVARBPROC) (GLuint index, GLenum pname, GLdouble *params); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVARBPROC) (GLuint index, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVARBPROC) (GLuint index, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVARBPROC) (GLuint index, GLenum pname, GLvoid* *pointer); -typedef GLboolean (APIENTRYP PFNGLISPROGRAMARBPROC) (GLuint program); -#endif - -#ifndef GL_ARB_fragment_program -#define GL_ARB_fragment_program 1 -/* All ARB_fragment_program entry points are shared with ARB_vertex_program. */ -#endif - -#ifndef GL_ARB_vertex_buffer_object -#define GL_ARB_vertex_buffer_object 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glBindBufferARB (GLenum, GLuint); -GLAPI void APIENTRY glDeleteBuffersARB (GLsizei, const GLuint *); -GLAPI void APIENTRY glGenBuffersARB (GLsizei, GLuint *); -GLAPI GLboolean APIENTRY glIsBufferARB (GLuint); -GLAPI void APIENTRY glBufferDataARB (GLenum, GLsizeiptrARB, const GLvoid *, GLenum); -GLAPI void APIENTRY glBufferSubDataARB (GLenum, GLintptrARB, GLsizeiptrARB, const GLvoid *); -GLAPI void APIENTRY glGetBufferSubDataARB (GLenum, GLintptrARB, GLsizeiptrARB, GLvoid *); -GLAPI GLvoid* APIENTRY glMapBufferARB (GLenum, GLenum); -GLAPI GLboolean APIENTRY glUnmapBufferARB (GLenum); -GLAPI void APIENTRY glGetBufferParameterivARB (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glGetBufferPointervARB (GLenum, GLenum, GLvoid* *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLBINDBUFFERARBPROC) (GLenum target, GLuint buffer); -typedef void (APIENTRYP PFNGLDELETEBUFFERSARBPROC) (GLsizei n, const GLuint *buffers); -typedef void (APIENTRYP PFNGLGENBUFFERSARBPROC) (GLsizei n, GLuint *buffers); -typedef GLboolean (APIENTRYP PFNGLISBUFFERARBPROC) (GLuint buffer); -typedef void (APIENTRYP PFNGLBUFFERDATAARBPROC) (GLenum target, GLsizeiptrARB size, const GLvoid *data, GLenum usage); -typedef void (APIENTRYP PFNGLBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, const GLvoid *data); -typedef void (APIENTRYP PFNGLGETBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, GLvoid *data); -typedef GLvoid* (APIENTRYP PFNGLMAPBUFFERARBPROC) (GLenum target, GLenum access); -typedef GLboolean (APIENTRYP PFNGLUNMAPBUFFERARBPROC) (GLenum target); -typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERIVARBPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETBUFFERPOINTERVARBPROC) (GLenum target, GLenum pname, GLvoid* *params); -#endif - -#ifndef GL_ARB_occlusion_query -#define GL_ARB_occlusion_query 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glGenQueriesARB (GLsizei, GLuint *); -GLAPI void APIENTRY glDeleteQueriesARB (GLsizei, const GLuint *); -GLAPI GLboolean APIENTRY glIsQueryARB (GLuint); -GLAPI void APIENTRY glBeginQueryARB (GLenum, GLuint); -GLAPI void APIENTRY glEndQueryARB (GLenum); -GLAPI void APIENTRY glGetQueryivARB (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glGetQueryObjectivARB (GLuint, GLenum, GLint *); -GLAPI void APIENTRY glGetQueryObjectuivARB (GLuint, GLenum, GLuint *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLGENQUERIESARBPROC) (GLsizei n, GLuint *ids); -typedef void (APIENTRYP PFNGLDELETEQUERIESARBPROC) (GLsizei n, const GLuint *ids); -typedef GLboolean (APIENTRYP PFNGLISQUERYARBPROC) (GLuint id); -typedef void (APIENTRYP PFNGLBEGINQUERYARBPROC) (GLenum target, GLuint id); -typedef void (APIENTRYP PFNGLENDQUERYARBPROC) (GLenum target); -typedef void (APIENTRYP PFNGLGETQUERYIVARBPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETQUERYOBJECTIVARBPROC) (GLuint id, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETQUERYOBJECTUIVARBPROC) (GLuint id, GLenum pname, GLuint *params); -#endif - -#ifndef GL_ARB_shader_objects -#define GL_ARB_shader_objects 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glDeleteObjectARB (GLhandleARB); -GLAPI GLhandleARB APIENTRY glGetHandleARB (GLenum); -GLAPI void APIENTRY glDetachObjectARB (GLhandleARB, GLhandleARB); -GLAPI GLhandleARB APIENTRY glCreateShaderObjectARB (GLenum); -GLAPI void APIENTRY glShaderSourceARB (GLhandleARB, GLsizei, const GLcharARB* *, const GLint *); -GLAPI void APIENTRY glCompileShaderARB (GLhandleARB); -GLAPI GLhandleARB APIENTRY glCreateProgramObjectARB (void); -GLAPI void APIENTRY glAttachObjectARB (GLhandleARB, GLhandleARB); -GLAPI void APIENTRY glLinkProgramARB (GLhandleARB); -GLAPI void APIENTRY glUseProgramObjectARB (GLhandleARB); -GLAPI void APIENTRY glValidateProgramARB (GLhandleARB); -GLAPI void APIENTRY glUniform1fARB (GLint, GLfloat); -GLAPI void APIENTRY glUniform2fARB (GLint, GLfloat, GLfloat); -GLAPI void APIENTRY glUniform3fARB (GLint, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glUniform4fARB (GLint, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glUniform1iARB (GLint, GLint); -GLAPI void APIENTRY glUniform2iARB (GLint, GLint, GLint); -GLAPI void APIENTRY glUniform3iARB (GLint, GLint, GLint, GLint); -GLAPI void APIENTRY glUniform4iARB (GLint, GLint, GLint, GLint, GLint); -GLAPI void APIENTRY glUniform1fvARB (GLint, GLsizei, const GLfloat *); -GLAPI void APIENTRY glUniform2fvARB (GLint, GLsizei, const GLfloat *); -GLAPI void APIENTRY glUniform3fvARB (GLint, GLsizei, const GLfloat *); -GLAPI void APIENTRY glUniform4fvARB (GLint, GLsizei, const GLfloat *); -GLAPI void APIENTRY glUniform1ivARB (GLint, GLsizei, const GLint *); -GLAPI void APIENTRY glUniform2ivARB (GLint, GLsizei, const GLint *); -GLAPI void APIENTRY glUniform3ivARB (GLint, GLsizei, const GLint *); -GLAPI void APIENTRY glUniform4ivARB (GLint, GLsizei, const GLint *); -GLAPI void APIENTRY glUniformMatrix2fvARB (GLint, GLsizei, GLboolean, const GLfloat *); -GLAPI void APIENTRY glUniformMatrix3fvARB (GLint, GLsizei, GLboolean, const GLfloat *); -GLAPI void APIENTRY glUniformMatrix4fvARB (GLint, GLsizei, GLboolean, const GLfloat *); -GLAPI void APIENTRY glGetObjectParameterfvARB (GLhandleARB, GLenum, GLfloat *); -GLAPI void APIENTRY glGetObjectParameterivARB (GLhandleARB, GLenum, GLint *); -GLAPI void APIENTRY glGetInfoLogARB (GLhandleARB, GLsizei, GLsizei *, GLcharARB *); -GLAPI void APIENTRY glGetAttachedObjectsARB (GLhandleARB, GLsizei, GLsizei *, GLhandleARB *); -GLAPI GLint APIENTRY glGetUniformLocationARB (GLhandleARB, const GLcharARB *); -GLAPI void APIENTRY glGetActiveUniformARB (GLhandleARB, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLcharARB *); -GLAPI void APIENTRY glGetUniformfvARB (GLhandleARB, GLint, GLfloat *); -GLAPI void APIENTRY glGetUniformivARB (GLhandleARB, GLint, GLint *); -GLAPI void APIENTRY glGetShaderSourceARB (GLhandleARB, GLsizei, GLsizei *, GLcharARB *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLDELETEOBJECTARBPROC) (GLhandleARB obj); -typedef GLhandleARB (APIENTRYP PFNGLGETHANDLEARBPROC) (GLenum pname); -typedef void (APIENTRYP PFNGLDETACHOBJECTARBPROC) (GLhandleARB containerObj, GLhandleARB attachedObj); -typedef GLhandleARB (APIENTRYP PFNGLCREATESHADEROBJECTARBPROC) (GLenum shaderType); -typedef void (APIENTRYP PFNGLSHADERSOURCEARBPROC) (GLhandleARB shaderObj, GLsizei count, const GLcharARB* *string, const GLint *length); -typedef void (APIENTRYP PFNGLCOMPILESHADERARBPROC) (GLhandleARB shaderObj); -typedef GLhandleARB (APIENTRYP PFNGLCREATEPROGRAMOBJECTARBPROC) (void); -typedef void (APIENTRYP PFNGLATTACHOBJECTARBPROC) (GLhandleARB containerObj, GLhandleARB obj); -typedef void (APIENTRYP PFNGLLINKPROGRAMARBPROC) (GLhandleARB programObj); -typedef void (APIENTRYP PFNGLUSEPROGRAMOBJECTARBPROC) (GLhandleARB programObj); -typedef void (APIENTRYP PFNGLVALIDATEPROGRAMARBPROC) (GLhandleARB programObj); -typedef void (APIENTRYP PFNGLUNIFORM1FARBPROC) (GLint location, GLfloat v0); -typedef void (APIENTRYP PFNGLUNIFORM2FARBPROC) (GLint location, GLfloat v0, GLfloat v1); -typedef void (APIENTRYP PFNGLUNIFORM3FARBPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2); -typedef void (APIENTRYP PFNGLUNIFORM4FARBPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); -typedef void (APIENTRYP PFNGLUNIFORM1IARBPROC) (GLint location, GLint v0); -typedef void (APIENTRYP PFNGLUNIFORM2IARBPROC) (GLint location, GLint v0, GLint v1); -typedef void (APIENTRYP PFNGLUNIFORM3IARBPROC) (GLint location, GLint v0, GLint v1, GLint v2); -typedef void (APIENTRYP PFNGLUNIFORM4IARBPROC) (GLint location, GLint v0, GLint v1, GLint v2, GLint v3); -typedef void (APIENTRYP PFNGLUNIFORM1FVARBPROC) (GLint location, GLsizei count, const GLfloat *value); -typedef void (APIENTRYP PFNGLUNIFORM2FVARBPROC) (GLint location, GLsizei count, const GLfloat *value); -typedef void (APIENTRYP PFNGLUNIFORM3FVARBPROC) (GLint location, GLsizei count, const GLfloat *value); -typedef void (APIENTRYP PFNGLUNIFORM4FVARBPROC) (GLint location, GLsizei count, const GLfloat *value); -typedef void (APIENTRYP PFNGLUNIFORM1IVARBPROC) (GLint location, GLsizei count, const GLint *value); -typedef void (APIENTRYP PFNGLUNIFORM2IVARBPROC) (GLint location, GLsizei count, const GLint *value); -typedef void (APIENTRYP PFNGLUNIFORM3IVARBPROC) (GLint location, GLsizei count, const GLint *value); -typedef void (APIENTRYP PFNGLUNIFORM4IVARBPROC) (GLint location, GLsizei count, const GLint *value); -typedef void (APIENTRYP PFNGLUNIFORMMATRIX2FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); -typedef void (APIENTRYP PFNGLUNIFORMMATRIX3FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); -typedef void (APIENTRYP PFNGLUNIFORMMATRIX4FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); -typedef void (APIENTRYP PFNGLGETOBJECTPARAMETERFVARBPROC) (GLhandleARB obj, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETOBJECTPARAMETERIVARBPROC) (GLhandleARB obj, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETINFOLOGARBPROC) (GLhandleARB obj, GLsizei maxLength, GLsizei *length, GLcharARB *infoLog); -typedef void (APIENTRYP PFNGLGETATTACHEDOBJECTSARBPROC) (GLhandleARB containerObj, GLsizei maxCount, GLsizei *count, GLhandleARB *obj); -typedef GLint (APIENTRYP PFNGLGETUNIFORMLOCATIONARBPROC) (GLhandleARB programObj, const GLcharARB *name); -typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMARBPROC) (GLhandleARB programObj, GLuint index, GLsizei maxLength, GLsizei *length, GLint *size, GLenum *type, GLcharARB *name); -typedef void (APIENTRYP PFNGLGETUNIFORMFVARBPROC) (GLhandleARB programObj, GLint location, GLfloat *params); -typedef void (APIENTRYP PFNGLGETUNIFORMIVARBPROC) (GLhandleARB programObj, GLint location, GLint *params); -typedef void (APIENTRYP PFNGLGETSHADERSOURCEARBPROC) (GLhandleARB obj, GLsizei maxLength, GLsizei *length, GLcharARB *source); -#endif - -#ifndef GL_ARB_vertex_shader -#define GL_ARB_vertex_shader 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glBindAttribLocationARB (GLhandleARB, GLuint, const GLcharARB *); -GLAPI void APIENTRY glGetActiveAttribARB (GLhandleARB, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLcharARB *); -GLAPI GLint APIENTRY glGetAttribLocationARB (GLhandleARB, const GLcharARB *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLBINDATTRIBLOCATIONARBPROC) (GLhandleARB programObj, GLuint index, const GLcharARB *name); -typedef void (APIENTRYP PFNGLGETACTIVEATTRIBARBPROC) (GLhandleARB programObj, GLuint index, GLsizei maxLength, GLsizei *length, GLint *size, GLenum *type, GLcharARB *name); -typedef GLint (APIENTRYP PFNGLGETATTRIBLOCATIONARBPROC) (GLhandleARB programObj, const GLcharARB *name); -#endif - -#ifndef GL_ARB_fragment_shader -#define GL_ARB_fragment_shader 1 -#endif - -#ifndef GL_ARB_shading_language_100 -#define GL_ARB_shading_language_100 1 -#endif - -#ifndef GL_ARB_texture_non_power_of_two -#define GL_ARB_texture_non_power_of_two 1 -#endif - -#ifndef GL_ARB_point_sprite -#define GL_ARB_point_sprite 1 -#endif - -#ifndef GL_ARB_fragment_program_shadow -#define GL_ARB_fragment_program_shadow 1 -#endif - -#ifndef GL_ARB_draw_buffers -#define GL_ARB_draw_buffers 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glDrawBuffersARB (GLsizei, const GLenum *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLDRAWBUFFERSARBPROC) (GLsizei n, const GLenum *bufs); -#endif - -#ifndef GL_ARB_texture_rectangle -#define GL_ARB_texture_rectangle 1 -#endif - -#ifndef GL_ARB_color_buffer_float -#define GL_ARB_color_buffer_float 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glClampColorARB (GLenum, GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLCLAMPCOLORARBPROC) (GLenum target, GLenum clamp); -#endif - -#ifndef GL_ARB_half_float_pixel -#define GL_ARB_half_float_pixel 1 -#endif - -#ifndef GL_ARB_texture_float -#define GL_ARB_texture_float 1 -#endif - -#ifndef GL_ARB_pixel_buffer_object -#define GL_ARB_pixel_buffer_object 1 -#endif - -#ifndef GL_EXT_abgr -#define GL_EXT_abgr 1 -#endif - -#ifndef GL_EXT_blend_color -#define GL_EXT_blend_color 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glBlendColorEXT (GLclampf, GLclampf, GLclampf, GLclampf); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLBLENDCOLOREXTPROC) (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha); -#endif - -#ifndef GL_EXT_polygon_offset -#define GL_EXT_polygon_offset 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glPolygonOffsetEXT (GLfloat, GLfloat); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLPOLYGONOFFSETEXTPROC) (GLfloat factor, GLfloat bias); -#endif - -#ifndef GL_EXT_texture -#define GL_EXT_texture 1 -#endif - -#ifndef GL_EXT_texture3D -#define GL_EXT_texture3D 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glTexImage3DEXT (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLint, GLenum, GLenum, const GLvoid *); -GLAPI void APIENTRY glTexSubImage3DEXT (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLTEXIMAGE3DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLTEXSUBIMAGE3DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); -#endif - -#ifndef GL_SGIS_texture_filter4 -#define GL_SGIS_texture_filter4 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glGetTexFilterFuncSGIS (GLenum, GLenum, GLfloat *); -GLAPI void APIENTRY glTexFilterFuncSGIS (GLenum, GLenum, GLsizei, const GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLGETTEXFILTERFUNCSGISPROC) (GLenum target, GLenum filter, GLfloat *weights); -typedef void (APIENTRYP PFNGLTEXFILTERFUNCSGISPROC) (GLenum target, GLenum filter, GLsizei n, const GLfloat *weights); -#endif - -#ifndef GL_EXT_subtexture -#define GL_EXT_subtexture 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glTexSubImage1DEXT (GLenum, GLint, GLint, GLsizei, GLenum, GLenum, const GLvoid *); -GLAPI void APIENTRY glTexSubImage2DEXT (GLenum, GLint, GLint, GLint, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLTEXSUBIMAGE1DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLTEXSUBIMAGE2DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *pixels); -#endif - -#ifndef GL_EXT_copy_texture -#define GL_EXT_copy_texture 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glCopyTexImage1DEXT (GLenum, GLint, GLenum, GLint, GLint, GLsizei, GLint); -GLAPI void APIENTRY glCopyTexImage2DEXT (GLenum, GLint, GLenum, GLint, GLint, GLsizei, GLsizei, GLint); -GLAPI void APIENTRY glCopyTexSubImage1DEXT (GLenum, GLint, GLint, GLint, GLint, GLsizei); -GLAPI void APIENTRY glCopyTexSubImage2DEXT (GLenum, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei); -GLAPI void APIENTRY glCopyTexSubImage3DEXT (GLenum, GLint, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLCOPYTEXIMAGE1DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border); -typedef void (APIENTRYP PFNGLCOPYTEXIMAGE2DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); -typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE1DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); -typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE2DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); -typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE3DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); -#endif - -#ifndef GL_EXT_histogram -#define GL_EXT_histogram 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glGetHistogramEXT (GLenum, GLboolean, GLenum, GLenum, GLvoid *); -GLAPI void APIENTRY glGetHistogramParameterfvEXT (GLenum, GLenum, GLfloat *); -GLAPI void APIENTRY glGetHistogramParameterivEXT (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glGetMinmaxEXT (GLenum, GLboolean, GLenum, GLenum, GLvoid *); -GLAPI void APIENTRY glGetMinmaxParameterfvEXT (GLenum, GLenum, GLfloat *); -GLAPI void APIENTRY glGetMinmaxParameterivEXT (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glHistogramEXT (GLenum, GLsizei, GLenum, GLboolean); -GLAPI void APIENTRY glMinmaxEXT (GLenum, GLenum, GLboolean); -GLAPI void APIENTRY glResetHistogramEXT (GLenum); -GLAPI void APIENTRY glResetMinmaxEXT (GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLGETHISTOGRAMEXTPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); -typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETMINMAXEXTPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); -typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLHISTOGRAMEXTPROC) (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink); -typedef void (APIENTRYP PFNGLMINMAXEXTPROC) (GLenum target, GLenum internalformat, GLboolean sink); -typedef void (APIENTRYP PFNGLRESETHISTOGRAMEXTPROC) (GLenum target); -typedef void (APIENTRYP PFNGLRESETMINMAXEXTPROC) (GLenum target); -#endif - -#ifndef GL_EXT_convolution -#define GL_EXT_convolution 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glConvolutionFilter1DEXT (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *); -GLAPI void APIENTRY glConvolutionFilter2DEXT (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); -GLAPI void APIENTRY glConvolutionParameterfEXT (GLenum, GLenum, GLfloat); -GLAPI void APIENTRY glConvolutionParameterfvEXT (GLenum, GLenum, const GLfloat *); -GLAPI void APIENTRY glConvolutionParameteriEXT (GLenum, GLenum, GLint); -GLAPI void APIENTRY glConvolutionParameterivEXT (GLenum, GLenum, const GLint *); -GLAPI void APIENTRY glCopyConvolutionFilter1DEXT (GLenum, GLenum, GLint, GLint, GLsizei); -GLAPI void APIENTRY glCopyConvolutionFilter2DEXT (GLenum, GLenum, GLint, GLint, GLsizei, GLsizei); -GLAPI void APIENTRY glGetConvolutionFilterEXT (GLenum, GLenum, GLenum, GLvoid *); -GLAPI void APIENTRY glGetConvolutionParameterfvEXT (GLenum, GLenum, GLfloat *); -GLAPI void APIENTRY glGetConvolutionParameterivEXT (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glGetSeparableFilterEXT (GLenum, GLenum, GLenum, GLvoid *, GLvoid *, GLvoid *); -GLAPI void APIENTRY glSeparableFilter2DEXT (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *, const GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER1DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *image); -typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *image); -typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFEXTPROC) (GLenum target, GLenum pname, GLfloat params); -typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFVEXTPROC) (GLenum target, GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIEXTPROC) (GLenum target, GLenum pname, GLint params); -typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIVEXTPROC) (GLenum target, GLenum pname, const GLint *params); -typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER1DEXTPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); -typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height); -typedef void (APIENTRYP PFNGLGETCONVOLUTIONFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *image); -typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETSEPARABLEFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *row, GLvoid *column, GLvoid *span); -typedef void (APIENTRYP PFNGLSEPARABLEFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *row, const GLvoid *column); -#endif - -#ifndef GL_SGI_color_matrix -#define GL_SGI_color_matrix 1 -#endif - -#ifndef GL_SGI_color_table -#define GL_SGI_color_table 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glColorTableSGI (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *); -GLAPI void APIENTRY glColorTableParameterfvSGI (GLenum, GLenum, const GLfloat *); -GLAPI void APIENTRY glColorTableParameterivSGI (GLenum, GLenum, const GLint *); -GLAPI void APIENTRY glCopyColorTableSGI (GLenum, GLenum, GLint, GLint, GLsizei); -GLAPI void APIENTRY glGetColorTableSGI (GLenum, GLenum, GLenum, GLvoid *); -GLAPI void APIENTRY glGetColorTableParameterfvSGI (GLenum, GLenum, GLfloat *); -GLAPI void APIENTRY glGetColorTableParameterivSGI (GLenum, GLenum, GLint *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLCOLORTABLESGIPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *table); -typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERFVSGIPROC) (GLenum target, GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERIVSGIPROC) (GLenum target, GLenum pname, const GLint *params); -typedef void (APIENTRYP PFNGLCOPYCOLORTABLESGIPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); -typedef void (APIENTRYP PFNGLGETCOLORTABLESGIPROC) (GLenum target, GLenum format, GLenum type, GLvoid *table); -typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVSGIPROC) (GLenum target, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVSGIPROC) (GLenum target, GLenum pname, GLint *params); -#endif - -#ifndef GL_SGIX_pixel_texture -#define GL_SGIX_pixel_texture 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glPixelTexGenSGIX (GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLPIXELTEXGENSGIXPROC) (GLenum mode); -#endif - -#ifndef GL_SGIS_pixel_texture -#define GL_SGIS_pixel_texture 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glPixelTexGenParameteriSGIS (GLenum, GLint); -GLAPI void APIENTRY glPixelTexGenParameterivSGIS (GLenum, const GLint *); -GLAPI void APIENTRY glPixelTexGenParameterfSGIS (GLenum, GLfloat); -GLAPI void APIENTRY glPixelTexGenParameterfvSGIS (GLenum, const GLfloat *); -GLAPI void APIENTRY glGetPixelTexGenParameterivSGIS (GLenum, GLint *); -GLAPI void APIENTRY glGetPixelTexGenParameterfvSGIS (GLenum, GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERISGISPROC) (GLenum pname, GLint param); -typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERIVSGISPROC) (GLenum pname, const GLint *params); -typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERFSGISPROC) (GLenum pname, GLfloat param); -typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERFVSGISPROC) (GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLGETPIXELTEXGENPARAMETERIVSGISPROC) (GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETPIXELTEXGENPARAMETERFVSGISPROC) (GLenum pname, GLfloat *params); -#endif - -#ifndef GL_SGIS_texture4D -#define GL_SGIS_texture4D 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glTexImage4DSGIS (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLsizei, GLint, GLenum, GLenum, const GLvoid *); -GLAPI void APIENTRY glTexSubImage4DSGIS (GLenum, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLTEXIMAGE4DSGISPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLTEXSUBIMAGE4DSGISPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint woffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLenum format, GLenum type, const GLvoid *pixels); -#endif - -#ifndef GL_SGI_texture_color_table -#define GL_SGI_texture_color_table 1 -#endif - -#ifndef GL_EXT_cmyka -#define GL_EXT_cmyka 1 -#endif - -#ifndef GL_EXT_texture_object -#define GL_EXT_texture_object 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI GLboolean APIENTRY glAreTexturesResidentEXT (GLsizei, const GLuint *, GLboolean *); -GLAPI void APIENTRY glBindTextureEXT (GLenum, GLuint); -GLAPI void APIENTRY glDeleteTexturesEXT (GLsizei, const GLuint *); -GLAPI void APIENTRY glGenTexturesEXT (GLsizei, GLuint *); -GLAPI GLboolean APIENTRY glIsTextureEXT (GLuint); -GLAPI void APIENTRY glPrioritizeTexturesEXT (GLsizei, const GLuint *, const GLclampf *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef GLboolean (APIENTRYP PFNGLARETEXTURESRESIDENTEXTPROC) (GLsizei n, const GLuint *textures, GLboolean *residences); -typedef void (APIENTRYP PFNGLBINDTEXTUREEXTPROC) (GLenum target, GLuint texture); -typedef void (APIENTRYP PFNGLDELETETEXTURESEXTPROC) (GLsizei n, const GLuint *textures); -typedef void (APIENTRYP PFNGLGENTEXTURESEXTPROC) (GLsizei n, GLuint *textures); -typedef GLboolean (APIENTRYP PFNGLISTEXTUREEXTPROC) (GLuint texture); -typedef void (APIENTRYP PFNGLPRIORITIZETEXTURESEXTPROC) (GLsizei n, const GLuint *textures, const GLclampf *priorities); -#endif - -#ifndef GL_SGIS_detail_texture -#define GL_SGIS_detail_texture 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glDetailTexFuncSGIS (GLenum, GLsizei, const GLfloat *); -GLAPI void APIENTRY glGetDetailTexFuncSGIS (GLenum, GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLDETAILTEXFUNCSGISPROC) (GLenum target, GLsizei n, const GLfloat *points); -typedef void (APIENTRYP PFNGLGETDETAILTEXFUNCSGISPROC) (GLenum target, GLfloat *points); -#endif - -#ifndef GL_SGIS_sharpen_texture -#define GL_SGIS_sharpen_texture 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glSharpenTexFuncSGIS (GLenum, GLsizei, const GLfloat *); -GLAPI void APIENTRY glGetSharpenTexFuncSGIS (GLenum, GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLSHARPENTEXFUNCSGISPROC) (GLenum target, GLsizei n, const GLfloat *points); -typedef void (APIENTRYP PFNGLGETSHARPENTEXFUNCSGISPROC) (GLenum target, GLfloat *points); -#endif - -#ifndef GL_EXT_packed_pixels -#define GL_EXT_packed_pixels 1 -#endif - -#ifndef GL_SGIS_texture_lod -#define GL_SGIS_texture_lod 1 -#endif - -#ifndef GL_SGIS_multisample -#define GL_SGIS_multisample 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glSampleMaskSGIS (GLclampf, GLboolean); -GLAPI void APIENTRY glSamplePatternSGIS (GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLSAMPLEMASKSGISPROC) (GLclampf value, GLboolean invert); -typedef void (APIENTRYP PFNGLSAMPLEPATTERNSGISPROC) (GLenum pattern); -#endif - -#ifndef GL_EXT_rescale_normal -#define GL_EXT_rescale_normal 1 -#endif - -#ifndef GL_EXT_vertex_array -#define GL_EXT_vertex_array 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glArrayElementEXT (GLint); -GLAPI void APIENTRY glColorPointerEXT (GLint, GLenum, GLsizei, GLsizei, const GLvoid *); -GLAPI void APIENTRY glDrawArraysEXT (GLenum, GLint, GLsizei); -GLAPI void APIENTRY glEdgeFlagPointerEXT (GLsizei, GLsizei, const GLboolean *); -GLAPI void APIENTRY glGetPointervEXT (GLenum, GLvoid* *); -GLAPI void APIENTRY glIndexPointerEXT (GLenum, GLsizei, GLsizei, const GLvoid *); -GLAPI void APIENTRY glNormalPointerEXT (GLenum, GLsizei, GLsizei, const GLvoid *); -GLAPI void APIENTRY glTexCoordPointerEXT (GLint, GLenum, GLsizei, GLsizei, const GLvoid *); -GLAPI void APIENTRY glVertexPointerEXT (GLint, GLenum, GLsizei, GLsizei, const GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLARRAYELEMENTEXTPROC) (GLint i); -typedef void (APIENTRYP PFNGLCOLORPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLDRAWARRAYSEXTPROC) (GLenum mode, GLint first, GLsizei count); -typedef void (APIENTRYP PFNGLEDGEFLAGPOINTEREXTPROC) (GLsizei stride, GLsizei count, const GLboolean *pointer); -typedef void (APIENTRYP PFNGLGETPOINTERVEXTPROC) (GLenum pname, GLvoid* *params); -typedef void (APIENTRYP PFNGLINDEXPOINTEREXTPROC) (GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLNORMALPOINTEREXTPROC) (GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLTEXCOORDPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLVERTEXPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); -#endif - -#ifndef GL_EXT_misc_attribute -#define GL_EXT_misc_attribute 1 -#endif - -#ifndef GL_SGIS_generate_mipmap -#define GL_SGIS_generate_mipmap 1 -#endif - -#ifndef GL_SGIX_clipmap -#define GL_SGIX_clipmap 1 -#endif - -#ifndef GL_SGIX_shadow -#define GL_SGIX_shadow 1 -#endif - -#ifndef GL_SGIS_texture_edge_clamp -#define GL_SGIS_texture_edge_clamp 1 -#endif - -#ifndef GL_SGIS_texture_border_clamp -#define GL_SGIS_texture_border_clamp 1 -#endif - -#ifndef GL_EXT_blend_minmax -#define GL_EXT_blend_minmax 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glBlendEquationEXT (GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLBLENDEQUATIONEXTPROC) (GLenum mode); -#endif - -#ifndef GL_EXT_blend_subtract -#define GL_EXT_blend_subtract 1 -#endif - -#ifndef GL_EXT_blend_logic_op -#define GL_EXT_blend_logic_op 1 -#endif - -#ifndef GL_SGIX_interlace -#define GL_SGIX_interlace 1 -#endif - -#ifndef GL_SGIX_pixel_tiles -#define GL_SGIX_pixel_tiles 1 -#endif - -#ifndef GL_SGIX_texture_select -#define GL_SGIX_texture_select 1 -#endif - -#ifndef GL_SGIX_sprite -#define GL_SGIX_sprite 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glSpriteParameterfSGIX (GLenum, GLfloat); -GLAPI void APIENTRY glSpriteParameterfvSGIX (GLenum, const GLfloat *); -GLAPI void APIENTRY glSpriteParameteriSGIX (GLenum, GLint); -GLAPI void APIENTRY glSpriteParameterivSGIX (GLenum, const GLint *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLSPRITEPARAMETERFSGIXPROC) (GLenum pname, GLfloat param); -typedef void (APIENTRYP PFNGLSPRITEPARAMETERFVSGIXPROC) (GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLSPRITEPARAMETERISGIXPROC) (GLenum pname, GLint param); -typedef void (APIENTRYP PFNGLSPRITEPARAMETERIVSGIXPROC) (GLenum pname, const GLint *params); -#endif - -#ifndef GL_SGIX_texture_multi_buffer -#define GL_SGIX_texture_multi_buffer 1 -#endif - -#ifndef GL_EXT_point_parameters -#define GL_EXT_point_parameters 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glPointParameterfEXT (GLenum, GLfloat); -GLAPI void APIENTRY glPointParameterfvEXT (GLenum, const GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLPOINTPARAMETERFEXTPROC) (GLenum pname, GLfloat param); -typedef void (APIENTRYP PFNGLPOINTPARAMETERFVEXTPROC) (GLenum pname, const GLfloat *params); -#endif - -#ifndef GL_SGIS_point_parameters -#define GL_SGIS_point_parameters 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glPointParameterfSGIS (GLenum, GLfloat); -GLAPI void APIENTRY glPointParameterfvSGIS (GLenum, const GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLPOINTPARAMETERFSGISPROC) (GLenum pname, GLfloat param); -typedef void (APIENTRYP PFNGLPOINTPARAMETERFVSGISPROC) (GLenum pname, const GLfloat *params); -#endif - -#ifndef GL_SGIX_instruments -#define GL_SGIX_instruments 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI GLint APIENTRY glGetInstrumentsSGIX (void); -GLAPI void APIENTRY glInstrumentsBufferSGIX (GLsizei, GLint *); -GLAPI GLint APIENTRY glPollInstrumentsSGIX (GLint *); -GLAPI void APIENTRY glReadInstrumentsSGIX (GLint); -GLAPI void APIENTRY glStartInstrumentsSGIX (void); -GLAPI void APIENTRY glStopInstrumentsSGIX (GLint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef GLint (APIENTRYP PFNGLGETINSTRUMENTSSGIXPROC) (void); -typedef void (APIENTRYP PFNGLINSTRUMENTSBUFFERSGIXPROC) (GLsizei size, GLint *buffer); -typedef GLint (APIENTRYP PFNGLPOLLINSTRUMENTSSGIXPROC) (GLint *marker_p); -typedef void (APIENTRYP PFNGLREADINSTRUMENTSSGIXPROC) (GLint marker); -typedef void (APIENTRYP PFNGLSTARTINSTRUMENTSSGIXPROC) (void); -typedef void (APIENTRYP PFNGLSTOPINSTRUMENTSSGIXPROC) (GLint marker); -#endif - -#ifndef GL_SGIX_texture_scale_bias -#define GL_SGIX_texture_scale_bias 1 -#endif - -#ifndef GL_SGIX_framezoom -#define GL_SGIX_framezoom 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glFrameZoomSGIX (GLint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLFRAMEZOOMSGIXPROC) (GLint factor); -#endif - -#ifndef GL_SGIX_tag_sample_buffer -#define GL_SGIX_tag_sample_buffer 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glTagSampleBufferSGIX (void); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLTAGSAMPLEBUFFERSGIXPROC) (void); -#endif - -#ifndef GL_SGIX_polynomial_ffd -#define GL_SGIX_polynomial_ffd 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glDeformationMap3dSGIX (GLenum, GLdouble, GLdouble, GLint, GLint, GLdouble, GLdouble, GLint, GLint, GLdouble, GLdouble, GLint, GLint, const GLdouble *); -GLAPI void APIENTRY glDeformationMap3fSGIX (GLenum, GLfloat, GLfloat, GLint, GLint, GLfloat, GLfloat, GLint, GLint, GLfloat, GLfloat, GLint, GLint, const GLfloat *); -GLAPI void APIENTRY glDeformSGIX (GLbitfield); -GLAPI void APIENTRY glLoadIdentityDeformationMapSGIX (GLbitfield); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLDEFORMATIONMAP3DSGIXPROC) (GLenum target, GLdouble u1, GLdouble u2, GLint ustride, GLint uorder, GLdouble v1, GLdouble v2, GLint vstride, GLint vorder, GLdouble w1, GLdouble w2, GLint wstride, GLint worder, const GLdouble *points); -typedef void (APIENTRYP PFNGLDEFORMATIONMAP3FSGIXPROC) (GLenum target, GLfloat u1, GLfloat u2, GLint ustride, GLint uorder, GLfloat v1, GLfloat v2, GLint vstride, GLint vorder, GLfloat w1, GLfloat w2, GLint wstride, GLint worder, const GLfloat *points); -typedef void (APIENTRYP PFNGLDEFORMSGIXPROC) (GLbitfield mask); -typedef void (APIENTRYP PFNGLLOADIDENTITYDEFORMATIONMAPSGIXPROC) (GLbitfield mask); -#endif - -#ifndef GL_SGIX_reference_plane -#define GL_SGIX_reference_plane 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glReferencePlaneSGIX (const GLdouble *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLREFERENCEPLANESGIXPROC) (const GLdouble *equation); -#endif - -#ifndef GL_SGIX_flush_raster -#define GL_SGIX_flush_raster 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glFlushRasterSGIX (void); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLFLUSHRASTERSGIXPROC) (void); -#endif - -#ifndef GL_SGIX_depth_texture -#define GL_SGIX_depth_texture 1 -#endif - -#ifndef GL_SGIS_fog_function -#define GL_SGIS_fog_function 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glFogFuncSGIS (GLsizei, const GLfloat *); -GLAPI void APIENTRY glGetFogFuncSGIS (GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLFOGFUNCSGISPROC) (GLsizei n, const GLfloat *points); -typedef void (APIENTRYP PFNGLGETFOGFUNCSGISPROC) (GLfloat *points); -#endif - -#ifndef GL_SGIX_fog_offset -#define GL_SGIX_fog_offset 1 -#endif - -#ifndef GL_HP_image_transform -#define GL_HP_image_transform 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glImageTransformParameteriHP (GLenum, GLenum, GLint); -GLAPI void APIENTRY glImageTransformParameterfHP (GLenum, GLenum, GLfloat); -GLAPI void APIENTRY glImageTransformParameterivHP (GLenum, GLenum, const GLint *); -GLAPI void APIENTRY glImageTransformParameterfvHP (GLenum, GLenum, const GLfloat *); -GLAPI void APIENTRY glGetImageTransformParameterivHP (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glGetImageTransformParameterfvHP (GLenum, GLenum, GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERIHPPROC) (GLenum target, GLenum pname, GLint param); -typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERFHPPROC) (GLenum target, GLenum pname, GLfloat param); -typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERIVHPPROC) (GLenum target, GLenum pname, const GLint *params); -typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERFVHPPROC) (GLenum target, GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLGETIMAGETRANSFORMPARAMETERIVHPPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETIMAGETRANSFORMPARAMETERFVHPPROC) (GLenum target, GLenum pname, GLfloat *params); -#endif - -#ifndef GL_HP_convolution_border_modes -#define GL_HP_convolution_border_modes 1 -#endif - -#ifndef GL_SGIX_texture_add_env -#define GL_SGIX_texture_add_env 1 -#endif - -#ifndef GL_EXT_color_subtable -#define GL_EXT_color_subtable 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glColorSubTableEXT (GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); -GLAPI void APIENTRY glCopyColorSubTableEXT (GLenum, GLsizei, GLint, GLint, GLsizei); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLCOLORSUBTABLEEXTPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOPYCOLORSUBTABLEEXTPROC) (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width); -#endif - -#ifndef GL_PGI_vertex_hints -#define GL_PGI_vertex_hints 1 -#endif - -#ifndef GL_PGI_misc_hints -#define GL_PGI_misc_hints 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glHintPGI (GLenum, GLint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLHINTPGIPROC) (GLenum target, GLint mode); -#endif - -#ifndef GL_EXT_paletted_texture -#define GL_EXT_paletted_texture 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glColorTableEXT (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *); -GLAPI void APIENTRY glGetColorTableEXT (GLenum, GLenum, GLenum, GLvoid *); -GLAPI void APIENTRY glGetColorTableParameterivEXT (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glGetColorTableParameterfvEXT (GLenum, GLenum, GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLCOLORTABLEEXTPROC) (GLenum target, GLenum internalFormat, GLsizei width, GLenum format, GLenum type, const GLvoid *table); -typedef void (APIENTRYP PFNGLGETCOLORTABLEEXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *data); -typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); -#endif - -#ifndef GL_EXT_clip_volume_hint -#define GL_EXT_clip_volume_hint 1 -#endif - -#ifndef GL_SGIX_list_priority -#define GL_SGIX_list_priority 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glGetListParameterfvSGIX (GLuint, GLenum, GLfloat *); -GLAPI void APIENTRY glGetListParameterivSGIX (GLuint, GLenum, GLint *); -GLAPI void APIENTRY glListParameterfSGIX (GLuint, GLenum, GLfloat); -GLAPI void APIENTRY glListParameterfvSGIX (GLuint, GLenum, const GLfloat *); -GLAPI void APIENTRY glListParameteriSGIX (GLuint, GLenum, GLint); -GLAPI void APIENTRY glListParameterivSGIX (GLuint, GLenum, const GLint *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLGETLISTPARAMETERFVSGIXPROC) (GLuint list, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETLISTPARAMETERIVSGIXPROC) (GLuint list, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLLISTPARAMETERFSGIXPROC) (GLuint list, GLenum pname, GLfloat param); -typedef void (APIENTRYP PFNGLLISTPARAMETERFVSGIXPROC) (GLuint list, GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLLISTPARAMETERISGIXPROC) (GLuint list, GLenum pname, GLint param); -typedef void (APIENTRYP PFNGLLISTPARAMETERIVSGIXPROC) (GLuint list, GLenum pname, const GLint *params); -#endif - -#ifndef GL_SGIX_ir_instrument1 -#define GL_SGIX_ir_instrument1 1 -#endif - -#ifndef GL_SGIX_calligraphic_fragment -#define GL_SGIX_calligraphic_fragment 1 -#endif - -#ifndef GL_SGIX_texture_lod_bias -#define GL_SGIX_texture_lod_bias 1 -#endif - -#ifndef GL_SGIX_shadow_ambient -#define GL_SGIX_shadow_ambient 1 -#endif - -#ifndef GL_EXT_index_texture -#define GL_EXT_index_texture 1 -#endif - -#ifndef GL_EXT_index_material -#define GL_EXT_index_material 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glIndexMaterialEXT (GLenum, GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLINDEXMATERIALEXTPROC) (GLenum face, GLenum mode); -#endif - -#ifndef GL_EXT_index_func -#define GL_EXT_index_func 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glIndexFuncEXT (GLenum, GLclampf); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLINDEXFUNCEXTPROC) (GLenum func, GLclampf ref); -#endif - -#ifndef GL_EXT_index_array_formats -#define GL_EXT_index_array_formats 1 -#endif - -#ifndef GL_EXT_compiled_vertex_array -#define GL_EXT_compiled_vertex_array 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glLockArraysEXT (GLint, GLsizei); -GLAPI void APIENTRY glUnlockArraysEXT (void); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLLOCKARRAYSEXTPROC) (GLint first, GLsizei count); -typedef void (APIENTRYP PFNGLUNLOCKARRAYSEXTPROC) (void); -#endif - -#ifndef GL_EXT_cull_vertex -#define GL_EXT_cull_vertex 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glCullParameterdvEXT (GLenum, GLdouble *); -GLAPI void APIENTRY glCullParameterfvEXT (GLenum, GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLCULLPARAMETERDVEXTPROC) (GLenum pname, GLdouble *params); -typedef void (APIENTRYP PFNGLCULLPARAMETERFVEXTPROC) (GLenum pname, GLfloat *params); -#endif - -#ifndef GL_SGIX_ycrcb -#define GL_SGIX_ycrcb 1 -#endif - -#ifndef GL_SGIX_fragment_lighting -#define GL_SGIX_fragment_lighting 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glFragmentColorMaterialSGIX (GLenum, GLenum); -GLAPI void APIENTRY glFragmentLightfSGIX (GLenum, GLenum, GLfloat); -GLAPI void APIENTRY glFragmentLightfvSGIX (GLenum, GLenum, const GLfloat *); -GLAPI void APIENTRY glFragmentLightiSGIX (GLenum, GLenum, GLint); -GLAPI void APIENTRY glFragmentLightivSGIX (GLenum, GLenum, const GLint *); -GLAPI void APIENTRY glFragmentLightModelfSGIX (GLenum, GLfloat); -GLAPI void APIENTRY glFragmentLightModelfvSGIX (GLenum, const GLfloat *); -GLAPI void APIENTRY glFragmentLightModeliSGIX (GLenum, GLint); -GLAPI void APIENTRY glFragmentLightModelivSGIX (GLenum, const GLint *); -GLAPI void APIENTRY glFragmentMaterialfSGIX (GLenum, GLenum, GLfloat); -GLAPI void APIENTRY glFragmentMaterialfvSGIX (GLenum, GLenum, const GLfloat *); -GLAPI void APIENTRY glFragmentMaterialiSGIX (GLenum, GLenum, GLint); -GLAPI void APIENTRY glFragmentMaterialivSGIX (GLenum, GLenum, const GLint *); -GLAPI void APIENTRY glGetFragmentLightfvSGIX (GLenum, GLenum, GLfloat *); -GLAPI void APIENTRY glGetFragmentLightivSGIX (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glGetFragmentMaterialfvSGIX (GLenum, GLenum, GLfloat *); -GLAPI void APIENTRY glGetFragmentMaterialivSGIX (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glLightEnviSGIX (GLenum, GLint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLFRAGMENTCOLORMATERIALSGIXPROC) (GLenum face, GLenum mode); -typedef void (APIENTRYP PFNGLFRAGMENTLIGHTFSGIXPROC) (GLenum light, GLenum pname, GLfloat param); -typedef void (APIENTRYP PFNGLFRAGMENTLIGHTFVSGIXPROC) (GLenum light, GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLFRAGMENTLIGHTISGIXPROC) (GLenum light, GLenum pname, GLint param); -typedef void (APIENTRYP PFNGLFRAGMENTLIGHTIVSGIXPROC) (GLenum light, GLenum pname, const GLint *params); -typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELFSGIXPROC) (GLenum pname, GLfloat param); -typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELFVSGIXPROC) (GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELISGIXPROC) (GLenum pname, GLint param); -typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELIVSGIXPROC) (GLenum pname, const GLint *params); -typedef void (APIENTRYP PFNGLFRAGMENTMATERIALFSGIXPROC) (GLenum face, GLenum pname, GLfloat param); -typedef void (APIENTRYP PFNGLFRAGMENTMATERIALFVSGIXPROC) (GLenum face, GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLFRAGMENTMATERIALISGIXPROC) (GLenum face, GLenum pname, GLint param); -typedef void (APIENTRYP PFNGLFRAGMENTMATERIALIVSGIXPROC) (GLenum face, GLenum pname, const GLint *params); -typedef void (APIENTRYP PFNGLGETFRAGMENTLIGHTFVSGIXPROC) (GLenum light, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETFRAGMENTLIGHTIVSGIXPROC) (GLenum light, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETFRAGMENTMATERIALFVSGIXPROC) (GLenum face, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETFRAGMENTMATERIALIVSGIXPROC) (GLenum face, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLLIGHTENVISGIXPROC) (GLenum pname, GLint param); -#endif - -#ifndef GL_IBM_rasterpos_clip -#define GL_IBM_rasterpos_clip 1 -#endif - -#ifndef GL_HP_texture_lighting -#define GL_HP_texture_lighting 1 -#endif - -#ifndef GL_EXT_draw_range_elements -#define GL_EXT_draw_range_elements 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glDrawRangeElementsEXT (GLenum, GLuint, GLuint, GLsizei, GLenum, const GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSEXTPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices); -#endif - -#ifndef GL_WIN_phong_shading -#define GL_WIN_phong_shading 1 -#endif - -#ifndef GL_WIN_specular_fog -#define GL_WIN_specular_fog 1 -#endif - -#ifndef GL_EXT_light_texture -#define GL_EXT_light_texture 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glApplyTextureEXT (GLenum); -GLAPI void APIENTRY glTextureLightEXT (GLenum); -GLAPI void APIENTRY glTextureMaterialEXT (GLenum, GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLAPPLYTEXTUREEXTPROC) (GLenum mode); -typedef void (APIENTRYP PFNGLTEXTURELIGHTEXTPROC) (GLenum pname); -typedef void (APIENTRYP PFNGLTEXTUREMATERIALEXTPROC) (GLenum face, GLenum mode); -#endif - -#ifndef GL_SGIX_blend_alpha_minmax -#define GL_SGIX_blend_alpha_minmax 1 -#endif - -#ifndef GL_EXT_bgra -#define GL_EXT_bgra 1 -#endif - -#ifndef GL_SGIX_async -#define GL_SGIX_async 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glAsyncMarkerSGIX (GLuint); -GLAPI GLint APIENTRY glFinishAsyncSGIX (GLuint *); -GLAPI GLint APIENTRY glPollAsyncSGIX (GLuint *); -GLAPI GLuint APIENTRY glGenAsyncMarkersSGIX (GLsizei); -GLAPI void APIENTRY glDeleteAsyncMarkersSGIX (GLuint, GLsizei); -GLAPI GLboolean APIENTRY glIsAsyncMarkerSGIX (GLuint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLASYNCMARKERSGIXPROC) (GLuint marker); -typedef GLint (APIENTRYP PFNGLFINISHASYNCSGIXPROC) (GLuint *markerp); -typedef GLint (APIENTRYP PFNGLPOLLASYNCSGIXPROC) (GLuint *markerp); -typedef GLuint (APIENTRYP PFNGLGENASYNCMARKERSSGIXPROC) (GLsizei range); -typedef void (APIENTRYP PFNGLDELETEASYNCMARKERSSGIXPROC) (GLuint marker, GLsizei range); -typedef GLboolean (APIENTRYP PFNGLISASYNCMARKERSGIXPROC) (GLuint marker); -#endif - -#ifndef GL_SGIX_async_pixel -#define GL_SGIX_async_pixel 1 -#endif - -#ifndef GL_SGIX_async_histogram -#define GL_SGIX_async_histogram 1 -#endif - -#ifndef GL_INTEL_parallel_arrays -#define GL_INTEL_parallel_arrays 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glVertexPointervINTEL (GLint, GLenum, const GLvoid* *); -GLAPI void APIENTRY glNormalPointervINTEL (GLenum, const GLvoid* *); -GLAPI void APIENTRY glColorPointervINTEL (GLint, GLenum, const GLvoid* *); -GLAPI void APIENTRY glTexCoordPointervINTEL (GLint, GLenum, const GLvoid* *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLVERTEXPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid* *pointer); -typedef void (APIENTRYP PFNGLNORMALPOINTERVINTELPROC) (GLenum type, const GLvoid* *pointer); -typedef void (APIENTRYP PFNGLCOLORPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid* *pointer); -typedef void (APIENTRYP PFNGLTEXCOORDPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid* *pointer); -#endif - -#ifndef GL_HP_occlusion_test -#define GL_HP_occlusion_test 1 -#endif - -#ifndef GL_EXT_pixel_transform -#define GL_EXT_pixel_transform 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glPixelTransformParameteriEXT (GLenum, GLenum, GLint); -GLAPI void APIENTRY glPixelTransformParameterfEXT (GLenum, GLenum, GLfloat); -GLAPI void APIENTRY glPixelTransformParameterivEXT (GLenum, GLenum, const GLint *); -GLAPI void APIENTRY glPixelTransformParameterfvEXT (GLenum, GLenum, const GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERIEXTPROC) (GLenum target, GLenum pname, GLint param); -typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERFEXTPROC) (GLenum target, GLenum pname, GLfloat param); -typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERIVEXTPROC) (GLenum target, GLenum pname, const GLint *params); -typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERFVEXTPROC) (GLenum target, GLenum pname, const GLfloat *params); -#endif - -#ifndef GL_EXT_pixel_transform_color_table -#define GL_EXT_pixel_transform_color_table 1 -#endif - -#ifndef GL_EXT_shared_texture_palette -#define GL_EXT_shared_texture_palette 1 -#endif - -#ifndef GL_EXT_separate_specular_color -#define GL_EXT_separate_specular_color 1 -#endif - -#ifndef GL_EXT_secondary_color -#define GL_EXT_secondary_color 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glSecondaryColor3bEXT (GLbyte, GLbyte, GLbyte); -GLAPI void APIENTRY glSecondaryColor3bvEXT (const GLbyte *); -GLAPI void APIENTRY glSecondaryColor3dEXT (GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glSecondaryColor3dvEXT (const GLdouble *); -GLAPI void APIENTRY glSecondaryColor3fEXT (GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glSecondaryColor3fvEXT (const GLfloat *); -GLAPI void APIENTRY glSecondaryColor3iEXT (GLint, GLint, GLint); -GLAPI void APIENTRY glSecondaryColor3ivEXT (const GLint *); -GLAPI void APIENTRY glSecondaryColor3sEXT (GLshort, GLshort, GLshort); -GLAPI void APIENTRY glSecondaryColor3svEXT (const GLshort *); -GLAPI void APIENTRY glSecondaryColor3ubEXT (GLubyte, GLubyte, GLubyte); -GLAPI void APIENTRY glSecondaryColor3ubvEXT (const GLubyte *); -GLAPI void APIENTRY glSecondaryColor3uiEXT (GLuint, GLuint, GLuint); -GLAPI void APIENTRY glSecondaryColor3uivEXT (const GLuint *); -GLAPI void APIENTRY glSecondaryColor3usEXT (GLushort, GLushort, GLushort); -GLAPI void APIENTRY glSecondaryColor3usvEXT (const GLushort *); -GLAPI void APIENTRY glSecondaryColorPointerEXT (GLint, GLenum, GLsizei, const GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BEXTPROC) (GLbyte red, GLbyte green, GLbyte blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BVEXTPROC) (const GLbyte *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DEXTPROC) (GLdouble red, GLdouble green, GLdouble blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DVEXTPROC) (const GLdouble *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FEXTPROC) (GLfloat red, GLfloat green, GLfloat blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FVEXTPROC) (const GLfloat *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IEXTPROC) (GLint red, GLint green, GLint blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IVEXTPROC) (const GLint *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SEXTPROC) (GLshort red, GLshort green, GLshort blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SVEXTPROC) (const GLshort *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBEXTPROC) (GLubyte red, GLubyte green, GLubyte blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBVEXTPROC) (const GLubyte *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIEXTPROC) (GLuint red, GLuint green, GLuint blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIVEXTPROC) (const GLuint *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USEXTPROC) (GLushort red, GLushort green, GLushort blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USVEXTPROC) (const GLushort *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); -#endif - -#ifndef GL_EXT_texture_perturb_normal -#define GL_EXT_texture_perturb_normal 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glTextureNormalEXT (GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLTEXTURENORMALEXTPROC) (GLenum mode); -#endif - -#ifndef GL_EXT_multi_draw_arrays -#define GL_EXT_multi_draw_arrays 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glMultiDrawArraysEXT (GLenum, GLint *, GLsizei *, GLsizei); -GLAPI void APIENTRY glMultiDrawElementsEXT (GLenum, const GLsizei *, GLenum, const GLvoid* *, GLsizei); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSEXTPROC) (GLenum mode, GLint *first, GLsizei *count, GLsizei primcount); -typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSEXTPROC) (GLenum mode, const GLsizei *count, GLenum type, const GLvoid* *indices, GLsizei primcount); -#endif - -#ifndef GL_EXT_fog_coord -#define GL_EXT_fog_coord 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glFogCoordfEXT (GLfloat); -GLAPI void APIENTRY glFogCoordfvEXT (const GLfloat *); -GLAPI void APIENTRY glFogCoorddEXT (GLdouble); -GLAPI void APIENTRY glFogCoorddvEXT (const GLdouble *); -GLAPI void APIENTRY glFogCoordPointerEXT (GLenum, GLsizei, const GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLFOGCOORDFEXTPROC) (GLfloat coord); -typedef void (APIENTRYP PFNGLFOGCOORDFVEXTPROC) (const GLfloat *coord); -typedef void (APIENTRYP PFNGLFOGCOORDDEXTPROC) (GLdouble coord); -typedef void (APIENTRYP PFNGLFOGCOORDDVEXTPROC) (const GLdouble *coord); -typedef void (APIENTRYP PFNGLFOGCOORDPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer); -#endif - -#ifndef GL_REND_screen_coordinates -#define GL_REND_screen_coordinates 1 -#endif - -#ifndef GL_EXT_coordinate_frame -#define GL_EXT_coordinate_frame 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glTangent3bEXT (GLbyte, GLbyte, GLbyte); -GLAPI void APIENTRY glTangent3bvEXT (const GLbyte *); -GLAPI void APIENTRY glTangent3dEXT (GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glTangent3dvEXT (const GLdouble *); -GLAPI void APIENTRY glTangent3fEXT (GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glTangent3fvEXT (const GLfloat *); -GLAPI void APIENTRY glTangent3iEXT (GLint, GLint, GLint); -GLAPI void APIENTRY glTangent3ivEXT (const GLint *); -GLAPI void APIENTRY glTangent3sEXT (GLshort, GLshort, GLshort); -GLAPI void APIENTRY glTangent3svEXT (const GLshort *); -GLAPI void APIENTRY glBinormal3bEXT (GLbyte, GLbyte, GLbyte); -GLAPI void APIENTRY glBinormal3bvEXT (const GLbyte *); -GLAPI void APIENTRY glBinormal3dEXT (GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glBinormal3dvEXT (const GLdouble *); -GLAPI void APIENTRY glBinormal3fEXT (GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glBinormal3fvEXT (const GLfloat *); -GLAPI void APIENTRY glBinormal3iEXT (GLint, GLint, GLint); -GLAPI void APIENTRY glBinormal3ivEXT (const GLint *); -GLAPI void APIENTRY glBinormal3sEXT (GLshort, GLshort, GLshort); -GLAPI void APIENTRY glBinormal3svEXT (const GLshort *); -GLAPI void APIENTRY glTangentPointerEXT (GLenum, GLsizei, const GLvoid *); -GLAPI void APIENTRY glBinormalPointerEXT (GLenum, GLsizei, const GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLTANGENT3BEXTPROC) (GLbyte tx, GLbyte ty, GLbyte tz); -typedef void (APIENTRYP PFNGLTANGENT3BVEXTPROC) (const GLbyte *v); -typedef void (APIENTRYP PFNGLTANGENT3DEXTPROC) (GLdouble tx, GLdouble ty, GLdouble tz); -typedef void (APIENTRYP PFNGLTANGENT3DVEXTPROC) (const GLdouble *v); -typedef void (APIENTRYP PFNGLTANGENT3FEXTPROC) (GLfloat tx, GLfloat ty, GLfloat tz); -typedef void (APIENTRYP PFNGLTANGENT3FVEXTPROC) (const GLfloat *v); -typedef void (APIENTRYP PFNGLTANGENT3IEXTPROC) (GLint tx, GLint ty, GLint tz); -typedef void (APIENTRYP PFNGLTANGENT3IVEXTPROC) (const GLint *v); -typedef void (APIENTRYP PFNGLTANGENT3SEXTPROC) (GLshort tx, GLshort ty, GLshort tz); -typedef void (APIENTRYP PFNGLTANGENT3SVEXTPROC) (const GLshort *v); -typedef void (APIENTRYP PFNGLBINORMAL3BEXTPROC) (GLbyte bx, GLbyte by, GLbyte bz); -typedef void (APIENTRYP PFNGLBINORMAL3BVEXTPROC) (const GLbyte *v); -typedef void (APIENTRYP PFNGLBINORMAL3DEXTPROC) (GLdouble bx, GLdouble by, GLdouble bz); -typedef void (APIENTRYP PFNGLBINORMAL3DVEXTPROC) (const GLdouble *v); -typedef void (APIENTRYP PFNGLBINORMAL3FEXTPROC) (GLfloat bx, GLfloat by, GLfloat bz); -typedef void (APIENTRYP PFNGLBINORMAL3FVEXTPROC) (const GLfloat *v); -typedef void (APIENTRYP PFNGLBINORMAL3IEXTPROC) (GLint bx, GLint by, GLint bz); -typedef void (APIENTRYP PFNGLBINORMAL3IVEXTPROC) (const GLint *v); -typedef void (APIENTRYP PFNGLBINORMAL3SEXTPROC) (GLshort bx, GLshort by, GLshort bz); -typedef void (APIENTRYP PFNGLBINORMAL3SVEXTPROC) (const GLshort *v); -typedef void (APIENTRYP PFNGLTANGENTPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLBINORMALPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer); -#endif - -#ifndef GL_EXT_texture_env_combine -#define GL_EXT_texture_env_combine 1 -#endif - -#ifndef GL_APPLE_specular_vector -#define GL_APPLE_specular_vector 1 -#endif - -#ifndef GL_APPLE_transform_hint -#define GL_APPLE_transform_hint 1 -#endif - -#ifndef GL_SGIX_fog_scale -#define GL_SGIX_fog_scale 1 -#endif - -#ifndef GL_SUNX_constant_data -#define GL_SUNX_constant_data 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glFinishTextureSUNX (void); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLFINISHTEXTURESUNXPROC) (void); -#endif - -#ifndef GL_SUN_global_alpha -#define GL_SUN_global_alpha 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glGlobalAlphaFactorbSUN (GLbyte); -GLAPI void APIENTRY glGlobalAlphaFactorsSUN (GLshort); -GLAPI void APIENTRY glGlobalAlphaFactoriSUN (GLint); -GLAPI void APIENTRY glGlobalAlphaFactorfSUN (GLfloat); -GLAPI void APIENTRY glGlobalAlphaFactordSUN (GLdouble); -GLAPI void APIENTRY glGlobalAlphaFactorubSUN (GLubyte); -GLAPI void APIENTRY glGlobalAlphaFactorusSUN (GLushort); -GLAPI void APIENTRY glGlobalAlphaFactoruiSUN (GLuint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORBSUNPROC) (GLbyte factor); -typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORSSUNPROC) (GLshort factor); -typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORISUNPROC) (GLint factor); -typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORFSUNPROC) (GLfloat factor); -typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORDSUNPROC) (GLdouble factor); -typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORUBSUNPROC) (GLubyte factor); -typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORUSSUNPROC) (GLushort factor); -typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORUISUNPROC) (GLuint factor); -#endif - -#ifndef GL_SUN_triangle_list -#define GL_SUN_triangle_list 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glReplacementCodeuiSUN (GLuint); -GLAPI void APIENTRY glReplacementCodeusSUN (GLushort); -GLAPI void APIENTRY glReplacementCodeubSUN (GLubyte); -GLAPI void APIENTRY glReplacementCodeuivSUN (const GLuint *); -GLAPI void APIENTRY glReplacementCodeusvSUN (const GLushort *); -GLAPI void APIENTRY glReplacementCodeubvSUN (const GLubyte *); -GLAPI void APIENTRY glReplacementCodePointerSUN (GLenum, GLsizei, const GLvoid* *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUISUNPROC) (GLuint code); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUSSUNPROC) (GLushort code); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUBSUNPROC) (GLubyte code); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUIVSUNPROC) (const GLuint *code); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUSVSUNPROC) (const GLushort *code); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUBVSUNPROC) (const GLubyte *code); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEPOINTERSUNPROC) (GLenum type, GLsizei stride, const GLvoid* *pointer); -#endif - -#ifndef GL_SUN_vertex -#define GL_SUN_vertex 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glColor4ubVertex2fSUN (GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat); -GLAPI void APIENTRY glColor4ubVertex2fvSUN (const GLubyte *, const GLfloat *); -GLAPI void APIENTRY glColor4ubVertex3fSUN (GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glColor4ubVertex3fvSUN (const GLubyte *, const GLfloat *); -GLAPI void APIENTRY glColor3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glColor3fVertex3fvSUN (const GLfloat *, const GLfloat *); -GLAPI void APIENTRY glNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *); -GLAPI void APIENTRY glColor4fNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glColor4fNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *); -GLAPI void APIENTRY glTexCoord2fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glTexCoord2fVertex3fvSUN (const GLfloat *, const GLfloat *); -GLAPI void APIENTRY glTexCoord4fVertex4fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glTexCoord4fVertex4fvSUN (const GLfloat *, const GLfloat *); -GLAPI void APIENTRY glTexCoord2fColor4ubVertex3fSUN (GLfloat, GLfloat, GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glTexCoord2fColor4ubVertex3fvSUN (const GLfloat *, const GLubyte *, const GLfloat *); -GLAPI void APIENTRY glTexCoord2fColor3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glTexCoord2fColor3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *); -GLAPI void APIENTRY glTexCoord2fNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glTexCoord2fNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *); -GLAPI void APIENTRY glTexCoord2fColor4fNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glTexCoord2fColor4fNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *, const GLfloat *); -GLAPI void APIENTRY glTexCoord4fColor4fNormal3fVertex4fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glTexCoord4fColor4fNormal3fVertex4fvSUN (const GLfloat *, const GLfloat *, const GLfloat *, const GLfloat *); -GLAPI void APIENTRY glReplacementCodeuiVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glReplacementCodeuiVertex3fvSUN (const GLuint *, const GLfloat *); -GLAPI void APIENTRY glReplacementCodeuiColor4ubVertex3fSUN (GLuint, GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glReplacementCodeuiColor4ubVertex3fvSUN (const GLuint *, const GLubyte *, const GLfloat *); -GLAPI void APIENTRY glReplacementCodeuiColor3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glReplacementCodeuiColor3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *); -GLAPI void APIENTRY glReplacementCodeuiNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glReplacementCodeuiNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *); -GLAPI void APIENTRY glReplacementCodeuiColor4fNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glReplacementCodeuiColor4fNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *, const GLfloat *); -GLAPI void APIENTRY glReplacementCodeuiTexCoord2fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glReplacementCodeuiTexCoord2fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *); -GLAPI void APIENTRY glReplacementCodeuiTexCoord2fNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glReplacementCodeuiTexCoord2fNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *, const GLfloat *); -GLAPI void APIENTRY glReplacementCodeuiTexCoord2fColor4fNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glReplacementCodeuiTexCoord2fColor4fNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *, const GLfloat *, const GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX2FSUNPROC) (GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y); -typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX2FVSUNPROC) (const GLubyte *c, const GLfloat *v); -typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX3FSUNPROC) (GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX3FVSUNPROC) (const GLubyte *c, const GLfloat *v); -typedef void (APIENTRYP PFNGLCOLOR3FVERTEX3FSUNPROC) (GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLCOLOR3FVERTEX3FVSUNPROC) (const GLfloat *c, const GLfloat *v); -typedef void (APIENTRYP PFNGLNORMAL3FVERTEX3FSUNPROC) (GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *n, const GLfloat *v); -typedef void (APIENTRYP PFNGLCOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLCOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *c, const GLfloat *n, const GLfloat *v); -typedef void (APIENTRYP PFNGLTEXCOORD2FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLTEXCOORD2FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *v); -typedef void (APIENTRYP PFNGLTEXCOORD4FVERTEX4FSUNPROC) (GLfloat s, GLfloat t, GLfloat p, GLfloat q, GLfloat x, GLfloat y, GLfloat z, GLfloat w); -typedef void (APIENTRYP PFNGLTEXCOORD4FVERTEX4FVSUNPROC) (const GLfloat *tc, const GLfloat *v); -typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4UBVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4UBVERTEX3FVSUNPROC) (const GLfloat *tc, const GLubyte *c, const GLfloat *v); -typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR3FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR3FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *c, const GLfloat *v); -typedef void (APIENTRYP PFNGLTEXCOORD2FNORMAL3FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLTEXCOORD2FNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *n, const GLfloat *v); -typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v); -typedef void (APIENTRYP PFNGLTEXCOORD4FCOLOR4FNORMAL3FVERTEX4FSUNPROC) (GLfloat s, GLfloat t, GLfloat p, GLfloat q, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z, GLfloat w); -typedef void (APIENTRYP PFNGLTEXCOORD4FCOLOR4FNORMAL3FVERTEX4FVSUNPROC) (const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUIVERTEX3FSUNPROC) (GLuint rc, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUIVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *v); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4UBVERTEX3FSUNPROC) (GLuint rc, GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4UBVERTEX3FVSUNPROC) (const GLuint *rc, const GLubyte *c, const GLfloat *v); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR3FVERTEX3FSUNPROC) (GLuint rc, GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *c, const GLfloat *v); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUINORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUINORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *n, const GLfloat *v); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *c, const GLfloat *n, const GLfloat *v); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FVERTEX3FSUNPROC) (GLuint rc, GLfloat s, GLfloat t, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *tc, const GLfloat *v); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FNORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat s, GLfloat t, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FNORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *tc, const GLfloat *n, const GLfloat *v); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FCOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FCOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v); -#endif - -#ifndef GL_EXT_blend_func_separate -#define GL_EXT_blend_func_separate 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glBlendFuncSeparateEXT (GLenum, GLenum, GLenum, GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEEXTPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); -#endif - -#ifndef GL_INGR_blend_func_separate -#define GL_INGR_blend_func_separate 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glBlendFuncSeparateINGR (GLenum, GLenum, GLenum, GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEINGRPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); -#endif - -#ifndef GL_INGR_color_clamp -#define GL_INGR_color_clamp 1 -#endif - -#ifndef GL_INGR_interlace_read -#define GL_INGR_interlace_read 1 -#endif - -#ifndef GL_EXT_stencil_wrap -#define GL_EXT_stencil_wrap 1 -#endif - -#ifndef GL_EXT_422_pixels -#define GL_EXT_422_pixels 1 -#endif - -#ifndef GL_NV_texgen_reflection -#define GL_NV_texgen_reflection 1 -#endif - -#ifndef GL_SUN_convolution_border_modes -#define GL_SUN_convolution_border_modes 1 -#endif - -#ifndef GL_EXT_texture_env_add -#define GL_EXT_texture_env_add 1 -#endif - -#ifndef GL_EXT_texture_lod_bias -#define GL_EXT_texture_lod_bias 1 -#endif - -#ifndef GL_EXT_texture_filter_anisotropic -#define GL_EXT_texture_filter_anisotropic 1 -#endif - -#ifndef GL_EXT_vertex_weighting -#define GL_EXT_vertex_weighting 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glVertexWeightfEXT (GLfloat); -GLAPI void APIENTRY glVertexWeightfvEXT (const GLfloat *); -GLAPI void APIENTRY glVertexWeightPointerEXT (GLsizei, GLenum, GLsizei, const GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLVERTEXWEIGHTFEXTPROC) (GLfloat weight); -typedef void (APIENTRYP PFNGLVERTEXWEIGHTFVEXTPROC) (const GLfloat *weight); -typedef void (APIENTRYP PFNGLVERTEXWEIGHTPOINTEREXTPROC) (GLsizei size, GLenum type, GLsizei stride, const GLvoid *pointer); -#endif - -#ifndef GL_NV_light_max_exponent -#define GL_NV_light_max_exponent 1 -#endif - -#ifndef GL_NV_vertex_array_range -#define GL_NV_vertex_array_range 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glFlushVertexArrayRangeNV (void); -GLAPI void APIENTRY glVertexArrayRangeNV (GLsizei, const GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLFLUSHVERTEXARRAYRANGENVPROC) (void); -typedef void (APIENTRYP PFNGLVERTEXARRAYRANGENVPROC) (GLsizei length, const GLvoid *pointer); -#endif - -#ifndef GL_NV_register_combiners -#define GL_NV_register_combiners 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glCombinerParameterfvNV (GLenum, const GLfloat *); -GLAPI void APIENTRY glCombinerParameterfNV (GLenum, GLfloat); -GLAPI void APIENTRY glCombinerParameterivNV (GLenum, const GLint *); -GLAPI void APIENTRY glCombinerParameteriNV (GLenum, GLint); -GLAPI void APIENTRY glCombinerInputNV (GLenum, GLenum, GLenum, GLenum, GLenum, GLenum); -GLAPI void APIENTRY glCombinerOutputNV (GLenum, GLenum, GLenum, GLenum, GLenum, GLenum, GLenum, GLboolean, GLboolean, GLboolean); -GLAPI void APIENTRY glFinalCombinerInputNV (GLenum, GLenum, GLenum, GLenum); -GLAPI void APIENTRY glGetCombinerInputParameterfvNV (GLenum, GLenum, GLenum, GLenum, GLfloat *); -GLAPI void APIENTRY glGetCombinerInputParameterivNV (GLenum, GLenum, GLenum, GLenum, GLint *); -GLAPI void APIENTRY glGetCombinerOutputParameterfvNV (GLenum, GLenum, GLenum, GLfloat *); -GLAPI void APIENTRY glGetCombinerOutputParameterivNV (GLenum, GLenum, GLenum, GLint *); -GLAPI void APIENTRY glGetFinalCombinerInputParameterfvNV (GLenum, GLenum, GLfloat *); -GLAPI void APIENTRY glGetFinalCombinerInputParameterivNV (GLenum, GLenum, GLint *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLCOMBINERPARAMETERFVNVPROC) (GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLCOMBINERPARAMETERFNVPROC) (GLenum pname, GLfloat param); -typedef void (APIENTRYP PFNGLCOMBINERPARAMETERIVNVPROC) (GLenum pname, const GLint *params); -typedef void (APIENTRYP PFNGLCOMBINERPARAMETERINVPROC) (GLenum pname, GLint param); -typedef void (APIENTRYP PFNGLCOMBINERINPUTNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum input, GLenum mapping, GLenum componentUsage); -typedef void (APIENTRYP PFNGLCOMBINEROUTPUTNVPROC) (GLenum stage, GLenum portion, GLenum abOutput, GLenum cdOutput, GLenum sumOutput, GLenum scale, GLenum bias, GLboolean abDotProduct, GLboolean cdDotProduct, GLboolean muxSum); -typedef void (APIENTRYP PFNGLFINALCOMBINERINPUTNVPROC) (GLenum variable, GLenum input, GLenum mapping, GLenum componentUsage); -typedef void (APIENTRYP PFNGLGETCOMBINERINPUTPARAMETERFVNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETCOMBINERINPUTPARAMETERIVNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETCOMBINEROUTPUTPARAMETERFVNVPROC) (GLenum stage, GLenum portion, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETCOMBINEROUTPUTPARAMETERIVNVPROC) (GLenum stage, GLenum portion, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETFINALCOMBINERINPUTPARAMETERFVNVPROC) (GLenum variable, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETFINALCOMBINERINPUTPARAMETERIVNVPROC) (GLenum variable, GLenum pname, GLint *params); -#endif - -#ifndef GL_NV_fog_distance -#define GL_NV_fog_distance 1 -#endif - -#ifndef GL_NV_texgen_emboss -#define GL_NV_texgen_emboss 1 -#endif - -#ifndef GL_NV_blend_square -#define GL_NV_blend_square 1 -#endif - -#ifndef GL_NV_texture_env_combine4 -#define GL_NV_texture_env_combine4 1 -#endif - -#ifndef GL_MESA_resize_buffers -#define GL_MESA_resize_buffers 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glResizeBuffersMESA (void); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLRESIZEBUFFERSMESAPROC) (void); -#endif - -#ifndef GL_MESA_window_pos -#define GL_MESA_window_pos 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glWindowPos2dMESA (GLdouble, GLdouble); -GLAPI void APIENTRY glWindowPos2dvMESA (const GLdouble *); -GLAPI void APIENTRY glWindowPos2fMESA (GLfloat, GLfloat); -GLAPI void APIENTRY glWindowPos2fvMESA (const GLfloat *); -GLAPI void APIENTRY glWindowPos2iMESA (GLint, GLint); -GLAPI void APIENTRY glWindowPos2ivMESA (const GLint *); -GLAPI void APIENTRY glWindowPos2sMESA (GLshort, GLshort); -GLAPI void APIENTRY glWindowPos2svMESA (const GLshort *); -GLAPI void APIENTRY glWindowPos3dMESA (GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glWindowPos3dvMESA (const GLdouble *); -GLAPI void APIENTRY glWindowPos3fMESA (GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glWindowPos3fvMESA (const GLfloat *); -GLAPI void APIENTRY glWindowPos3iMESA (GLint, GLint, GLint); -GLAPI void APIENTRY glWindowPos3ivMESA (const GLint *); -GLAPI void APIENTRY glWindowPos3sMESA (GLshort, GLshort, GLshort); -GLAPI void APIENTRY glWindowPos3svMESA (const GLshort *); -GLAPI void APIENTRY glWindowPos4dMESA (GLdouble, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glWindowPos4dvMESA (const GLdouble *); -GLAPI void APIENTRY glWindowPos4fMESA (GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glWindowPos4fvMESA (const GLfloat *); -GLAPI void APIENTRY glWindowPos4iMESA (GLint, GLint, GLint, GLint); -GLAPI void APIENTRY glWindowPos4ivMESA (const GLint *); -GLAPI void APIENTRY glWindowPos4sMESA (GLshort, GLshort, GLshort, GLshort); -GLAPI void APIENTRY glWindowPos4svMESA (const GLshort *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLWINDOWPOS2DMESAPROC) (GLdouble x, GLdouble y); -typedef void (APIENTRYP PFNGLWINDOWPOS2DVMESAPROC) (const GLdouble *v); -typedef void (APIENTRYP PFNGLWINDOWPOS2FMESAPROC) (GLfloat x, GLfloat y); -typedef void (APIENTRYP PFNGLWINDOWPOS2FVMESAPROC) (const GLfloat *v); -typedef void (APIENTRYP PFNGLWINDOWPOS2IMESAPROC) (GLint x, GLint y); -typedef void (APIENTRYP PFNGLWINDOWPOS2IVMESAPROC) (const GLint *v); -typedef void (APIENTRYP PFNGLWINDOWPOS2SMESAPROC) (GLshort x, GLshort y); -typedef void (APIENTRYP PFNGLWINDOWPOS2SVMESAPROC) (const GLshort *v); -typedef void (APIENTRYP PFNGLWINDOWPOS3DMESAPROC) (GLdouble x, GLdouble y, GLdouble z); -typedef void (APIENTRYP PFNGLWINDOWPOS3DVMESAPROC) (const GLdouble *v); -typedef void (APIENTRYP PFNGLWINDOWPOS3FMESAPROC) (GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLWINDOWPOS3FVMESAPROC) (const GLfloat *v); -typedef void (APIENTRYP PFNGLWINDOWPOS3IMESAPROC) (GLint x, GLint y, GLint z); -typedef void (APIENTRYP PFNGLWINDOWPOS3IVMESAPROC) (const GLint *v); -typedef void (APIENTRYP PFNGLWINDOWPOS3SMESAPROC) (GLshort x, GLshort y, GLshort z); -typedef void (APIENTRYP PFNGLWINDOWPOS3SVMESAPROC) (const GLshort *v); -typedef void (APIENTRYP PFNGLWINDOWPOS4DMESAPROC) (GLdouble x, GLdouble y, GLdouble z, GLdouble w); -typedef void (APIENTRYP PFNGLWINDOWPOS4DVMESAPROC) (const GLdouble *v); -typedef void (APIENTRYP PFNGLWINDOWPOS4FMESAPROC) (GLfloat x, GLfloat y, GLfloat z, GLfloat w); -typedef void (APIENTRYP PFNGLWINDOWPOS4FVMESAPROC) (const GLfloat *v); -typedef void (APIENTRYP PFNGLWINDOWPOS4IMESAPROC) (GLint x, GLint y, GLint z, GLint w); -typedef void (APIENTRYP PFNGLWINDOWPOS4IVMESAPROC) (const GLint *v); -typedef void (APIENTRYP PFNGLWINDOWPOS4SMESAPROC) (GLshort x, GLshort y, GLshort z, GLshort w); -typedef void (APIENTRYP PFNGLWINDOWPOS4SVMESAPROC) (const GLshort *v); -#endif - -#ifndef GL_IBM_cull_vertex -#define GL_IBM_cull_vertex 1 -#endif - -#ifndef GL_IBM_multimode_draw_arrays -#define GL_IBM_multimode_draw_arrays 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glMultiModeDrawArraysIBM (const GLenum *, const GLint *, const GLsizei *, GLsizei, GLint); -GLAPI void APIENTRY glMultiModeDrawElementsIBM (const GLenum *, const GLsizei *, GLenum, const GLvoid* const *, GLsizei, GLint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLMULTIMODEDRAWARRAYSIBMPROC) (const GLenum *mode, const GLint *first, const GLsizei *count, GLsizei primcount, GLint modestride); -typedef void (APIENTRYP PFNGLMULTIMODEDRAWELEMENTSIBMPROC) (const GLenum *mode, const GLsizei *count, GLenum type, const GLvoid* const *indices, GLsizei primcount, GLint modestride); -#endif - -#ifndef GL_IBM_vertex_array_lists -#define GL_IBM_vertex_array_lists 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glColorPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint); -GLAPI void APIENTRY glSecondaryColorPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint); -GLAPI void APIENTRY glEdgeFlagPointerListIBM (GLint, const GLboolean* *, GLint); -GLAPI void APIENTRY glFogCoordPointerListIBM (GLenum, GLint, const GLvoid* *, GLint); -GLAPI void APIENTRY glIndexPointerListIBM (GLenum, GLint, const GLvoid* *, GLint); -GLAPI void APIENTRY glNormalPointerListIBM (GLenum, GLint, const GLvoid* *, GLint); -GLAPI void APIENTRY glTexCoordPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint); -GLAPI void APIENTRY glVertexPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLCOLORPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); -typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); -typedef void (APIENTRYP PFNGLEDGEFLAGPOINTERLISTIBMPROC) (GLint stride, const GLboolean* *pointer, GLint ptrstride); -typedef void (APIENTRYP PFNGLFOGCOORDPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); -typedef void (APIENTRYP PFNGLINDEXPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); -typedef void (APIENTRYP PFNGLNORMALPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); -typedef void (APIENTRYP PFNGLTEXCOORDPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); -typedef void (APIENTRYP PFNGLVERTEXPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); -#endif - -#ifndef GL_SGIX_subsample -#define GL_SGIX_subsample 1 -#endif - -#ifndef GL_SGIX_ycrcba -#define GL_SGIX_ycrcba 1 -#endif - -#ifndef GL_SGIX_ycrcb_subsample -#define GL_SGIX_ycrcb_subsample 1 -#endif - -#ifndef GL_SGIX_depth_pass_instrument -#define GL_SGIX_depth_pass_instrument 1 -#endif - -#ifndef GL_3DFX_texture_compression_FXT1 -#define GL_3DFX_texture_compression_FXT1 1 -#endif - -#ifndef GL_3DFX_multisample -#define GL_3DFX_multisample 1 -#endif - -#ifndef GL_3DFX_tbuffer -#define GL_3DFX_tbuffer 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glTbufferMask3DFX (GLuint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLTBUFFERMASK3DFXPROC) (GLuint mask); -#endif - -#ifndef GL_EXT_multisample -#define GL_EXT_multisample 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glSampleMaskEXT (GLclampf, GLboolean); -GLAPI void APIENTRY glSamplePatternEXT (GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLSAMPLEMASKEXTPROC) (GLclampf value, GLboolean invert); -typedef void (APIENTRYP PFNGLSAMPLEPATTERNEXTPROC) (GLenum pattern); -#endif - -#ifndef GL_SGIX_vertex_preclip -#define GL_SGIX_vertex_preclip 1 -#endif - -#ifndef GL_SGIX_convolution_accuracy -#define GL_SGIX_convolution_accuracy 1 -#endif - -#ifndef GL_SGIX_resample -#define GL_SGIX_resample 1 -#endif - -#ifndef GL_SGIS_point_line_texgen -#define GL_SGIS_point_line_texgen 1 -#endif - -#ifndef GL_SGIS_texture_color_mask -#define GL_SGIS_texture_color_mask 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glTextureColorMaskSGIS (GLboolean, GLboolean, GLboolean, GLboolean); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLTEXTURECOLORMASKSGISPROC) (GLboolean red, GLboolean green, GLboolean blue, GLboolean alpha); -#endif - -#ifndef GL_SGIX_igloo_interface -#define GL_SGIX_igloo_interface 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glIglooInterfaceSGIX (GLenum, const GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLIGLOOINTERFACESGIXPROC) (GLenum pname, const GLvoid *params); -#endif - -#ifndef GL_EXT_texture_env_dot3 -#define GL_EXT_texture_env_dot3 1 -#endif - -#ifndef GL_ATI_texture_mirror_once -#define GL_ATI_texture_mirror_once 1 -#endif - -#ifndef GL_NV_fence -#define GL_NV_fence 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glDeleteFencesNV (GLsizei, const GLuint *); -GLAPI void APIENTRY glGenFencesNV (GLsizei, GLuint *); -GLAPI GLboolean APIENTRY glIsFenceNV (GLuint); -GLAPI GLboolean APIENTRY glTestFenceNV (GLuint); -GLAPI void APIENTRY glGetFenceivNV (GLuint, GLenum, GLint *); -GLAPI void APIENTRY glFinishFenceNV (GLuint); -GLAPI void APIENTRY glSetFenceNV (GLuint, GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLDELETEFENCESNVPROC) (GLsizei n, const GLuint *fences); -typedef void (APIENTRYP PFNGLGENFENCESNVPROC) (GLsizei n, GLuint *fences); -typedef GLboolean (APIENTRYP PFNGLISFENCENVPROC) (GLuint fence); -typedef GLboolean (APIENTRYP PFNGLTESTFENCENVPROC) (GLuint fence); -typedef void (APIENTRYP PFNGLGETFENCEIVNVPROC) (GLuint fence, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLFINISHFENCENVPROC) (GLuint fence); -typedef void (APIENTRYP PFNGLSETFENCENVPROC) (GLuint fence, GLenum condition); -#endif - -#ifndef GL_NV_evaluators -#define GL_NV_evaluators 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glMapControlPointsNV (GLenum, GLuint, GLenum, GLsizei, GLsizei, GLint, GLint, GLboolean, const GLvoid *); -GLAPI void APIENTRY glMapParameterivNV (GLenum, GLenum, const GLint *); -GLAPI void APIENTRY glMapParameterfvNV (GLenum, GLenum, const GLfloat *); -GLAPI void APIENTRY glGetMapControlPointsNV (GLenum, GLuint, GLenum, GLsizei, GLsizei, GLboolean, GLvoid *); -GLAPI void APIENTRY glGetMapParameterivNV (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glGetMapParameterfvNV (GLenum, GLenum, GLfloat *); -GLAPI void APIENTRY glGetMapAttribParameterivNV (GLenum, GLuint, GLenum, GLint *); -GLAPI void APIENTRY glGetMapAttribParameterfvNV (GLenum, GLuint, GLenum, GLfloat *); -GLAPI void APIENTRY glEvalMapsNV (GLenum, GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLMAPCONTROLPOINTSNVPROC) (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLint uorder, GLint vorder, GLboolean packed, const GLvoid *points); -typedef void (APIENTRYP PFNGLMAPPARAMETERIVNVPROC) (GLenum target, GLenum pname, const GLint *params); -typedef void (APIENTRYP PFNGLMAPPARAMETERFVNVPROC) (GLenum target, GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLGETMAPCONTROLPOINTSNVPROC) (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLboolean packed, GLvoid *points); -typedef void (APIENTRYP PFNGLGETMAPPARAMETERIVNVPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETMAPPARAMETERFVNVPROC) (GLenum target, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETMAPATTRIBPARAMETERIVNVPROC) (GLenum target, GLuint index, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETMAPATTRIBPARAMETERFVNVPROC) (GLenum target, GLuint index, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLEVALMAPSNVPROC) (GLenum target, GLenum mode); -#endif - -#ifndef GL_NV_packed_depth_stencil -#define GL_NV_packed_depth_stencil 1 -#endif - -#ifndef GL_NV_register_combiners2 -#define GL_NV_register_combiners2 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glCombinerStageParameterfvNV (GLenum, GLenum, const GLfloat *); -GLAPI void APIENTRY glGetCombinerStageParameterfvNV (GLenum, GLenum, GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLCOMBINERSTAGEPARAMETERFVNVPROC) (GLenum stage, GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLGETCOMBINERSTAGEPARAMETERFVNVPROC) (GLenum stage, GLenum pname, GLfloat *params); -#endif - -#ifndef GL_NV_texture_compression_vtc -#define GL_NV_texture_compression_vtc 1 -#endif - -#ifndef GL_NV_texture_rectangle -#define GL_NV_texture_rectangle 1 -#endif - -#ifndef GL_NV_texture_shader -#define GL_NV_texture_shader 1 -#endif - -#ifndef GL_NV_texture_shader2 -#define GL_NV_texture_shader2 1 -#endif - -#ifndef GL_NV_vertex_array_range2 -#define GL_NV_vertex_array_range2 1 -#endif - -#ifndef GL_NV_vertex_program -#define GL_NV_vertex_program 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI GLboolean APIENTRY glAreProgramsResidentNV (GLsizei, const GLuint *, GLboolean *); -GLAPI void APIENTRY glBindProgramNV (GLenum, GLuint); -GLAPI void APIENTRY glDeleteProgramsNV (GLsizei, const GLuint *); -GLAPI void APIENTRY glExecuteProgramNV (GLenum, GLuint, const GLfloat *); -GLAPI void APIENTRY glGenProgramsNV (GLsizei, GLuint *); -GLAPI void APIENTRY glGetProgramParameterdvNV (GLenum, GLuint, GLenum, GLdouble *); -GLAPI void APIENTRY glGetProgramParameterfvNV (GLenum, GLuint, GLenum, GLfloat *); -GLAPI void APIENTRY glGetProgramivNV (GLuint, GLenum, GLint *); -GLAPI void APIENTRY glGetProgramStringNV (GLuint, GLenum, GLubyte *); -GLAPI void APIENTRY glGetTrackMatrixivNV (GLenum, GLuint, GLenum, GLint *); -GLAPI void APIENTRY glGetVertexAttribdvNV (GLuint, GLenum, GLdouble *); -GLAPI void APIENTRY glGetVertexAttribfvNV (GLuint, GLenum, GLfloat *); -GLAPI void APIENTRY glGetVertexAttribivNV (GLuint, GLenum, GLint *); -GLAPI void APIENTRY glGetVertexAttribPointervNV (GLuint, GLenum, GLvoid* *); -GLAPI GLboolean APIENTRY glIsProgramNV (GLuint); -GLAPI void APIENTRY glLoadProgramNV (GLenum, GLuint, GLsizei, const GLubyte *); -GLAPI void APIENTRY glProgramParameter4dNV (GLenum, GLuint, GLdouble, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glProgramParameter4dvNV (GLenum, GLuint, const GLdouble *); -GLAPI void APIENTRY glProgramParameter4fNV (GLenum, GLuint, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glProgramParameter4fvNV (GLenum, GLuint, const GLfloat *); -GLAPI void APIENTRY glProgramParameters4dvNV (GLenum, GLuint, GLuint, const GLdouble *); -GLAPI void APIENTRY glProgramParameters4fvNV (GLenum, GLuint, GLuint, const GLfloat *); -GLAPI void APIENTRY glRequestResidentProgramsNV (GLsizei, const GLuint *); -GLAPI void APIENTRY glTrackMatrixNV (GLenum, GLuint, GLenum, GLenum); -GLAPI void APIENTRY glVertexAttribPointerNV (GLuint, GLint, GLenum, GLsizei, const GLvoid *); -GLAPI void APIENTRY glVertexAttrib1dNV (GLuint, GLdouble); -GLAPI void APIENTRY glVertexAttrib1dvNV (GLuint, const GLdouble *); -GLAPI void APIENTRY glVertexAttrib1fNV (GLuint, GLfloat); -GLAPI void APIENTRY glVertexAttrib1fvNV (GLuint, const GLfloat *); -GLAPI void APIENTRY glVertexAttrib1sNV (GLuint, GLshort); -GLAPI void APIENTRY glVertexAttrib1svNV (GLuint, const GLshort *); -GLAPI void APIENTRY glVertexAttrib2dNV (GLuint, GLdouble, GLdouble); -GLAPI void APIENTRY glVertexAttrib2dvNV (GLuint, const GLdouble *); -GLAPI void APIENTRY glVertexAttrib2fNV (GLuint, GLfloat, GLfloat); -GLAPI void APIENTRY glVertexAttrib2fvNV (GLuint, const GLfloat *); -GLAPI void APIENTRY glVertexAttrib2sNV (GLuint, GLshort, GLshort); -GLAPI void APIENTRY glVertexAttrib2svNV (GLuint, const GLshort *); -GLAPI void APIENTRY glVertexAttrib3dNV (GLuint, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glVertexAttrib3dvNV (GLuint, const GLdouble *); -GLAPI void APIENTRY glVertexAttrib3fNV (GLuint, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glVertexAttrib3fvNV (GLuint, const GLfloat *); -GLAPI void APIENTRY glVertexAttrib3sNV (GLuint, GLshort, GLshort, GLshort); -GLAPI void APIENTRY glVertexAttrib3svNV (GLuint, const GLshort *); -GLAPI void APIENTRY glVertexAttrib4dNV (GLuint, GLdouble, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glVertexAttrib4dvNV (GLuint, const GLdouble *); -GLAPI void APIENTRY glVertexAttrib4fNV (GLuint, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glVertexAttrib4fvNV (GLuint, const GLfloat *); -GLAPI void APIENTRY glVertexAttrib4sNV (GLuint, GLshort, GLshort, GLshort, GLshort); -GLAPI void APIENTRY glVertexAttrib4svNV (GLuint, const GLshort *); -GLAPI void APIENTRY glVertexAttrib4ubNV (GLuint, GLubyte, GLubyte, GLubyte, GLubyte); -GLAPI void APIENTRY glVertexAttrib4ubvNV (GLuint, const GLubyte *); -GLAPI void APIENTRY glVertexAttribs1dvNV (GLuint, GLsizei, const GLdouble *); -GLAPI void APIENTRY glVertexAttribs1fvNV (GLuint, GLsizei, const GLfloat *); -GLAPI void APIENTRY glVertexAttribs1svNV (GLuint, GLsizei, const GLshort *); -GLAPI void APIENTRY glVertexAttribs2dvNV (GLuint, GLsizei, const GLdouble *); -GLAPI void APIENTRY glVertexAttribs2fvNV (GLuint, GLsizei, const GLfloat *); -GLAPI void APIENTRY glVertexAttribs2svNV (GLuint, GLsizei, const GLshort *); -GLAPI void APIENTRY glVertexAttribs3dvNV (GLuint, GLsizei, const GLdouble *); -GLAPI void APIENTRY glVertexAttribs3fvNV (GLuint, GLsizei, const GLfloat *); -GLAPI void APIENTRY glVertexAttribs3svNV (GLuint, GLsizei, const GLshort *); -GLAPI void APIENTRY glVertexAttribs4dvNV (GLuint, GLsizei, const GLdouble *); -GLAPI void APIENTRY glVertexAttribs4fvNV (GLuint, GLsizei, const GLfloat *); -GLAPI void APIENTRY glVertexAttribs4svNV (GLuint, GLsizei, const GLshort *); -GLAPI void APIENTRY glVertexAttribs4ubvNV (GLuint, GLsizei, const GLubyte *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef GLboolean (APIENTRYP PFNGLAREPROGRAMSRESIDENTNVPROC) (GLsizei n, const GLuint *programs, GLboolean *residences); -typedef void (APIENTRYP PFNGLBINDPROGRAMNVPROC) (GLenum target, GLuint id); -typedef void (APIENTRYP PFNGLDELETEPROGRAMSNVPROC) (GLsizei n, const GLuint *programs); -typedef void (APIENTRYP PFNGLEXECUTEPROGRAMNVPROC) (GLenum target, GLuint id, const GLfloat *params); -typedef void (APIENTRYP PFNGLGENPROGRAMSNVPROC) (GLsizei n, GLuint *programs); -typedef void (APIENTRYP PFNGLGETPROGRAMPARAMETERDVNVPROC) (GLenum target, GLuint index, GLenum pname, GLdouble *params); -typedef void (APIENTRYP PFNGLGETPROGRAMPARAMETERFVNVPROC) (GLenum target, GLuint index, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETPROGRAMIVNVPROC) (GLuint id, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETPROGRAMSTRINGNVPROC) (GLuint id, GLenum pname, GLubyte *program); -typedef void (APIENTRYP PFNGLGETTRACKMATRIXIVNVPROC) (GLenum target, GLuint address, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVNVPROC) (GLuint index, GLenum pname, GLdouble *params); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVNVPROC) (GLuint index, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVNVPROC) (GLuint index, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVNVPROC) (GLuint index, GLenum pname, GLvoid* *pointer); -typedef GLboolean (APIENTRYP PFNGLISPROGRAMNVPROC) (GLuint id); -typedef void (APIENTRYP PFNGLLOADPROGRAMNVPROC) (GLenum target, GLuint id, GLsizei len, const GLubyte *program); -typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4DNVPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); -typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4DVNVPROC) (GLenum target, GLuint index, const GLdouble *v); -typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4FNVPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); -typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4FVNVPROC) (GLenum target, GLuint index, const GLfloat *v); -typedef void (APIENTRYP PFNGLPROGRAMPARAMETERS4DVNVPROC) (GLenum target, GLuint index, GLuint count, const GLdouble *v); -typedef void (APIENTRYP PFNGLPROGRAMPARAMETERS4FVNVPROC) (GLenum target, GLuint index, GLuint count, const GLfloat *v); -typedef void (APIENTRYP PFNGLREQUESTRESIDENTPROGRAMSNVPROC) (GLsizei n, const GLuint *programs); -typedef void (APIENTRYP PFNGLTRACKMATRIXNVPROC) (GLenum target, GLuint address, GLenum matrix, GLenum transform); -typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERNVPROC) (GLuint index, GLint fsize, GLenum type, GLsizei stride, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1DNVPROC) (GLuint index, GLdouble x); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1DVNVPROC) (GLuint index, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1FNVPROC) (GLuint index, GLfloat x); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1FVNVPROC) (GLuint index, const GLfloat *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1SNVPROC) (GLuint index, GLshort x); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1SVNVPROC) (GLuint index, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2DNVPROC) (GLuint index, GLdouble x, GLdouble y); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2DVNVPROC) (GLuint index, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2FNVPROC) (GLuint index, GLfloat x, GLfloat y); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2FVNVPROC) (GLuint index, const GLfloat *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2SNVPROC) (GLuint index, GLshort x, GLshort y); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2SVNVPROC) (GLuint index, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3DNVPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3DVNVPROC) (GLuint index, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3FNVPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3FVNVPROC) (GLuint index, const GLfloat *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3SNVPROC) (GLuint index, GLshort x, GLshort y, GLshort z); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3SVNVPROC) (GLuint index, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4DNVPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4DVNVPROC) (GLuint index, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4FNVPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4FVNVPROC) (GLuint index, const GLfloat *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4SNVPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVNVPROC) (GLuint index, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBNVPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVNVPROC) (GLuint index, const GLubyte *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS1DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS1FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS1SVNVPROC) (GLuint index, GLsizei count, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS2DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS2FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS2SVNVPROC) (GLuint index, GLsizei count, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS3DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS3FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS3SVNVPROC) (GLuint index, GLsizei count, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS4DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS4FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS4SVNVPROC) (GLuint index, GLsizei count, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS4UBVNVPROC) (GLuint index, GLsizei count, const GLubyte *v); -#endif - -#ifndef GL_SGIX_texture_coordinate_clamp -#define GL_SGIX_texture_coordinate_clamp 1 -#endif - -#ifndef GL_SGIX_scalebias_hint -#define GL_SGIX_scalebias_hint 1 -#endif - -#ifndef GL_OML_interlace -#define GL_OML_interlace 1 -#endif - -#ifndef GL_OML_subsample -#define GL_OML_subsample 1 -#endif - -#ifndef GL_OML_resample -#define GL_OML_resample 1 -#endif - -#ifndef GL_NV_copy_depth_to_color -#define GL_NV_copy_depth_to_color 1 -#endif - -#ifndef GL_ATI_envmap_bumpmap -#define GL_ATI_envmap_bumpmap 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glTexBumpParameterivATI (GLenum, const GLint *); -GLAPI void APIENTRY glTexBumpParameterfvATI (GLenum, const GLfloat *); -GLAPI void APIENTRY glGetTexBumpParameterivATI (GLenum, GLint *); -GLAPI void APIENTRY glGetTexBumpParameterfvATI (GLenum, GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLTEXBUMPPARAMETERIVATIPROC) (GLenum pname, const GLint *param); -typedef void (APIENTRYP PFNGLTEXBUMPPARAMETERFVATIPROC) (GLenum pname, const GLfloat *param); -typedef void (APIENTRYP PFNGLGETTEXBUMPPARAMETERIVATIPROC) (GLenum pname, GLint *param); -typedef void (APIENTRYP PFNGLGETTEXBUMPPARAMETERFVATIPROC) (GLenum pname, GLfloat *param); -#endif - -#ifndef GL_ATI_fragment_shader -#define GL_ATI_fragment_shader 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI GLuint APIENTRY glGenFragmentShadersATI (GLuint); -GLAPI void APIENTRY glBindFragmentShaderATI (GLuint); -GLAPI void APIENTRY glDeleteFragmentShaderATI (GLuint); -GLAPI void APIENTRY glBeginFragmentShaderATI (void); -GLAPI void APIENTRY glEndFragmentShaderATI (void); -GLAPI void APIENTRY glPassTexCoordATI (GLuint, GLuint, GLenum); -GLAPI void APIENTRY glSampleMapATI (GLuint, GLuint, GLenum); -GLAPI void APIENTRY glColorFragmentOp1ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint); -GLAPI void APIENTRY glColorFragmentOp2ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint); -GLAPI void APIENTRY glColorFragmentOp3ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint); -GLAPI void APIENTRY glAlphaFragmentOp1ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint); -GLAPI void APIENTRY glAlphaFragmentOp2ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint); -GLAPI void APIENTRY glAlphaFragmentOp3ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint); -GLAPI void APIENTRY glSetFragmentShaderConstantATI (GLuint, const GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef GLuint (APIENTRYP PFNGLGENFRAGMENTSHADERSATIPROC) (GLuint range); -typedef void (APIENTRYP PFNGLBINDFRAGMENTSHADERATIPROC) (GLuint id); -typedef void (APIENTRYP PFNGLDELETEFRAGMENTSHADERATIPROC) (GLuint id); -typedef void (APIENTRYP PFNGLBEGINFRAGMENTSHADERATIPROC) (void); -typedef void (APIENTRYP PFNGLENDFRAGMENTSHADERATIPROC) (void); -typedef void (APIENTRYP PFNGLPASSTEXCOORDATIPROC) (GLuint dst, GLuint coord, GLenum swizzle); -typedef void (APIENTRYP PFNGLSAMPLEMAPATIPROC) (GLuint dst, GLuint interp, GLenum swizzle); -typedef void (APIENTRYP PFNGLCOLORFRAGMENTOP1ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod); -typedef void (APIENTRYP PFNGLCOLORFRAGMENTOP2ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod); -typedef void (APIENTRYP PFNGLCOLORFRAGMENTOP3ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod, GLuint arg3, GLuint arg3Rep, GLuint arg3Mod); -typedef void (APIENTRYP PFNGLALPHAFRAGMENTOP1ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod); -typedef void (APIENTRYP PFNGLALPHAFRAGMENTOP2ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod); -typedef void (APIENTRYP PFNGLALPHAFRAGMENTOP3ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod, GLuint arg3, GLuint arg3Rep, GLuint arg3Mod); -typedef void (APIENTRYP PFNGLSETFRAGMENTSHADERCONSTANTATIPROC) (GLuint dst, const GLfloat *value); -#endif - -#ifndef GL_ATI_pn_triangles -#define GL_ATI_pn_triangles 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glPNTrianglesiATI (GLenum, GLint); -GLAPI void APIENTRY glPNTrianglesfATI (GLenum, GLfloat); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLPNTRIANGLESIATIPROC) (GLenum pname, GLint param); -typedef void (APIENTRYP PFNGLPNTRIANGLESFATIPROC) (GLenum pname, GLfloat param); -#endif - -#ifndef GL_ATI_vertex_array_object -#define GL_ATI_vertex_array_object 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI GLuint APIENTRY glNewObjectBufferATI (GLsizei, const GLvoid *, GLenum); -GLAPI GLboolean APIENTRY glIsObjectBufferATI (GLuint); -GLAPI void APIENTRY glUpdateObjectBufferATI (GLuint, GLuint, GLsizei, const GLvoid *, GLenum); -GLAPI void APIENTRY glGetObjectBufferfvATI (GLuint, GLenum, GLfloat *); -GLAPI void APIENTRY glGetObjectBufferivATI (GLuint, GLenum, GLint *); -GLAPI void APIENTRY glFreeObjectBufferATI (GLuint); -GLAPI void APIENTRY glArrayObjectATI (GLenum, GLint, GLenum, GLsizei, GLuint, GLuint); -GLAPI void APIENTRY glGetArrayObjectfvATI (GLenum, GLenum, GLfloat *); -GLAPI void APIENTRY glGetArrayObjectivATI (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glVariantArrayObjectATI (GLuint, GLenum, GLsizei, GLuint, GLuint); -GLAPI void APIENTRY glGetVariantArrayObjectfvATI (GLuint, GLenum, GLfloat *); -GLAPI void APIENTRY glGetVariantArrayObjectivATI (GLuint, GLenum, GLint *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef GLuint (APIENTRYP PFNGLNEWOBJECTBUFFERATIPROC) (GLsizei size, const GLvoid *pointer, GLenum usage); -typedef GLboolean (APIENTRYP PFNGLISOBJECTBUFFERATIPROC) (GLuint buffer); -typedef void (APIENTRYP PFNGLUPDATEOBJECTBUFFERATIPROC) (GLuint buffer, GLuint offset, GLsizei size, const GLvoid *pointer, GLenum preserve); -typedef void (APIENTRYP PFNGLGETOBJECTBUFFERFVATIPROC) (GLuint buffer, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETOBJECTBUFFERIVATIPROC) (GLuint buffer, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLFREEOBJECTBUFFERATIPROC) (GLuint buffer); -typedef void (APIENTRYP PFNGLARRAYOBJECTATIPROC) (GLenum array, GLint size, GLenum type, GLsizei stride, GLuint buffer, GLuint offset); -typedef void (APIENTRYP PFNGLGETARRAYOBJECTFVATIPROC) (GLenum array, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETARRAYOBJECTIVATIPROC) (GLenum array, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLVARIANTARRAYOBJECTATIPROC) (GLuint id, GLenum type, GLsizei stride, GLuint buffer, GLuint offset); -typedef void (APIENTRYP PFNGLGETVARIANTARRAYOBJECTFVATIPROC) (GLuint id, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETVARIANTARRAYOBJECTIVATIPROC) (GLuint id, GLenum pname, GLint *params); -#endif - -#ifndef GL_EXT_vertex_shader -#define GL_EXT_vertex_shader 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glBeginVertexShaderEXT (void); -GLAPI void APIENTRY glEndVertexShaderEXT (void); -GLAPI void APIENTRY glBindVertexShaderEXT (GLuint); -GLAPI GLuint APIENTRY glGenVertexShadersEXT (GLuint); -GLAPI void APIENTRY glDeleteVertexShaderEXT (GLuint); -GLAPI void APIENTRY glShaderOp1EXT (GLenum, GLuint, GLuint); -GLAPI void APIENTRY glShaderOp2EXT (GLenum, GLuint, GLuint, GLuint); -GLAPI void APIENTRY glShaderOp3EXT (GLenum, GLuint, GLuint, GLuint, GLuint); -GLAPI void APIENTRY glSwizzleEXT (GLuint, GLuint, GLenum, GLenum, GLenum, GLenum); -GLAPI void APIENTRY glWriteMaskEXT (GLuint, GLuint, GLenum, GLenum, GLenum, GLenum); -GLAPI void APIENTRY glInsertComponentEXT (GLuint, GLuint, GLuint); -GLAPI void APIENTRY glExtractComponentEXT (GLuint, GLuint, GLuint); -GLAPI GLuint APIENTRY glGenSymbolsEXT (GLenum, GLenum, GLenum, GLuint); -GLAPI void APIENTRY glSetInvariantEXT (GLuint, GLenum, const GLvoid *); -GLAPI void APIENTRY glSetLocalConstantEXT (GLuint, GLenum, const GLvoid *); -GLAPI void APIENTRY glVariantbvEXT (GLuint, const GLbyte *); -GLAPI void APIENTRY glVariantsvEXT (GLuint, const GLshort *); -GLAPI void APIENTRY glVariantivEXT (GLuint, const GLint *); -GLAPI void APIENTRY glVariantfvEXT (GLuint, const GLfloat *); -GLAPI void APIENTRY glVariantdvEXT (GLuint, const GLdouble *); -GLAPI void APIENTRY glVariantubvEXT (GLuint, const GLubyte *); -GLAPI void APIENTRY glVariantusvEXT (GLuint, const GLushort *); -GLAPI void APIENTRY glVariantuivEXT (GLuint, const GLuint *); -GLAPI void APIENTRY glVariantPointerEXT (GLuint, GLenum, GLuint, const GLvoid *); -GLAPI void APIENTRY glEnableVariantClientStateEXT (GLuint); -GLAPI void APIENTRY glDisableVariantClientStateEXT (GLuint); -GLAPI GLuint APIENTRY glBindLightParameterEXT (GLenum, GLenum); -GLAPI GLuint APIENTRY glBindMaterialParameterEXT (GLenum, GLenum); -GLAPI GLuint APIENTRY glBindTexGenParameterEXT (GLenum, GLenum, GLenum); -GLAPI GLuint APIENTRY glBindTextureUnitParameterEXT (GLenum, GLenum); -GLAPI GLuint APIENTRY glBindParameterEXT (GLenum); -GLAPI GLboolean APIENTRY glIsVariantEnabledEXT (GLuint, GLenum); -GLAPI void APIENTRY glGetVariantBooleanvEXT (GLuint, GLenum, GLboolean *); -GLAPI void APIENTRY glGetVariantIntegervEXT (GLuint, GLenum, GLint *); -GLAPI void APIENTRY glGetVariantFloatvEXT (GLuint, GLenum, GLfloat *); -GLAPI void APIENTRY glGetVariantPointervEXT (GLuint, GLenum, GLvoid* *); -GLAPI void APIENTRY glGetInvariantBooleanvEXT (GLuint, GLenum, GLboolean *); -GLAPI void APIENTRY glGetInvariantIntegervEXT (GLuint, GLenum, GLint *); -GLAPI void APIENTRY glGetInvariantFloatvEXT (GLuint, GLenum, GLfloat *); -GLAPI void APIENTRY glGetLocalConstantBooleanvEXT (GLuint, GLenum, GLboolean *); -GLAPI void APIENTRY glGetLocalConstantIntegervEXT (GLuint, GLenum, GLint *); -GLAPI void APIENTRY glGetLocalConstantFloatvEXT (GLuint, GLenum, GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLBEGINVERTEXSHADEREXTPROC) (void); -typedef void (APIENTRYP PFNGLENDVERTEXSHADEREXTPROC) (void); -typedef void (APIENTRYP PFNGLBINDVERTEXSHADEREXTPROC) (GLuint id); -typedef GLuint (APIENTRYP PFNGLGENVERTEXSHADERSEXTPROC) (GLuint range); -typedef void (APIENTRYP PFNGLDELETEVERTEXSHADEREXTPROC) (GLuint id); -typedef void (APIENTRYP PFNGLSHADEROP1EXTPROC) (GLenum op, GLuint res, GLuint arg1); -typedef void (APIENTRYP PFNGLSHADEROP2EXTPROC) (GLenum op, GLuint res, GLuint arg1, GLuint arg2); -typedef void (APIENTRYP PFNGLSHADEROP3EXTPROC) (GLenum op, GLuint res, GLuint arg1, GLuint arg2, GLuint arg3); -typedef void (APIENTRYP PFNGLSWIZZLEEXTPROC) (GLuint res, GLuint in, GLenum outX, GLenum outY, GLenum outZ, GLenum outW); -typedef void (APIENTRYP PFNGLWRITEMASKEXTPROC) (GLuint res, GLuint in, GLenum outX, GLenum outY, GLenum outZ, GLenum outW); -typedef void (APIENTRYP PFNGLINSERTCOMPONENTEXTPROC) (GLuint res, GLuint src, GLuint num); -typedef void (APIENTRYP PFNGLEXTRACTCOMPONENTEXTPROC) (GLuint res, GLuint src, GLuint num); -typedef GLuint (APIENTRYP PFNGLGENSYMBOLSEXTPROC) (GLenum datatype, GLenum storagetype, GLenum range, GLuint components); -typedef void (APIENTRYP PFNGLSETINVARIANTEXTPROC) (GLuint id, GLenum type, const GLvoid *addr); -typedef void (APIENTRYP PFNGLSETLOCALCONSTANTEXTPROC) (GLuint id, GLenum type, const GLvoid *addr); -typedef void (APIENTRYP PFNGLVARIANTBVEXTPROC) (GLuint id, const GLbyte *addr); -typedef void (APIENTRYP PFNGLVARIANTSVEXTPROC) (GLuint id, const GLshort *addr); -typedef void (APIENTRYP PFNGLVARIANTIVEXTPROC) (GLuint id, const GLint *addr); -typedef void (APIENTRYP PFNGLVARIANTFVEXTPROC) (GLuint id, const GLfloat *addr); -typedef void (APIENTRYP PFNGLVARIANTDVEXTPROC) (GLuint id, const GLdouble *addr); -typedef void (APIENTRYP PFNGLVARIANTUBVEXTPROC) (GLuint id, const GLubyte *addr); -typedef void (APIENTRYP PFNGLVARIANTUSVEXTPROC) (GLuint id, const GLushort *addr); -typedef void (APIENTRYP PFNGLVARIANTUIVEXTPROC) (GLuint id, const GLuint *addr); -typedef void (APIENTRYP PFNGLVARIANTPOINTEREXTPROC) (GLuint id, GLenum type, GLuint stride, const GLvoid *addr); -typedef void (APIENTRYP PFNGLENABLEVARIANTCLIENTSTATEEXTPROC) (GLuint id); -typedef void (APIENTRYP PFNGLDISABLEVARIANTCLIENTSTATEEXTPROC) (GLuint id); -typedef GLuint (APIENTRYP PFNGLBINDLIGHTPARAMETEREXTPROC) (GLenum light, GLenum value); -typedef GLuint (APIENTRYP PFNGLBINDMATERIALPARAMETEREXTPROC) (GLenum face, GLenum value); -typedef GLuint (APIENTRYP PFNGLBINDTEXGENPARAMETEREXTPROC) (GLenum unit, GLenum coord, GLenum value); -typedef GLuint (APIENTRYP PFNGLBINDTEXTUREUNITPARAMETEREXTPROC) (GLenum unit, GLenum value); -typedef GLuint (APIENTRYP PFNGLBINDPARAMETEREXTPROC) (GLenum value); -typedef GLboolean (APIENTRYP PFNGLISVARIANTENABLEDEXTPROC) (GLuint id, GLenum cap); -typedef void (APIENTRYP PFNGLGETVARIANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data); -typedef void (APIENTRYP PFNGLGETVARIANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data); -typedef void (APIENTRYP PFNGLGETVARIANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data); -typedef void (APIENTRYP PFNGLGETVARIANTPOINTERVEXTPROC) (GLuint id, GLenum value, GLvoid* *data); -typedef void (APIENTRYP PFNGLGETINVARIANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data); -typedef void (APIENTRYP PFNGLGETINVARIANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data); -typedef void (APIENTRYP PFNGLGETINVARIANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data); -typedef void (APIENTRYP PFNGLGETLOCALCONSTANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data); -typedef void (APIENTRYP PFNGLGETLOCALCONSTANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data); -typedef void (APIENTRYP PFNGLGETLOCALCONSTANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data); -#endif - -#ifndef GL_ATI_vertex_streams -#define GL_ATI_vertex_streams 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glVertexStream1sATI (GLenum, GLshort); -GLAPI void APIENTRY glVertexStream1svATI (GLenum, const GLshort *); -GLAPI void APIENTRY glVertexStream1iATI (GLenum, GLint); -GLAPI void APIENTRY glVertexStream1ivATI (GLenum, const GLint *); -GLAPI void APIENTRY glVertexStream1fATI (GLenum, GLfloat); -GLAPI void APIENTRY glVertexStream1fvATI (GLenum, const GLfloat *); -GLAPI void APIENTRY glVertexStream1dATI (GLenum, GLdouble); -GLAPI void APIENTRY glVertexStream1dvATI (GLenum, const GLdouble *); -GLAPI void APIENTRY glVertexStream2sATI (GLenum, GLshort, GLshort); -GLAPI void APIENTRY glVertexStream2svATI (GLenum, const GLshort *); -GLAPI void APIENTRY glVertexStream2iATI (GLenum, GLint, GLint); -GLAPI void APIENTRY glVertexStream2ivATI (GLenum, const GLint *); -GLAPI void APIENTRY glVertexStream2fATI (GLenum, GLfloat, GLfloat); -GLAPI void APIENTRY glVertexStream2fvATI (GLenum, const GLfloat *); -GLAPI void APIENTRY glVertexStream2dATI (GLenum, GLdouble, GLdouble); -GLAPI void APIENTRY glVertexStream2dvATI (GLenum, const GLdouble *); -GLAPI void APIENTRY glVertexStream3sATI (GLenum, GLshort, GLshort, GLshort); -GLAPI void APIENTRY glVertexStream3svATI (GLenum, const GLshort *); -GLAPI void APIENTRY glVertexStream3iATI (GLenum, GLint, GLint, GLint); -GLAPI void APIENTRY glVertexStream3ivATI (GLenum, const GLint *); -GLAPI void APIENTRY glVertexStream3fATI (GLenum, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glVertexStream3fvATI (GLenum, const GLfloat *); -GLAPI void APIENTRY glVertexStream3dATI (GLenum, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glVertexStream3dvATI (GLenum, const GLdouble *); -GLAPI void APIENTRY glVertexStream4sATI (GLenum, GLshort, GLshort, GLshort, GLshort); -GLAPI void APIENTRY glVertexStream4svATI (GLenum, const GLshort *); -GLAPI void APIENTRY glVertexStream4iATI (GLenum, GLint, GLint, GLint, GLint); -GLAPI void APIENTRY glVertexStream4ivATI (GLenum, const GLint *); -GLAPI void APIENTRY glVertexStream4fATI (GLenum, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glVertexStream4fvATI (GLenum, const GLfloat *); -GLAPI void APIENTRY glVertexStream4dATI (GLenum, GLdouble, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glVertexStream4dvATI (GLenum, const GLdouble *); -GLAPI void APIENTRY glNormalStream3bATI (GLenum, GLbyte, GLbyte, GLbyte); -GLAPI void APIENTRY glNormalStream3bvATI (GLenum, const GLbyte *); -GLAPI void APIENTRY glNormalStream3sATI (GLenum, GLshort, GLshort, GLshort); -GLAPI void APIENTRY glNormalStream3svATI (GLenum, const GLshort *); -GLAPI void APIENTRY glNormalStream3iATI (GLenum, GLint, GLint, GLint); -GLAPI void APIENTRY glNormalStream3ivATI (GLenum, const GLint *); -GLAPI void APIENTRY glNormalStream3fATI (GLenum, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glNormalStream3fvATI (GLenum, const GLfloat *); -GLAPI void APIENTRY glNormalStream3dATI (GLenum, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glNormalStream3dvATI (GLenum, const GLdouble *); -GLAPI void APIENTRY glClientActiveVertexStreamATI (GLenum); -GLAPI void APIENTRY glVertexBlendEnviATI (GLenum, GLint); -GLAPI void APIENTRY glVertexBlendEnvfATI (GLenum, GLfloat); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLVERTEXSTREAM1SATIPROC) (GLenum stream, GLshort x); -typedef void (APIENTRYP PFNGLVERTEXSTREAM1SVATIPROC) (GLenum stream, const GLshort *coords); -typedef void (APIENTRYP PFNGLVERTEXSTREAM1IATIPROC) (GLenum stream, GLint x); -typedef void (APIENTRYP PFNGLVERTEXSTREAM1IVATIPROC) (GLenum stream, const GLint *coords); -typedef void (APIENTRYP PFNGLVERTEXSTREAM1FATIPROC) (GLenum stream, GLfloat x); -typedef void (APIENTRYP PFNGLVERTEXSTREAM1FVATIPROC) (GLenum stream, const GLfloat *coords); -typedef void (APIENTRYP PFNGLVERTEXSTREAM1DATIPROC) (GLenum stream, GLdouble x); -typedef void (APIENTRYP PFNGLVERTEXSTREAM1DVATIPROC) (GLenum stream, const GLdouble *coords); -typedef void (APIENTRYP PFNGLVERTEXSTREAM2SATIPROC) (GLenum stream, GLshort x, GLshort y); -typedef void (APIENTRYP PFNGLVERTEXSTREAM2SVATIPROC) (GLenum stream, const GLshort *coords); -typedef void (APIENTRYP PFNGLVERTEXSTREAM2IATIPROC) (GLenum stream, GLint x, GLint y); -typedef void (APIENTRYP PFNGLVERTEXSTREAM2IVATIPROC) (GLenum stream, const GLint *coords); -typedef void (APIENTRYP PFNGLVERTEXSTREAM2FATIPROC) (GLenum stream, GLfloat x, GLfloat y); -typedef void (APIENTRYP PFNGLVERTEXSTREAM2FVATIPROC) (GLenum stream, const GLfloat *coords); -typedef void (APIENTRYP PFNGLVERTEXSTREAM2DATIPROC) (GLenum stream, GLdouble x, GLdouble y); -typedef void (APIENTRYP PFNGLVERTEXSTREAM2DVATIPROC) (GLenum stream, const GLdouble *coords); -typedef void (APIENTRYP PFNGLVERTEXSTREAM3SATIPROC) (GLenum stream, GLshort x, GLshort y, GLshort z); -typedef void (APIENTRYP PFNGLVERTEXSTREAM3SVATIPROC) (GLenum stream, const GLshort *coords); -typedef void (APIENTRYP PFNGLVERTEXSTREAM3IATIPROC) (GLenum stream, GLint x, GLint y, GLint z); -typedef void (APIENTRYP PFNGLVERTEXSTREAM3IVATIPROC) (GLenum stream, const GLint *coords); -typedef void (APIENTRYP PFNGLVERTEXSTREAM3FATIPROC) (GLenum stream, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLVERTEXSTREAM3FVATIPROC) (GLenum stream, const GLfloat *coords); -typedef void (APIENTRYP PFNGLVERTEXSTREAM3DATIPROC) (GLenum stream, GLdouble x, GLdouble y, GLdouble z); -typedef void (APIENTRYP PFNGLVERTEXSTREAM3DVATIPROC) (GLenum stream, const GLdouble *coords); -typedef void (APIENTRYP PFNGLVERTEXSTREAM4SATIPROC) (GLenum stream, GLshort x, GLshort y, GLshort z, GLshort w); -typedef void (APIENTRYP PFNGLVERTEXSTREAM4SVATIPROC) (GLenum stream, const GLshort *coords); -typedef void (APIENTRYP PFNGLVERTEXSTREAM4IATIPROC) (GLenum stream, GLint x, GLint y, GLint z, GLint w); -typedef void (APIENTRYP PFNGLVERTEXSTREAM4IVATIPROC) (GLenum stream, const GLint *coords); -typedef void (APIENTRYP PFNGLVERTEXSTREAM4FATIPROC) (GLenum stream, GLfloat x, GLfloat y, GLfloat z, GLfloat w); -typedef void (APIENTRYP PFNGLVERTEXSTREAM4FVATIPROC) (GLenum stream, const GLfloat *coords); -typedef void (APIENTRYP PFNGLVERTEXSTREAM4DATIPROC) (GLenum stream, GLdouble x, GLdouble y, GLdouble z, GLdouble w); -typedef void (APIENTRYP PFNGLVERTEXSTREAM4DVATIPROC) (GLenum stream, const GLdouble *coords); -typedef void (APIENTRYP PFNGLNORMALSTREAM3BATIPROC) (GLenum stream, GLbyte nx, GLbyte ny, GLbyte nz); -typedef void (APIENTRYP PFNGLNORMALSTREAM3BVATIPROC) (GLenum stream, const GLbyte *coords); -typedef void (APIENTRYP PFNGLNORMALSTREAM3SATIPROC) (GLenum stream, GLshort nx, GLshort ny, GLshort nz); -typedef void (APIENTRYP PFNGLNORMALSTREAM3SVATIPROC) (GLenum stream, const GLshort *coords); -typedef void (APIENTRYP PFNGLNORMALSTREAM3IATIPROC) (GLenum stream, GLint nx, GLint ny, GLint nz); -typedef void (APIENTRYP PFNGLNORMALSTREAM3IVATIPROC) (GLenum stream, const GLint *coords); -typedef void (APIENTRYP PFNGLNORMALSTREAM3FATIPROC) (GLenum stream, GLfloat nx, GLfloat ny, GLfloat nz); -typedef void (APIENTRYP PFNGLNORMALSTREAM3FVATIPROC) (GLenum stream, const GLfloat *coords); -typedef void (APIENTRYP PFNGLNORMALSTREAM3DATIPROC) (GLenum stream, GLdouble nx, GLdouble ny, GLdouble nz); -typedef void (APIENTRYP PFNGLNORMALSTREAM3DVATIPROC) (GLenum stream, const GLdouble *coords); -typedef void (APIENTRYP PFNGLCLIENTACTIVEVERTEXSTREAMATIPROC) (GLenum stream); -typedef void (APIENTRYP PFNGLVERTEXBLENDENVIATIPROC) (GLenum pname, GLint param); -typedef void (APIENTRYP PFNGLVERTEXBLENDENVFATIPROC) (GLenum pname, GLfloat param); -#endif - -#ifndef GL_ATI_element_array -#define GL_ATI_element_array 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glElementPointerATI (GLenum, const GLvoid *); -GLAPI void APIENTRY glDrawElementArrayATI (GLenum, GLsizei); -GLAPI void APIENTRY glDrawRangeElementArrayATI (GLenum, GLuint, GLuint, GLsizei); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLELEMENTPOINTERATIPROC) (GLenum type, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLDRAWELEMENTARRAYATIPROC) (GLenum mode, GLsizei count); -typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTARRAYATIPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count); -#endif - -#ifndef GL_SUN_mesh_array -#define GL_SUN_mesh_array 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glDrawMeshArraysSUN (GLenum, GLint, GLsizei, GLsizei); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLDRAWMESHARRAYSSUNPROC) (GLenum mode, GLint first, GLsizei count, GLsizei width); -#endif - -#ifndef GL_SUN_slice_accum -#define GL_SUN_slice_accum 1 -#endif - -#ifndef GL_NV_multisample_filter_hint -#define GL_NV_multisample_filter_hint 1 -#endif - -#ifndef GL_NV_depth_clamp -#define GL_NV_depth_clamp 1 -#endif - -#ifndef GL_NV_occlusion_query -#define GL_NV_occlusion_query 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glGenOcclusionQueriesNV (GLsizei, GLuint *); -GLAPI void APIENTRY glDeleteOcclusionQueriesNV (GLsizei, const GLuint *); -GLAPI GLboolean APIENTRY glIsOcclusionQueryNV (GLuint); -GLAPI void APIENTRY glBeginOcclusionQueryNV (GLuint); -GLAPI void APIENTRY glEndOcclusionQueryNV (void); -GLAPI void APIENTRY glGetOcclusionQueryivNV (GLuint, GLenum, GLint *); -GLAPI void APIENTRY glGetOcclusionQueryuivNV (GLuint, GLenum, GLuint *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLGENOCCLUSIONQUERIESNVPROC) (GLsizei n, GLuint *ids); -typedef void (APIENTRYP PFNGLDELETEOCCLUSIONQUERIESNVPROC) (GLsizei n, const GLuint *ids); -typedef GLboolean (APIENTRYP PFNGLISOCCLUSIONQUERYNVPROC) (GLuint id); -typedef void (APIENTRYP PFNGLBEGINOCCLUSIONQUERYNVPROC) (GLuint id); -typedef void (APIENTRYP PFNGLENDOCCLUSIONQUERYNVPROC) (void); -typedef void (APIENTRYP PFNGLGETOCCLUSIONQUERYIVNVPROC) (GLuint id, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETOCCLUSIONQUERYUIVNVPROC) (GLuint id, GLenum pname, GLuint *params); -#endif - -#ifndef GL_NV_point_sprite -#define GL_NV_point_sprite 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glPointParameteriNV (GLenum, GLint); -GLAPI void APIENTRY glPointParameterivNV (GLenum, const GLint *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLPOINTPARAMETERINVPROC) (GLenum pname, GLint param); -typedef void (APIENTRYP PFNGLPOINTPARAMETERIVNVPROC) (GLenum pname, const GLint *params); -#endif - -#ifndef GL_NV_texture_shader3 -#define GL_NV_texture_shader3 1 -#endif - -#ifndef GL_NV_vertex_program1_1 -#define GL_NV_vertex_program1_1 1 -#endif - -#ifndef GL_EXT_shadow_funcs -#define GL_EXT_shadow_funcs 1 -#endif - -#ifndef GL_EXT_stencil_two_side -#define GL_EXT_stencil_two_side 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glActiveStencilFaceEXT (GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLACTIVESTENCILFACEEXTPROC) (GLenum face); -#endif - -#ifndef GL_ATI_text_fragment_shader -#define GL_ATI_text_fragment_shader 1 -#endif - -#ifndef GL_APPLE_client_storage -#define GL_APPLE_client_storage 1 -#endif - -#ifndef GL_APPLE_element_array -#define GL_APPLE_element_array 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glElementPointerAPPLE (GLenum, const GLvoid *); -GLAPI void APIENTRY glDrawElementArrayAPPLE (GLenum, GLint, GLsizei); -GLAPI void APIENTRY glDrawRangeElementArrayAPPLE (GLenum, GLuint, GLuint, GLint, GLsizei); -GLAPI void APIENTRY glMultiDrawElementArrayAPPLE (GLenum, const GLint *, const GLsizei *, GLsizei); -GLAPI void APIENTRY glMultiDrawRangeElementArrayAPPLE (GLenum, GLuint, GLuint, const GLint *, const GLsizei *, GLsizei); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLELEMENTPOINTERAPPLEPROC) (GLenum type, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLDRAWELEMENTARRAYAPPLEPROC) (GLenum mode, GLint first, GLsizei count); -typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTARRAYAPPLEPROC) (GLenum mode, GLuint start, GLuint end, GLint first, GLsizei count); -typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTARRAYAPPLEPROC) (GLenum mode, const GLint *first, const GLsizei *count, GLsizei primcount); -typedef void (APIENTRYP PFNGLMULTIDRAWRANGEELEMENTARRAYAPPLEPROC) (GLenum mode, GLuint start, GLuint end, const GLint *first, const GLsizei *count, GLsizei primcount); -#endif - -#ifndef GL_APPLE_fence -#define GL_APPLE_fence 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glGenFencesAPPLE (GLsizei, GLuint *); -GLAPI void APIENTRY glDeleteFencesAPPLE (GLsizei, const GLuint *); -GLAPI void APIENTRY glSetFenceAPPLE (GLuint); -GLAPI GLboolean APIENTRY glIsFenceAPPLE (GLuint); -GLAPI GLboolean APIENTRY glTestFenceAPPLE (GLuint); -GLAPI void APIENTRY glFinishFenceAPPLE (GLuint); -GLAPI GLboolean APIENTRY glTestObjectAPPLE (GLenum, GLuint); -GLAPI void APIENTRY glFinishObjectAPPLE (GLenum, GLint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLGENFENCESAPPLEPROC) (GLsizei n, GLuint *fences); -typedef void (APIENTRYP PFNGLDELETEFENCESAPPLEPROC) (GLsizei n, const GLuint *fences); -typedef void (APIENTRYP PFNGLSETFENCEAPPLEPROC) (GLuint fence); -typedef GLboolean (APIENTRYP PFNGLISFENCEAPPLEPROC) (GLuint fence); -typedef GLboolean (APIENTRYP PFNGLTESTFENCEAPPLEPROC) (GLuint fence); -typedef void (APIENTRYP PFNGLFINISHFENCEAPPLEPROC) (GLuint fence); -typedef GLboolean (APIENTRYP PFNGLTESTOBJECTAPPLEPROC) (GLenum object, GLuint name); -typedef void (APIENTRYP PFNGLFINISHOBJECTAPPLEPROC) (GLenum object, GLint name); -#endif - -#ifndef GL_APPLE_vertex_array_object -#define GL_APPLE_vertex_array_object 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glBindVertexArrayAPPLE (GLuint); -GLAPI void APIENTRY glDeleteVertexArraysAPPLE (GLsizei, const GLuint *); -GLAPI void APIENTRY glGenVertexArraysAPPLE (GLsizei, GLuint *); -GLAPI GLboolean APIENTRY glIsVertexArrayAPPLE (GLuint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLBINDVERTEXARRAYAPPLEPROC) (GLuint array); -typedef void (APIENTRYP PFNGLDELETEVERTEXARRAYSAPPLEPROC) (GLsizei n, const GLuint *arrays); -typedef void (APIENTRYP PFNGLGENVERTEXARRAYSAPPLEPROC) (GLsizei n, GLuint *arrays); -typedef GLboolean (APIENTRYP PFNGLISVERTEXARRAYAPPLEPROC) (GLuint array); -#endif - -#ifndef GL_APPLE_vertex_array_range -#define GL_APPLE_vertex_array_range 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glVertexArrayRangeAPPLE (GLsizei, GLvoid *); -GLAPI void APIENTRY glFlushVertexArrayRangeAPPLE (GLsizei, GLvoid *); -GLAPI void APIENTRY glVertexArrayParameteriAPPLE (GLenum, GLint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, GLvoid *pointer); -typedef void (APIENTRYP PFNGLFLUSHVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, GLvoid *pointer); -typedef void (APIENTRYP PFNGLVERTEXARRAYPARAMETERIAPPLEPROC) (GLenum pname, GLint param); -#endif - -#ifndef GL_APPLE_ycbcr_422 -#define GL_APPLE_ycbcr_422 1 -#endif - -#ifndef GL_S3_s3tc -#define GL_S3_s3tc 1 -#endif - -#ifndef GL_ATI_draw_buffers -#define GL_ATI_draw_buffers 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glDrawBuffersATI (GLsizei, const GLenum *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLDRAWBUFFERSATIPROC) (GLsizei n, const GLenum *bufs); -#endif - -#ifndef GL_ATI_pixel_format_float -#define GL_ATI_pixel_format_float 1 -/* This is really a WGL extension, but defines some associated GL enums. - * ATI does not export "GL_ATI_pixel_format_float" in the GL_EXTENSIONS string. - */ -#endif - -#ifndef GL_ATI_texture_env_combine3 -#define GL_ATI_texture_env_combine3 1 -#endif - -#ifndef GL_ATI_texture_float -#define GL_ATI_texture_float 1 -#endif - -#ifndef GL_NV_float_buffer -#define GL_NV_float_buffer 1 -#endif - -#ifndef GL_NV_fragment_program -#define GL_NV_fragment_program 1 -/* Some NV_fragment_program entry points are shared with ARB_vertex_program. */ -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glProgramNamedParameter4fNV (GLuint, GLsizei, const GLubyte *, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glProgramNamedParameter4dNV (GLuint, GLsizei, const GLubyte *, GLdouble, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glProgramNamedParameter4fvNV (GLuint, GLsizei, const GLubyte *, const GLfloat *); -GLAPI void APIENTRY glProgramNamedParameter4dvNV (GLuint, GLsizei, const GLubyte *, const GLdouble *); -GLAPI void APIENTRY glGetProgramNamedParameterfvNV (GLuint, GLsizei, const GLubyte *, GLfloat *); -GLAPI void APIENTRY glGetProgramNamedParameterdvNV (GLuint, GLsizei, const GLubyte *, GLdouble *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4FNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLfloat x, GLfloat y, GLfloat z, GLfloat w); -typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4DNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLdouble x, GLdouble y, GLdouble z, GLdouble w); -typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4FVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, const GLfloat *v); -typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4DVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, const GLdouble *v); -typedef void (APIENTRYP PFNGLGETPROGRAMNAMEDPARAMETERFVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLfloat *params); -typedef void (APIENTRYP PFNGLGETPROGRAMNAMEDPARAMETERDVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLdouble *params); -#endif - -#ifndef GL_NV_half_float -#define GL_NV_half_float 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glVertex2hNV (GLhalfNV, GLhalfNV); -GLAPI void APIENTRY glVertex2hvNV (const GLhalfNV *); -GLAPI void APIENTRY glVertex3hNV (GLhalfNV, GLhalfNV, GLhalfNV); -GLAPI void APIENTRY glVertex3hvNV (const GLhalfNV *); -GLAPI void APIENTRY glVertex4hNV (GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV); -GLAPI void APIENTRY glVertex4hvNV (const GLhalfNV *); -GLAPI void APIENTRY glNormal3hNV (GLhalfNV, GLhalfNV, GLhalfNV); -GLAPI void APIENTRY glNormal3hvNV (const GLhalfNV *); -GLAPI void APIENTRY glColor3hNV (GLhalfNV, GLhalfNV, GLhalfNV); -GLAPI void APIENTRY glColor3hvNV (const GLhalfNV *); -GLAPI void APIENTRY glColor4hNV (GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV); -GLAPI void APIENTRY glColor4hvNV (const GLhalfNV *); -GLAPI void APIENTRY glTexCoord1hNV (GLhalfNV); -GLAPI void APIENTRY glTexCoord1hvNV (const GLhalfNV *); -GLAPI void APIENTRY glTexCoord2hNV (GLhalfNV, GLhalfNV); -GLAPI void APIENTRY glTexCoord2hvNV (const GLhalfNV *); -GLAPI void APIENTRY glTexCoord3hNV (GLhalfNV, GLhalfNV, GLhalfNV); -GLAPI void APIENTRY glTexCoord3hvNV (const GLhalfNV *); -GLAPI void APIENTRY glTexCoord4hNV (GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV); -GLAPI void APIENTRY glTexCoord4hvNV (const GLhalfNV *); -GLAPI void APIENTRY glMultiTexCoord1hNV (GLenum, GLhalfNV); -GLAPI void APIENTRY glMultiTexCoord1hvNV (GLenum, const GLhalfNV *); -GLAPI void APIENTRY glMultiTexCoord2hNV (GLenum, GLhalfNV, GLhalfNV); -GLAPI void APIENTRY glMultiTexCoord2hvNV (GLenum, const GLhalfNV *); -GLAPI void APIENTRY glMultiTexCoord3hNV (GLenum, GLhalfNV, GLhalfNV, GLhalfNV); -GLAPI void APIENTRY glMultiTexCoord3hvNV (GLenum, const GLhalfNV *); -GLAPI void APIENTRY glMultiTexCoord4hNV (GLenum, GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV); -GLAPI void APIENTRY glMultiTexCoord4hvNV (GLenum, const GLhalfNV *); -GLAPI void APIENTRY glFogCoordhNV (GLhalfNV); -GLAPI void APIENTRY glFogCoordhvNV (const GLhalfNV *); -GLAPI void APIENTRY glSecondaryColor3hNV (GLhalfNV, GLhalfNV, GLhalfNV); -GLAPI void APIENTRY glSecondaryColor3hvNV (const GLhalfNV *); -GLAPI void APIENTRY glVertexWeighthNV (GLhalfNV); -GLAPI void APIENTRY glVertexWeighthvNV (const GLhalfNV *); -GLAPI void APIENTRY glVertexAttrib1hNV (GLuint, GLhalfNV); -GLAPI void APIENTRY glVertexAttrib1hvNV (GLuint, const GLhalfNV *); -GLAPI void APIENTRY glVertexAttrib2hNV (GLuint, GLhalfNV, GLhalfNV); -GLAPI void APIENTRY glVertexAttrib2hvNV (GLuint, const GLhalfNV *); -GLAPI void APIENTRY glVertexAttrib3hNV (GLuint, GLhalfNV, GLhalfNV, GLhalfNV); -GLAPI void APIENTRY glVertexAttrib3hvNV (GLuint, const GLhalfNV *); -GLAPI void APIENTRY glVertexAttrib4hNV (GLuint, GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV); -GLAPI void APIENTRY glVertexAttrib4hvNV (GLuint, const GLhalfNV *); -GLAPI void APIENTRY glVertexAttribs1hvNV (GLuint, GLsizei, const GLhalfNV *); -GLAPI void APIENTRY glVertexAttribs2hvNV (GLuint, GLsizei, const GLhalfNV *); -GLAPI void APIENTRY glVertexAttribs3hvNV (GLuint, GLsizei, const GLhalfNV *); -GLAPI void APIENTRY glVertexAttribs4hvNV (GLuint, GLsizei, const GLhalfNV *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLVERTEX2HNVPROC) (GLhalfNV x, GLhalfNV y); -typedef void (APIENTRYP PFNGLVERTEX2HVNVPROC) (const GLhalfNV *v); -typedef void (APIENTRYP PFNGLVERTEX3HNVPROC) (GLhalfNV x, GLhalfNV y, GLhalfNV z); -typedef void (APIENTRYP PFNGLVERTEX3HVNVPROC) (const GLhalfNV *v); -typedef void (APIENTRYP PFNGLVERTEX4HNVPROC) (GLhalfNV x, GLhalfNV y, GLhalfNV z, GLhalfNV w); -typedef void (APIENTRYP PFNGLVERTEX4HVNVPROC) (const GLhalfNV *v); -typedef void (APIENTRYP PFNGLNORMAL3HNVPROC) (GLhalfNV nx, GLhalfNV ny, GLhalfNV nz); -typedef void (APIENTRYP PFNGLNORMAL3HVNVPROC) (const GLhalfNV *v); -typedef void (APIENTRYP PFNGLCOLOR3HNVPROC) (GLhalfNV red, GLhalfNV green, GLhalfNV blue); -typedef void (APIENTRYP PFNGLCOLOR3HVNVPROC) (const GLhalfNV *v); -typedef void (APIENTRYP PFNGLCOLOR4HNVPROC) (GLhalfNV red, GLhalfNV green, GLhalfNV blue, GLhalfNV alpha); -typedef void (APIENTRYP PFNGLCOLOR4HVNVPROC) (const GLhalfNV *v); -typedef void (APIENTRYP PFNGLTEXCOORD1HNVPROC) (GLhalfNV s); -typedef void (APIENTRYP PFNGLTEXCOORD1HVNVPROC) (const GLhalfNV *v); -typedef void (APIENTRYP PFNGLTEXCOORD2HNVPROC) (GLhalfNV s, GLhalfNV t); -typedef void (APIENTRYP PFNGLTEXCOORD2HVNVPROC) (const GLhalfNV *v); -typedef void (APIENTRYP PFNGLTEXCOORD3HNVPROC) (GLhalfNV s, GLhalfNV t, GLhalfNV r); -typedef void (APIENTRYP PFNGLTEXCOORD3HVNVPROC) (const GLhalfNV *v); -typedef void (APIENTRYP PFNGLTEXCOORD4HNVPROC) (GLhalfNV s, GLhalfNV t, GLhalfNV r, GLhalfNV q); -typedef void (APIENTRYP PFNGLTEXCOORD4HVNVPROC) (const GLhalfNV *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1HNVPROC) (GLenum target, GLhalfNV s); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1HVNVPROC) (GLenum target, const GLhalfNV *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2HNVPROC) (GLenum target, GLhalfNV s, GLhalfNV t); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2HVNVPROC) (GLenum target, const GLhalfNV *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3HNVPROC) (GLenum target, GLhalfNV s, GLhalfNV t, GLhalfNV r); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3HVNVPROC) (GLenum target, const GLhalfNV *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4HNVPROC) (GLenum target, GLhalfNV s, GLhalfNV t, GLhalfNV r, GLhalfNV q); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4HVNVPROC) (GLenum target, const GLhalfNV *v); -typedef void (APIENTRYP PFNGLFOGCOORDHNVPROC) (GLhalfNV fog); -typedef void (APIENTRYP PFNGLFOGCOORDHVNVPROC) (const GLhalfNV *fog); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3HNVPROC) (GLhalfNV red, GLhalfNV green, GLhalfNV blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3HVNVPROC) (const GLhalfNV *v); -typedef void (APIENTRYP PFNGLVERTEXWEIGHTHNVPROC) (GLhalfNV weight); -typedef void (APIENTRYP PFNGLVERTEXWEIGHTHVNVPROC) (const GLhalfNV *weight); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1HNVPROC) (GLuint index, GLhalfNV x); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1HVNVPROC) (GLuint index, const GLhalfNV *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2HNVPROC) (GLuint index, GLhalfNV x, GLhalfNV y); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2HVNVPROC) (GLuint index, const GLhalfNV *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3HNVPROC) (GLuint index, GLhalfNV x, GLhalfNV y, GLhalfNV z); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3HVNVPROC) (GLuint index, const GLhalfNV *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4HNVPROC) (GLuint index, GLhalfNV x, GLhalfNV y, GLhalfNV z, GLhalfNV w); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4HVNVPROC) (GLuint index, const GLhalfNV *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS1HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS2HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS3HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS4HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v); -#endif - -#ifndef GL_NV_pixel_data_range -#define GL_NV_pixel_data_range 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glPixelDataRangeNV (GLenum, GLsizei, GLvoid *); -GLAPI void APIENTRY glFlushPixelDataRangeNV (GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLPIXELDATARANGENVPROC) (GLenum target, GLsizei length, GLvoid *pointer); -typedef void (APIENTRYP PFNGLFLUSHPIXELDATARANGENVPROC) (GLenum target); -#endif - -#ifndef GL_NV_primitive_restart -#define GL_NV_primitive_restart 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glPrimitiveRestartNV (void); -GLAPI void APIENTRY glPrimitiveRestartIndexNV (GLuint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLPRIMITIVERESTARTNVPROC) (void); -typedef void (APIENTRYP PFNGLPRIMITIVERESTARTINDEXNVPROC) (GLuint index); -#endif - -#ifndef GL_NV_texture_expand_normal -#define GL_NV_texture_expand_normal 1 -#endif - -#ifndef GL_NV_vertex_program2 -#define GL_NV_vertex_program2 1 -#endif - -#ifndef GL_ATI_map_object_buffer -#define GL_ATI_map_object_buffer 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI GLvoid* APIENTRY glMapObjectBufferATI (GLuint); -GLAPI void APIENTRY glUnmapObjectBufferATI (GLuint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef GLvoid* (APIENTRYP PFNGLMAPOBJECTBUFFERATIPROC) (GLuint buffer); -typedef void (APIENTRYP PFNGLUNMAPOBJECTBUFFERATIPROC) (GLuint buffer); -#endif - -#ifndef GL_ATI_separate_stencil -#define GL_ATI_separate_stencil 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glStencilOpSeparateATI (GLenum, GLenum, GLenum, GLenum); -GLAPI void APIENTRY glStencilFuncSeparateATI (GLenum, GLenum, GLint, GLuint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLSTENCILOPSEPARATEATIPROC) (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass); -typedef void (APIENTRYP PFNGLSTENCILFUNCSEPARATEATIPROC) (GLenum frontfunc, GLenum backfunc, GLint ref, GLuint mask); -#endif - -#ifndef GL_ATI_vertex_attrib_array_object -#define GL_ATI_vertex_attrib_array_object 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glVertexAttribArrayObjectATI (GLuint, GLint, GLenum, GLboolean, GLsizei, GLuint, GLuint); -GLAPI void APIENTRY glGetVertexAttribArrayObjectfvATI (GLuint, GLenum, GLfloat *); -GLAPI void APIENTRY glGetVertexAttribArrayObjectivATI (GLuint, GLenum, GLint *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLVERTEXATTRIBARRAYOBJECTATIPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, GLuint buffer, GLuint offset); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBARRAYOBJECTFVATIPROC) (GLuint index, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBARRAYOBJECTIVATIPROC) (GLuint index, GLenum pname, GLint *params); -#endif - -#ifndef GL_OES_read_format -#define GL_OES_read_format 1 -#endif - -#ifndef GL_EXT_depth_bounds_test -#define GL_EXT_depth_bounds_test 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glDepthBoundsEXT (GLclampd, GLclampd); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLDEPTHBOUNDSEXTPROC) (GLclampd zmin, GLclampd zmax); -#endif - -#ifndef GL_EXT_texture_mirror_clamp -#define GL_EXT_texture_mirror_clamp 1 -#endif - -#ifndef GL_EXT_blend_equation_separate -#define GL_EXT_blend_equation_separate 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glBlendEquationSeparateEXT (GLenum, GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLBLENDEQUATIONSEPARATEEXTPROC) (GLenum modeRGB, GLenum modeAlpha); -#endif - -#ifndef GL_MESA_pack_invert -#define GL_MESA_pack_invert 1 -#endif - -#ifndef GL_MESA_ycbcr_texture -#define GL_MESA_ycbcr_texture 1 -#endif - -#ifndef GL_EXT_pixel_buffer_object -#define GL_EXT_pixel_buffer_object 1 -#endif - -#ifndef GL_NV_fragment_program_option -#define GL_NV_fragment_program_option 1 -#endif - -#ifndef GL_NV_fragment_program2 -#define GL_NV_fragment_program2 1 -#endif - -#ifndef GL_NV_vertex_program2_option -#define GL_NV_vertex_program2_option 1 -#endif - -#ifndef GL_NV_vertex_program3 -#define GL_NV_vertex_program3 1 -#endif - -#ifndef GL_EXT_framebuffer_object -#define GL_EXT_framebuffer_object 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI GLboolean APIENTRY glIsRenderbufferEXT (GLuint); -GLAPI void APIENTRY glBindRenderbufferEXT (GLenum, GLuint); -GLAPI void APIENTRY glDeleteRenderbuffersEXT (GLsizei, const GLuint *); -GLAPI void APIENTRY glGenRenderbuffersEXT (GLsizei, GLuint *); -GLAPI void APIENTRY glRenderbufferStorageEXT (GLenum, GLenum, GLsizei, GLsizei); -GLAPI void APIENTRY glGetRenderbufferParameterivEXT (GLenum, GLenum, GLint *); -GLAPI GLboolean APIENTRY glIsFramebufferEXT (GLuint); -GLAPI void APIENTRY glBindFramebufferEXT (GLenum, GLuint); -GLAPI void APIENTRY glDeleteFramebuffersEXT (GLsizei, const GLuint *); -GLAPI void APIENTRY glGenFramebuffersEXT (GLsizei, GLuint *); -GLAPI GLenum APIENTRY glCheckFramebufferStatusEXT (GLenum); -GLAPI void APIENTRY glFramebufferTexture1DEXT (GLenum, GLenum, GLenum, GLuint, GLint); -GLAPI void APIENTRY glFramebufferTexture2DEXT (GLenum, GLenum, GLenum, GLuint, GLint); -GLAPI void APIENTRY glFramebufferTexture3DEXT (GLenum, GLenum, GLenum, GLuint, GLint, GLint); -GLAPI void APIENTRY glFramebufferRenderbufferEXT (GLenum, GLenum, GLenum, GLuint); -GLAPI void APIENTRY glGetFramebufferAttachmentParameterivEXT (GLenum, GLenum, GLenum, GLint *); -GLAPI void APIENTRY glGenerateMipmapEXT (GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef GLboolean (APIENTRYP PFNGLISRENDERBUFFEREXTPROC) (GLuint renderbuffer); -typedef void (APIENTRYP PFNGLBINDRENDERBUFFEREXTPROC) (GLenum target, GLuint renderbuffer); -typedef void (APIENTRYP PFNGLDELETERENDERBUFFERSEXTPROC) (GLsizei n, const GLuint *renderbuffers); -typedef void (APIENTRYP PFNGLGENRENDERBUFFERSEXTPROC) (GLsizei n, GLuint *renderbuffers); -typedef void (APIENTRYP PFNGLRENDERBUFFERSTORAGEEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height); -typedef void (APIENTRYP PFNGLGETRENDERBUFFERPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); -typedef GLboolean (APIENTRYP PFNGLISFRAMEBUFFEREXTPROC) (GLuint framebuffer); -typedef void (APIENTRYP PFNGLBINDFRAMEBUFFEREXTPROC) (GLenum target, GLuint framebuffer); -typedef void (APIENTRYP PFNGLDELETEFRAMEBUFFERSEXTPROC) (GLsizei n, const GLuint *framebuffers); -typedef void (APIENTRYP PFNGLGENFRAMEBUFFERSEXTPROC) (GLsizei n, GLuint *framebuffers); -typedef GLenum (APIENTRYP PFNGLCHECKFRAMEBUFFERSTATUSEXTPROC) (GLenum target); -typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE1DEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level); -typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE2DEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level); -typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE3DEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint zoffset); -typedef void (APIENTRYP PFNGLFRAMEBUFFERRENDERBUFFEREXTPROC) (GLenum target, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer); -typedef void (APIENTRYP PFNGLGETFRAMEBUFFERATTACHMENTPARAMETERIVEXTPROC) (GLenum target, GLenum attachment, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGENERATEMIPMAPEXTPROC) (GLenum target); -#endif - -#ifndef GL_GREMEDY_string_marker -#define GL_GREMEDY_string_marker 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glStringMarkerGREMEDY (GLsizei, const GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLSTRINGMARKERGREMEDYPROC) (GLsizei len, const GLvoid *string); -#endif - -#ifndef GL_EXT_packed_depth_stencil -#define GL_EXT_packed_depth_stencil 1 -#endif - -#ifndef GL_EXT_stencil_clear_tag -#define GL_EXT_stencil_clear_tag 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glStencilClearTagEXT (GLsizei, GLuint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLSTENCILCLEARTAGEXTPROC) (GLsizei stencilTagBits, GLuint stencilClearTag); -#endif - -#ifndef GL_EXT_texture_sRGB -#define GL_EXT_texture_sRGB 1 -#endif - -#ifndef GL_EXT_framebuffer_blit -#define GL_EXT_framebuffer_blit 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glBlitFramebufferEXT (GLint, GLint, GLint, GLint, GLint, GLint, GLint, GLint, GLbitfield, GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLBLITFRAMEBUFFEREXTPROC) (GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); -#endif - -#ifndef GL_EXT_framebuffer_multisample -#define GL_EXT_framebuffer_multisample 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glRenderbufferStorageMultisampleEXT (GLenum, GLsizei, GLenum, GLsizei, GLsizei); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLRENDERBUFFERSTORAGEMULTISAMPLEEXTPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); -#endif - -#ifndef GL_MESAX_texture_stack -#define GL_MESAX_texture_stack 1 -#endif - -#ifndef GL_EXT_timer_query -#define GL_EXT_timer_query 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glGetQueryObjecti64vEXT (GLuint, GLenum, GLint64EXT *); -GLAPI void APIENTRY glGetQueryObjectui64vEXT (GLuint, GLenum, GLuint64EXT *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLGETQUERYOBJECTI64VEXTPROC) (GLuint id, GLenum pname, GLint64EXT *params); -typedef void (APIENTRYP PFNGLGETQUERYOBJECTUI64VEXTPROC) (GLuint id, GLenum pname, GLuint64EXT *params); -#endif - -#ifndef GL_EXT_gpu_program_parameters -#define GL_EXT_gpu_program_parameters 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glProgramEnvParameters4fvEXT (GLenum, GLuint, GLsizei, const GLfloat *); -GLAPI void APIENTRY glProgramLocalParameters4fvEXT (GLenum, GLuint, GLsizei, const GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETERS4FVEXTPROC) (GLenum target, GLuint index, GLsizei count, const GLfloat *params); -typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETERS4FVEXTPROC) (GLenum target, GLuint index, GLsizei count, const GLfloat *params); -#endif - -#ifndef GL_APPLE_flush_buffer_range -#define GL_APPLE_flush_buffer_range 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glBufferParameteriAPPLE (GLenum, GLenum, GLint); -GLAPI void APIENTRY glFlushMappedBufferRangeAPPLE (GLenum, GLintptr, GLsizeiptr); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLBUFFERPARAMETERIAPPLEPROC) (GLenum target, GLenum pname, GLint param); -typedef void (APIENTRYP PFNGLFLUSHMAPPEDBUFFERRANGEAPPLEPROC) (GLenum target, GLintptr offset, GLsizeiptr size); -#endif - -#ifndef GL_NV_gpu_program4 -#define GL_NV_gpu_program4 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glProgramLocalParameterI4iNV (GLenum, GLuint, GLint, GLint, GLint, GLint); -GLAPI void APIENTRY glProgramLocalParameterI4ivNV (GLenum, GLuint, const GLint *); -GLAPI void APIENTRY glProgramLocalParametersI4ivNV (GLenum, GLuint, GLsizei, const GLint *); -GLAPI void APIENTRY glProgramLocalParameterI4uiNV (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint); -GLAPI void APIENTRY glProgramLocalParameterI4uivNV (GLenum, GLuint, const GLuint *); -GLAPI void APIENTRY glProgramLocalParametersI4uivNV (GLenum, GLuint, GLsizei, const GLuint *); -GLAPI void APIENTRY glProgramEnvParameterI4iNV (GLenum, GLuint, GLint, GLint, GLint, GLint); -GLAPI void APIENTRY glProgramEnvParameterI4ivNV (GLenum, GLuint, const GLint *); -GLAPI void APIENTRY glProgramEnvParametersI4ivNV (GLenum, GLuint, GLsizei, const GLint *); -GLAPI void APIENTRY glProgramEnvParameterI4uiNV (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint); -GLAPI void APIENTRY glProgramEnvParameterI4uivNV (GLenum, GLuint, const GLuint *); -GLAPI void APIENTRY glProgramEnvParametersI4uivNV (GLenum, GLuint, GLsizei, const GLuint *); -GLAPI void APIENTRY glGetProgramLocalParameterIivNV (GLenum, GLuint, GLint *); -GLAPI void APIENTRY glGetProgramLocalParameterIuivNV (GLenum, GLuint, GLuint *); -GLAPI void APIENTRY glGetProgramEnvParameterIivNV (GLenum, GLuint, GLint *); -GLAPI void APIENTRY glGetProgramEnvParameterIuivNV (GLenum, GLuint, GLuint *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETERI4INVPROC) (GLenum target, GLuint index, GLint x, GLint y, GLint z, GLint w); -typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETERI4IVNVPROC) (GLenum target, GLuint index, const GLint *params); -typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETERSI4IVNVPROC) (GLenum target, GLuint index, GLsizei count, const GLint *params); -typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETERI4UINVPROC) (GLenum target, GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); -typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETERI4UIVNVPROC) (GLenum target, GLuint index, const GLuint *params); -typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETERSI4UIVNVPROC) (GLenum target, GLuint index, GLsizei count, const GLuint *params); -typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETERI4INVPROC) (GLenum target, GLuint index, GLint x, GLint y, GLint z, GLint w); -typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETERI4IVNVPROC) (GLenum target, GLuint index, const GLint *params); -typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETERSI4IVNVPROC) (GLenum target, GLuint index, GLsizei count, const GLint *params); -typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETERI4UINVPROC) (GLenum target, GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); -typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETERI4UIVNVPROC) (GLenum target, GLuint index, const GLuint *params); -typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETERSI4UIVNVPROC) (GLenum target, GLuint index, GLsizei count, const GLuint *params); -typedef void (APIENTRYP PFNGLGETPROGRAMLOCALPARAMETERIIVNVPROC) (GLenum target, GLuint index, GLint *params); -typedef void (APIENTRYP PFNGLGETPROGRAMLOCALPARAMETERIUIVNVPROC) (GLenum target, GLuint index, GLuint *params); -typedef void (APIENTRYP PFNGLGETPROGRAMENVPARAMETERIIVNVPROC) (GLenum target, GLuint index, GLint *params); -typedef void (APIENTRYP PFNGLGETPROGRAMENVPARAMETERIUIVNVPROC) (GLenum target, GLuint index, GLuint *params); -#endif - -#ifndef GL_NV_geometry_program4 -#define GL_NV_geometry_program4 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glProgramVertexLimitNV (GLenum, GLint); -GLAPI void APIENTRY glFramebufferTextureEXT (GLenum, GLenum, GLuint, GLint); -GLAPI void APIENTRY glFramebufferTextureLayerEXT (GLenum, GLenum, GLuint, GLint, GLint); -GLAPI void APIENTRY glFramebufferTextureFaceEXT (GLenum, GLenum, GLuint, GLint, GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLPROGRAMVERTEXLIMITNVPROC) (GLenum target, GLint limit); -typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREEXTPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level); -typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURELAYEREXTPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint layer); -typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREFACEEXTPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLenum face); -#endif - -#ifndef GL_EXT_geometry_shader4 -#define GL_EXT_geometry_shader4 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glProgramParameteriEXT (GLuint, GLenum, GLint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLPROGRAMPARAMETERIEXTPROC) (GLuint program, GLenum pname, GLint value); -#endif - -#ifndef GL_NV_vertex_program4 -#define GL_NV_vertex_program4 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glVertexAttribI1iEXT (GLuint, GLint); -GLAPI void APIENTRY glVertexAttribI2iEXT (GLuint, GLint, GLint); -GLAPI void APIENTRY glVertexAttribI3iEXT (GLuint, GLint, GLint, GLint); -GLAPI void APIENTRY glVertexAttribI4iEXT (GLuint, GLint, GLint, GLint, GLint); -GLAPI void APIENTRY glVertexAttribI1uiEXT (GLuint, GLuint); -GLAPI void APIENTRY glVertexAttribI2uiEXT (GLuint, GLuint, GLuint); -GLAPI void APIENTRY glVertexAttribI3uiEXT (GLuint, GLuint, GLuint, GLuint); -GLAPI void APIENTRY glVertexAttribI4uiEXT (GLuint, GLuint, GLuint, GLuint, GLuint); -GLAPI void APIENTRY glVertexAttribI1ivEXT (GLuint, const GLint *); -GLAPI void APIENTRY glVertexAttribI2ivEXT (GLuint, const GLint *); -GLAPI void APIENTRY glVertexAttribI3ivEXT (GLuint, const GLint *); -GLAPI void APIENTRY glVertexAttribI4ivEXT (GLuint, const GLint *); -GLAPI void APIENTRY glVertexAttribI1uivEXT (GLuint, const GLuint *); -GLAPI void APIENTRY glVertexAttribI2uivEXT (GLuint, const GLuint *); -GLAPI void APIENTRY glVertexAttribI3uivEXT (GLuint, const GLuint *); -GLAPI void APIENTRY glVertexAttribI4uivEXT (GLuint, const GLuint *); -GLAPI void APIENTRY glVertexAttribI4bvEXT (GLuint, const GLbyte *); -GLAPI void APIENTRY glVertexAttribI4svEXT (GLuint, const GLshort *); -GLAPI void APIENTRY glVertexAttribI4ubvEXT (GLuint, const GLubyte *); -GLAPI void APIENTRY glVertexAttribI4usvEXT (GLuint, const GLushort *); -GLAPI void APIENTRY glVertexAttribIPointerEXT (GLuint, GLint, GLenum, GLsizei, const GLvoid *); -GLAPI void APIENTRY glGetVertexAttribIivEXT (GLuint, GLenum, GLint *); -GLAPI void APIENTRY glGetVertexAttribIuivEXT (GLuint, GLenum, GLuint *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLVERTEXATTRIBI1IEXTPROC) (GLuint index, GLint x); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI2IEXTPROC) (GLuint index, GLint x, GLint y); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI3IEXTPROC) (GLuint index, GLint x, GLint y, GLint z); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI4IEXTPROC) (GLuint index, GLint x, GLint y, GLint z, GLint w); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI1UIEXTPROC) (GLuint index, GLuint x); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI2UIEXTPROC) (GLuint index, GLuint x, GLuint y); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI3UIEXTPROC) (GLuint index, GLuint x, GLuint y, GLuint z); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI4UIEXTPROC) (GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI1IVEXTPROC) (GLuint index, const GLint *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI2IVEXTPROC) (GLuint index, const GLint *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI3IVEXTPROC) (GLuint index, const GLint *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI4IVEXTPROC) (GLuint index, const GLint *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI1UIVEXTPROC) (GLuint index, const GLuint *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI2UIVEXTPROC) (GLuint index, const GLuint *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI3UIVEXTPROC) (GLuint index, const GLuint *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI4UIVEXTPROC) (GLuint index, const GLuint *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI4BVEXTPROC) (GLuint index, const GLbyte *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI4SVEXTPROC) (GLuint index, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI4UBVEXTPROC) (GLuint index, const GLubyte *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI4USVEXTPROC) (GLuint index, const GLushort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBIPOINTEREXTPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIIVEXTPROC) (GLuint index, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIUIVEXTPROC) (GLuint index, GLenum pname, GLuint *params); -#endif - -#ifndef GL_EXT_gpu_shader4 -#define GL_EXT_gpu_shader4 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glGetUniformuivEXT (GLuint, GLint, GLuint *); -GLAPI void APIENTRY glBindFragDataLocationEXT (GLuint, GLuint, const GLchar *); -GLAPI GLint APIENTRY glGetFragDataLocationEXT (GLuint, const GLchar *); -GLAPI void APIENTRY glUniform1uiEXT (GLint, GLuint); -GLAPI void APIENTRY glUniform2uiEXT (GLint, GLuint, GLuint); -GLAPI void APIENTRY glUniform3uiEXT (GLint, GLuint, GLuint, GLuint); -GLAPI void APIENTRY glUniform4uiEXT (GLint, GLuint, GLuint, GLuint, GLuint); -GLAPI void APIENTRY glUniform1uivEXT (GLint, GLsizei, const GLuint *); -GLAPI void APIENTRY glUniform2uivEXT (GLint, GLsizei, const GLuint *); -GLAPI void APIENTRY glUniform3uivEXT (GLint, GLsizei, const GLuint *); -GLAPI void APIENTRY glUniform4uivEXT (GLint, GLsizei, const GLuint *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLGETUNIFORMUIVEXTPROC) (GLuint program, GLint location, GLuint *params); -typedef void (APIENTRYP PFNGLBINDFRAGDATALOCATIONEXTPROC) (GLuint program, GLuint color, const GLchar *name); -typedef GLint (APIENTRYP PFNGLGETFRAGDATALOCATIONEXTPROC) (GLuint program, const GLchar *name); -typedef void (APIENTRYP PFNGLUNIFORM1UIEXTPROC) (GLint location, GLuint v0); -typedef void (APIENTRYP PFNGLUNIFORM2UIEXTPROC) (GLint location, GLuint v0, GLuint v1); -typedef void (APIENTRYP PFNGLUNIFORM3UIEXTPROC) (GLint location, GLuint v0, GLuint v1, GLuint v2); -typedef void (APIENTRYP PFNGLUNIFORM4UIEXTPROC) (GLint location, GLuint v0, GLuint v1, GLuint v2, GLuint v3); -typedef void (APIENTRYP PFNGLUNIFORM1UIVEXTPROC) (GLint location, GLsizei count, const GLuint *value); -typedef void (APIENTRYP PFNGLUNIFORM2UIVEXTPROC) (GLint location, GLsizei count, const GLuint *value); -typedef void (APIENTRYP PFNGLUNIFORM3UIVEXTPROC) (GLint location, GLsizei count, const GLuint *value); -typedef void (APIENTRYP PFNGLUNIFORM4UIVEXTPROC) (GLint location, GLsizei count, const GLuint *value); -#endif - -#ifndef GL_EXT_draw_instanced -#define GL_EXT_draw_instanced 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glDrawArraysInstancedEXT (GLenum, GLint, GLsizei, GLsizei); -GLAPI void APIENTRY glDrawElementsInstancedEXT (GLenum, GLsizei, GLenum, const GLvoid *, GLsizei); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLDRAWARRAYSINSTANCEDEXTPROC) (GLenum mode, GLint start, GLsizei count, GLsizei primcount); -typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDEXTPROC) (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLsizei primcount); -#endif - -#ifndef GL_EXT_packed_float -#define GL_EXT_packed_float 1 -#endif - -#ifndef GL_EXT_texture_array -#define GL_EXT_texture_array 1 -#endif - -#ifndef GL_EXT_texture_buffer_object -#define GL_EXT_texture_buffer_object 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glTexBufferEXT (GLenum, GLenum, GLuint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLTEXBUFFEREXTPROC) (GLenum target, GLenum internalformat, GLuint buffer); -#endif - -#ifndef GL_EXT_texture_compression_latc -#define GL_EXT_texture_compression_latc 1 -#endif - -#ifndef GL_EXT_texture_compression_rgtc -#define GL_EXT_texture_compression_rgtc 1 -#endif - -#ifndef GL_EXT_texture_shared_exponent -#define GL_EXT_texture_shared_exponent 1 -#endif - -#ifndef GL_NV_depth_buffer_float -#define GL_NV_depth_buffer_float 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glDepthRangedNV (GLdouble, GLdouble); -GLAPI void APIENTRY glClearDepthdNV (GLdouble); -GLAPI void APIENTRY glDepthBoundsdNV (GLdouble, GLdouble); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLDEPTHRANGEDNVPROC) (GLdouble zNear, GLdouble zFar); -typedef void (APIENTRYP PFNGLCLEARDEPTHDNVPROC) (GLdouble depth); -typedef void (APIENTRYP PFNGLDEPTHBOUNDSDNVPROC) (GLdouble zmin, GLdouble zmax); -#endif - -#ifndef GL_NV_fragment_program4 -#define GL_NV_fragment_program4 1 -#endif - -#ifndef GL_NV_framebuffer_multisample_coverage -#define GL_NV_framebuffer_multisample_coverage 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glRenderbufferStorageMultisampleCoverageNV (GLenum, GLsizei, GLsizei, GLenum, GLsizei, GLsizei); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLRENDERBUFFERSTORAGEMULTISAMPLECOVERAGENVPROC) (GLenum target, GLsizei coverageSamples, GLsizei colorSamples, GLenum internalformat, GLsizei width, GLsizei height); -#endif - -#ifndef GL_EXT_framebuffer_sRGB -#define GL_EXT_framebuffer_sRGB 1 -#endif - -#ifndef GL_NV_geometry_shader4 -#define GL_NV_geometry_shader4 1 -#endif - -#ifndef GL_NV_parameter_buffer_object -#define GL_NV_parameter_buffer_object 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glProgramBufferParametersfvNV (GLenum, GLuint, GLuint, GLsizei, const GLfloat *); -GLAPI void APIENTRY glProgramBufferParametersIivNV (GLenum, GLuint, GLuint, GLsizei, const GLint *); -GLAPI void APIENTRY glProgramBufferParametersIuivNV (GLenum, GLuint, GLuint, GLsizei, const GLuint *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLPROGRAMBUFFERPARAMETERSFVNVPROC) (GLenum target, GLuint buffer, GLuint index, GLsizei count, const GLfloat *params); -typedef void (APIENTRYP PFNGLPROGRAMBUFFERPARAMETERSIIVNVPROC) (GLenum target, GLuint buffer, GLuint index, GLsizei count, const GLint *params); -typedef void (APIENTRYP PFNGLPROGRAMBUFFERPARAMETERSIUIVNVPROC) (GLenum target, GLuint buffer, GLuint index, GLsizei count, const GLuint *params); -#endif - -#ifndef GL_EXT_draw_buffers2 -#define GL_EXT_draw_buffers2 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glColorMaskIndexedEXT (GLuint, GLboolean, GLboolean, GLboolean, GLboolean); -GLAPI void APIENTRY glGetBooleanIndexedvEXT (GLenum, GLuint, GLboolean *); -GLAPI void APIENTRY glGetIntegerIndexedvEXT (GLenum, GLuint, GLint *); -GLAPI void APIENTRY glEnableIndexedEXT (GLenum, GLuint); -GLAPI void APIENTRY glDisableIndexedEXT (GLenum, GLuint); -GLAPI GLboolean APIENTRY glIsEnabledIndexedEXT (GLenum, GLuint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLCOLORMASKINDEXEDEXTPROC) (GLuint index, GLboolean r, GLboolean g, GLboolean b, GLboolean a); -typedef void (APIENTRYP PFNGLGETBOOLEANINDEXEDVEXTPROC) (GLenum target, GLuint index, GLboolean *data); -typedef void (APIENTRYP PFNGLGETINTEGERINDEXEDVEXTPROC) (GLenum target, GLuint index, GLint *data); -typedef void (APIENTRYP PFNGLENABLEINDEXEDEXTPROC) (GLenum target, GLuint index); -typedef void (APIENTRYP PFNGLDISABLEINDEXEDEXTPROC) (GLenum target, GLuint index); -typedef GLboolean (APIENTRYP PFNGLISENABLEDINDEXEDEXTPROC) (GLenum target, GLuint index); -#endif - -#ifndef GL_NV_transform_feedback -#define GL_NV_transform_feedback 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glBeginTransformFeedbackNV (GLenum); -GLAPI void APIENTRY glEndTransformFeedbackNV (void); -GLAPI void APIENTRY glTransformFeedbackAttribsNV (GLuint, const GLint *, GLenum); -GLAPI void APIENTRY glBindBufferRangeNV (GLenum, GLuint, GLuint, GLintptr, GLsizeiptr); -GLAPI void APIENTRY glBindBufferOffsetNV (GLenum, GLuint, GLuint, GLintptr); -GLAPI void APIENTRY glBindBufferBaseNV (GLenum, GLuint, GLuint); -GLAPI void APIENTRY glTransformFeedbackVaryingsNV (GLuint, GLsizei, const GLint *, GLenum); -GLAPI void APIENTRY glActiveVaryingNV (GLuint, const GLchar *); -GLAPI GLint APIENTRY glGetVaryingLocationNV (GLuint, const GLchar *); -GLAPI void APIENTRY glGetActiveVaryingNV (GLuint, GLuint, GLsizei, GLsizei *, GLsizei *, GLenum *, GLchar *); -GLAPI void APIENTRY glGetTransformFeedbackVaryingNV (GLuint, GLuint, GLint *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLBEGINTRANSFORMFEEDBACKNVPROC) (GLenum primitiveMode); -typedef void (APIENTRYP PFNGLENDTRANSFORMFEEDBACKNVPROC) (void); -typedef void (APIENTRYP PFNGLTRANSFORMFEEDBACKATTRIBSNVPROC) (GLuint count, const GLint *attribs, GLenum bufferMode); -typedef void (APIENTRYP PFNGLBINDBUFFERRANGENVPROC) (GLenum target, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size); -typedef void (APIENTRYP PFNGLBINDBUFFEROFFSETNVPROC) (GLenum target, GLuint index, GLuint buffer, GLintptr offset); -typedef void (APIENTRYP PFNGLBINDBUFFERBASENVPROC) (GLenum target, GLuint index, GLuint buffer); -typedef void (APIENTRYP PFNGLTRANSFORMFEEDBACKVARYINGSNVPROC) (GLuint program, GLsizei count, const GLint *locations, GLenum bufferMode); -typedef void (APIENTRYP PFNGLACTIVEVARYINGNVPROC) (GLuint program, const GLchar *name); -typedef GLint (APIENTRYP PFNGLGETVARYINGLOCATIONNVPROC) (GLuint program, const GLchar *name); -typedef void (APIENTRYP PFNGLGETACTIVEVARYINGNVPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLsizei *size, GLenum *type, GLchar *name); -typedef void (APIENTRYP PFNGLGETTRANSFORMFEEDBACKVARYINGNVPROC) (GLuint program, GLuint index, GLint *location); -#endif - -#ifndef GL_EXT_bindable_uniform -#define GL_EXT_bindable_uniform 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glUniformBufferEXT (GLuint, GLint, GLuint); -GLAPI GLint APIENTRY glGetUniformBufferSizeEXT (GLuint, GLint); -GLAPI GLintptr APIENTRY glGetUniformOffsetEXT (GLuint, GLint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLUNIFORMBUFFEREXTPROC) (GLuint program, GLint location, GLuint buffer); -typedef GLint (APIENTRYP PFNGLGETUNIFORMBUFFERSIZEEXTPROC) (GLuint program, GLint location); -typedef GLintptr (APIENTRYP PFNGLGETUNIFORMOFFSETEXTPROC) (GLuint program, GLint location); -#endif - -#ifndef GL_EXT_texture_integer -#define GL_EXT_texture_integer 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glTexParameterIivEXT (GLenum, GLenum, const GLint *); -GLAPI void APIENTRY glTexParameterIuivEXT (GLenum, GLenum, const GLuint *); -GLAPI void APIENTRY glGetTexParameterIivEXT (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glGetTexParameterIuivEXT (GLenum, GLenum, GLuint *); -GLAPI void APIENTRY glClearColorIiEXT (GLint, GLint, GLint, GLint); -GLAPI void APIENTRY glClearColorIuiEXT (GLuint, GLuint, GLuint, GLuint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLTEXPARAMETERIIVEXTPROC) (GLenum target, GLenum pname, const GLint *params); -typedef void (APIENTRYP PFNGLTEXPARAMETERIUIVEXTPROC) (GLenum target, GLenum pname, const GLuint *params); -typedef void (APIENTRYP PFNGLGETTEXPARAMETERIIVEXTPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETTEXPARAMETERIUIVEXTPROC) (GLenum target, GLenum pname, GLuint *params); -typedef void (APIENTRYP PFNGLCLEARCOLORIIEXTPROC) (GLint red, GLint green, GLint blue, GLint alpha); -typedef void (APIENTRYP PFNGLCLEARCOLORIUIEXTPROC) (GLuint red, GLuint green, GLuint blue, GLuint alpha); -#endif - -#ifndef GL_GREMEDY_frame_terminator -#define GL_GREMEDY_frame_terminator 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glFrameTerminatorGREMEDY (void); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLFRAMETERMINATORGREMEDYPROC) (void); -#endif - - -#ifdef __cplusplus -} -#endif - -#endif diff --git a/dependencies/msvc/stdint.h b/dependencies/msvc/stdint.h deleted file mode 100644 index 1ff7fb05..00000000 --- a/dependencies/msvc/stdint.h +++ /dev/null @@ -1,222 +0,0 @@ -// ISO C9x compliant stdint.h for Miscrosoft Visual Studio -// Based on ISO/IEC 9899:TC2 Committee draft (May 6, 2005) WG14/N1124 -// -// Copyright (c) 2006 Alexander Chemeris -// -// Redistribution and use in source and binary forms, with or without -// modification, are permitted provided that the following conditions are met: -// -// 1. Redistributions of source code must retain the above copyright notice, -// this list of conditions and the following disclaimer. -// -// 2. Redistributions in binary form must reproduce the above copyright -// notice, this list of conditions and the following disclaimer in the -// documentation and/or other materials provided with the distribution. -// -// 3. The name of the author may be used to endorse or promote products -// derived from this software without specific prior written permission. -// -// THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR IMPLIED -// WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF -// MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO -// EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, -// SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, -// PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; -// OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, -// WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR -// OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF -// ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. -// -/////////////////////////////////////////////////////////////////////////////// - -#ifndef _MSC_VER // [ -#error "Use this header only with Microsoft Visual C++ compilers!" -#endif // _MSC_VER ] - -#ifndef _MSC_STDINT_H_ // [ -#define _MSC_STDINT_H_ - -#if _MSC_VER > 1000 -#pragma once -#endif - -#include - -// For Visual Studio 6 in C++ mode wrap include with 'extern "C++" {}' -// or compiler give many errors like this: -// error C2733: second C linkage of overloaded function 'wmemchr' not allowed -#if (_MSC_VER < 1300) && defined(__cplusplus) - extern "C++" { -#endif -# include -#if (_MSC_VER < 1300) && defined(__cplusplus) - } -#endif - -// 7.18.1 Integer types - -// 7.18.1.1 Exact-width integer types -typedef __int8 int8_t; -typedef __int16 int16_t; -typedef __int32 int32_t; -typedef __int64 int64_t; -typedef unsigned __int8 uint8_t; -typedef unsigned __int16 uint16_t; -typedef unsigned __int32 uint32_t; -typedef unsigned __int64 uint64_t; - -// 7.18.1.2 Minimum-width integer types -typedef int8_t int_least8_t; -typedef int16_t int_least16_t; -typedef int32_t int_least32_t; -typedef int64_t int_least64_t; -typedef uint8_t uint_least8_t; -typedef uint16_t uint_least16_t; -typedef uint32_t uint_least32_t; -typedef uint64_t uint_least64_t; - -// 7.18.1.3 Fastest minimum-width integer types -typedef int8_t int_fast8_t; -typedef int16_t int_fast16_t; -typedef int32_t int_fast32_t; -typedef int64_t int_fast64_t; -typedef uint8_t uint_fast8_t; -typedef uint16_t uint_fast16_t; -typedef uint32_t uint_fast32_t; -typedef uint64_t uint_fast64_t; - -// 7.18.1.4 Integer types capable of holding object pointers -#ifdef _WIN64 // [ - typedef __int64 intptr_t; - typedef unsigned __int64 uintptr_t; -#else // _WIN64 ][ - typedef int intptr_t; - typedef unsigned int uintptr_t; -#endif // _WIN64 ] - -// 7.18.1.5 Greatest-width integer types -typedef int64_t intmax_t; -typedef uint64_t uintmax_t; - - -// 7.18.2 Limits of specified-width integer types - -#if !defined(__cplusplus) || defined(__STDC_LIMIT_MACROS) // [ See footnote 220 at page 257 and footnote 221 at page 259 - -// 7.18.2.1 Limits of exact-width integer types -#define INT8_MIN _I8_MIN -#define INT8_MAX _I8_MAX -#define INT16_MIN _I16_MIN -#define INT16_MAX _I16_MAX -#define INT32_MIN _I32_MIN -#define INT32_MAX _I32_MAX -#define INT64_MIN _I64_MIN -#define INT64_MAX _I64_MAX -#define UINT8_MAX _UI8_MAX -#define UINT16_MAX _UI16_MAX -#define UINT32_MAX _UI32_MAX -#define UINT64_MAX _UI64_MAX - -// 7.18.2.2 Limits of minimum-width integer types -#define INT_LEAST8_MIN INT8_MIN -#define INT_LEAST8_MAX INT8_MAX -#define INT_LEAST16_MIN INT16_MIN -#define INT_LEAST16_MAX INT16_MAX -#define INT_LEAST32_MIN INT32_MIN -#define INT_LEAST32_MAX INT32_MAX -#define INT_LEAST64_MIN INT64_MIN -#define INT_LEAST64_MAX INT64_MAX -#define UINT_LEAST8_MAX UINT8_MAX -#define UINT_LEAST16_MAX UINT16_MAX -#define UINT_LEAST32_MAX UINT32_MAX -#define UINT_LEAST64_MAX UINT64_MAX - -// 7.18.2.3 Limits of fastest minimum-width integer types -#define INT_FAST8_MIN INT8_MIN -#define INT_FAST8_MAX INT8_MAX -#define INT_FAST16_MIN INT16_MIN -#define INT_FAST16_MAX INT16_MAX -#define INT_FAST32_MIN INT32_MIN -#define INT_FAST32_MAX INT32_MAX -#define INT_FAST64_MIN INT64_MIN -#define INT_FAST64_MAX INT64_MAX -#define UINT_FAST8_MAX UINT8_MAX -#define UINT_FAST16_MAX UINT16_MAX -#define UINT_FAST32_MAX UINT32_MAX -#define UINT_FAST64_MAX UINT64_MAX - -// 7.18.2.4 Limits of integer types capable of holding object pointers -#ifdef _WIN64 // [ -# define INTPTR_MIN INT64_MIN -# define INTPTR_MAX INT64_MAX -# define UINTPTR_MAX UINT64_MAX -#else // _WIN64 ][ -# define INTPTR_MIN INT32_MIN -# define INTPTR_MAX INT32_MAX -# define UINTPTR_MAX UINT32_MAX -#endif // _WIN64 ] - -// 7.18.2.5 Limits of greatest-width integer types -#define INTMAX_MIN INT64_MIN -#define INTMAX_MAX INT64_MAX -#define UINTMAX_MAX UINT64_MAX - -// 7.18.3 Limits of other integer types - -#ifdef _WIN64 // [ -# define PTRDIFF_MIN _I64_MIN -# define PTRDIFF_MAX _I64_MAX -#else // _WIN64 ][ -# define PTRDIFF_MIN _I32_MIN -# define PTRDIFF_MAX _I32_MAX -#endif // _WIN64 ] - -#define SIG_ATOMIC_MIN INT_MIN -#define SIG_ATOMIC_MAX INT_MAX - -#ifndef SIZE_MAX // [ -# ifdef _WIN64 // [ -# define SIZE_MAX _UI64_MAX -# else // _WIN64 ][ -# define SIZE_MAX _UI32_MAX -# endif // _WIN64 ] -#endif // SIZE_MAX ] - -// WCHAR_MIN and WCHAR_MAX are also defined in -#ifndef WCHAR_MIN // [ -# define WCHAR_MIN 0 -#endif // WCHAR_MIN ] -#ifndef WCHAR_MAX // [ -# define WCHAR_MAX _UI16_MAX -#endif // WCHAR_MAX ] - -#define WINT_MIN 0 -#define WINT_MAX _UI16_MAX - -#endif // __STDC_LIMIT_MACROS ] - - -// 7.18.4 Limits of other integer types - -#if !defined(__cplusplus) || defined(__STDC_CONSTANT_MACROS) // [ See footnote 224 at page 260 - -// 7.18.4.1 Macros for minimum-width integer constants - -#define INT8_C(val) val -#define INT16_C(val) val -#define INT32_C(val) val##L -#define INT64_C(val) val##i64 - -#define UINT8_C(val) val -#define UINT16_C(val) val -#define UINT32_C(val) val##UL -#define UINT64_C(val) val##Ui64 - -// 7.18.4.2 Macros for greatest-width integer constants -#define INTMAX_C INT64_C -#define UINTMAX_C UINT64_C - -#endif // __STDC_CONSTANT_MACROS ] - - -#endif // _MSC_STDINT_H_ ] diff --git a/dependencies/nasm.exe b/dependencies/nasm.exe deleted file mode 100644 index 18b1573d..00000000 Binary files a/dependencies/nasm.exe and /dev/null differ diff --git a/dependencies/zlib/ChangeLog b/dependencies/zlib/ChangeLog deleted file mode 100644 index 1ac94630..00000000 --- a/dependencies/zlib/ChangeLog +++ /dev/null @@ -1,855 +0,0 @@ - - ChangeLog file for zlib - -Changes in 1.2.3 (18 July 2005) -- Apply security vulnerability fixes to contrib/infback9 as well -- Clean up some text files (carriage returns, trailing space) -- Update testzlib, vstudio, masmx64, and masmx86 in contrib [Vollant] - -Changes in 1.2.2.4 (11 July 2005) -- Add inflatePrime() function for starting inflation at bit boundary -- Avoid some Visual C warnings in deflate.c -- Avoid more silly Visual C warnings in inflate.c and inftrees.c for 64-bit - compile -- Fix some spelling errors in comments [Betts] -- Correct inflateInit2() error return documentation in zlib.h -- Added zran.c example of compressed data random access to examples - directory, shows use of inflatePrime() -- Fix cast for assignments to strm->state in inflate.c and infback.c -- Fix zlibCompileFlags() in zutil.c to use 1L for long shifts [Oberhumer] -- Move declarations of gf2 functions to right place in crc32.c [Oberhumer] -- Add cast in trees.c t avoid a warning [Oberhumer] -- Avoid some warnings in fitblk.c, gun.c, gzjoin.c in examples [Oberhumer] -- Update make_vms.com [Zinser] -- Initialize state->write in inflateReset() since copied in inflate_fast() -- Be more strict on incomplete code sets in inflate_table() and increase - ENOUGH and MAXD -- this repairs a possible security vulnerability for - invalid inflate input. Thanks to Tavis Ormandy and Markus Oberhumer for - discovering the vulnerability and providing test cases. -- Add ia64 support to configure for HP-UX [Smith] -- Add error return to gzread() for format or i/o error [Levin] -- Use malloc.h for OS/2 [Necasek] - -Changes in 1.2.2.3 (27 May 2005) -- Replace 1U constants in inflate.c and inftrees.c for 64-bit compile -- Typecast fread() return values in gzio.c [Vollant] -- Remove trailing space in minigzip.c outmode (VC++ can't deal with it) -- Fix crc check bug in gzread() after gzungetc() [Heiner] -- Add the deflateTune() function to adjust internal compression parameters -- Add a fast gzip decompressor, gun.c, to examples (use of inflateBack) -- Remove an incorrect assertion in examples/zpipe.c -- Add C++ wrapper in infback9.h [Donais] -- Fix bug in inflateCopy() when decoding fixed codes -- Note in zlib.h how much deflateSetDictionary() actually uses -- Remove USE_DICT_HEAD in deflate.c (would mess up inflate if used) -- Add _WIN32_WCE to define WIN32 in zconf.in.h [Spencer] -- Don't include stderr.h or errno.h for _WIN32_WCE in zutil.h [Spencer] -- Add gzdirect() function to indicate transparent reads -- Update contrib/minizip [Vollant] -- Fix compilation of deflate.c when both ASMV and FASTEST [Oberhumer] -- Add casts in crc32.c to avoid warnings [Oberhumer] -- Add contrib/masmx64 [Vollant] -- Update contrib/asm586, asm686, masmx86, testzlib, vstudio [Vollant] - -Changes in 1.2.2.2 (30 December 2004) -- Replace structure assignments in deflate.c and inflate.c with zmemcpy to - avoid implicit memcpy calls (portability for no-library compilation) -- Increase sprintf() buffer size in gzdopen() to allow for large numbers -- Add INFLATE_STRICT to check distances against zlib header -- Improve WinCE errno handling and comments [Chang] -- Remove comment about no gzip header processing in FAQ -- Add Z_FIXED strategy option to deflateInit2() to force fixed trees -- Add updated make_vms.com [Coghlan], update README -- Create a new "examples" directory, move gzappend.c there, add zpipe.c, - fitblk.c, gzlog.[ch], gzjoin.c, and zlib_how.html. -- Add FAQ entry and comments in deflate.c on uninitialized memory access -- Add Solaris 9 make options in configure [Gilbert] -- Allow strerror() usage in gzio.c for STDC -- Fix DecompressBuf in contrib/delphi/ZLib.pas [ManChesTer] -- Update contrib/masmx86/inffas32.asm and gvmat32.asm [Vollant] -- Use z_off_t for adler32_combine() and crc32_combine() lengths -- Make adler32() much faster for small len -- Use OS_CODE in deflate() default gzip header - -Changes in 1.2.2.1 (31 October 2004) -- Allow inflateSetDictionary() call for raw inflate -- Fix inflate header crc check bug for file names and comments -- Add deflateSetHeader() and gz_header structure for custom gzip headers -- Add inflateGetheader() to retrieve gzip headers -- Add crc32_combine() and adler32_combine() functions -- Add alloc_func, free_func, in_func, out_func to Z_PREFIX list -- Use zstreamp consistently in zlib.h (inflate_back functions) -- Remove GUNZIP condition from definition of inflate_mode in inflate.h - and in contrib/inflate86/inffast.S [Truta, Anderson] -- Add support for AMD64 in contrib/inflate86/inffas86.c [Anderson] -- Update projects/README.projects and projects/visualc6 [Truta] -- Update win32/DLL_FAQ.txt [Truta] -- Avoid warning under NO_GZCOMPRESS in gzio.c; fix typo [Truta] -- Deprecate Z_ASCII; use Z_TEXT instead [Truta] -- Use a new algorithm for setting strm->data_type in trees.c [Truta] -- Do not define an exit() prototype in zutil.c unless DEBUG defined -- Remove prototype of exit() from zutil.c, example.c, minigzip.c [Truta] -- Add comment in zlib.h for Z_NO_FLUSH parameter to deflate() -- Fix Darwin build version identification [Peterson] - -Changes in 1.2.2 (3 October 2004) -- Update zlib.h comments on gzip in-memory processing -- Set adler to 1 in inflateReset() to support Java test suite [Walles] -- Add contrib/dotzlib [Ravn] -- Update win32/DLL_FAQ.txt [Truta] -- Update contrib/minizip [Vollant] -- Move contrib/visual-basic.txt to old/ [Truta] -- Fix assembler builds in projects/visualc6/ [Truta] - -Changes in 1.2.1.2 (9 September 2004) -- Update INDEX file -- Fix trees.c to update strm->data_type (no one ever noticed!) -- Fix bug in error case in inflate.c, infback.c, and infback9.c [Brown] -- Add "volatile" to crc table flag declaration (for DYNAMIC_CRC_TABLE) -- Add limited multitasking protection to DYNAMIC_CRC_TABLE -- Add NO_vsnprintf for VMS in zutil.h [Mozilla] -- Don't declare strerror() under VMS [Mozilla] -- Add comment to DYNAMIC_CRC_TABLE to use get_crc_table() to initialize -- Update contrib/ada [Anisimkov] -- Update contrib/minizip [Vollant] -- Fix configure to not hardcode directories for Darwin [Peterson] -- Fix gzio.c to not return error on empty files [Brown] -- Fix indentation; update version in contrib/delphi/ZLib.pas and - contrib/pascal/zlibpas.pas [Truta] -- Update mkasm.bat in contrib/masmx86 [Truta] -- Update contrib/untgz [Truta] -- Add projects/README.projects [Truta] -- Add project for MS Visual C++ 6.0 in projects/visualc6 [Cadieux, Truta] -- Update win32/DLL_FAQ.txt [Truta] -- Update list of Z_PREFIX symbols in zconf.h [Randers-Pehrson, Truta] -- Remove an unnecessary assignment to curr in inftrees.c [Truta] -- Add OS/2 to exe builds in configure [Poltorak] -- Remove err dummy parameter in zlib.h [Kientzle] - -Changes in 1.2.1.1 (9 January 2004) -- Update email address in README -- Several FAQ updates -- Fix a big fat bug in inftrees.c that prevented decoding valid - dynamic blocks with only literals and no distance codes -- - Thanks to "Hot Emu" for the bug report and sample file -- Add a note to puff.c on no distance codes case. - -Changes in 1.2.1 (17 November 2003) -- Remove a tab in contrib/gzappend/gzappend.c -- Update some interfaces in contrib for new zlib functions -- Update zlib version number in some contrib entries -- Add Windows CE definition for ptrdiff_t in zutil.h [Mai, Truta] -- Support shared libraries on Hurd and KFreeBSD [Brown] -- Fix error in NO_DIVIDE option of adler32.c - -Changes in 1.2.0.8 (4 November 2003) -- Update version in contrib/delphi/ZLib.pas and contrib/pascal/zlibpas.pas -- Add experimental NO_DIVIDE #define in adler32.c - - Possibly faster on some processors (let me know if it is) -- Correct Z_BLOCK to not return on first inflate call if no wrap -- Fix strm->data_type on inflate() return to correctly indicate EOB -- Add deflatePrime() function for appending in the middle of a byte -- Add contrib/gzappend for an example of appending to a stream -- Update win32/DLL_FAQ.txt [Truta] -- Delete Turbo C comment in README [Truta] -- Improve some indentation in zconf.h [Truta] -- Fix infinite loop on bad input in configure script [Church] -- Fix gzeof() for concatenated gzip files [Johnson] -- Add example to contrib/visual-basic.txt [Michael B.] -- Add -p to mkdir's in Makefile.in [vda] -- Fix configure to properly detect presence or lack of printf functions -- Add AS400 support [Monnerat] -- Add a little Cygwin support [Wilson] - -Changes in 1.2.0.7 (21 September 2003) -- Correct some debug formats in contrib/infback9 -- Cast a type in a debug statement in trees.c -- Change search and replace delimiter in configure from % to # [Beebe] -- Update contrib/untgz to 0.2 with various fixes [Truta] -- Add build support for Amiga [Nikl] -- Remove some directories in old that have been updated to 1.2 -- Add dylib building for Mac OS X in configure and Makefile.in -- Remove old distribution stuff from Makefile -- Update README to point to DLL_FAQ.txt, and add comment on Mac OS X -- Update links in README - -Changes in 1.2.0.6 (13 September 2003) -- Minor FAQ updates -- Update contrib/minizip to 1.00 [Vollant] -- Remove test of gz functions in example.c when GZ_COMPRESS defined [Truta] -- Update POSTINC comment for 68060 [Nikl] -- Add contrib/infback9 with deflate64 decoding (unsupported) -- For MVS define NO_vsnprintf and undefine FAR [van Burik] -- Add pragma for fdopen on MVS [van Burik] - -Changes in 1.2.0.5 (8 September 2003) -- Add OF to inflateBackEnd() declaration in zlib.h -- Remember start when using gzdopen in the middle of a file -- Use internal off_t counters in gz* functions to properly handle seeks -- Perform more rigorous check for distance-too-far in inffast.c -- Add Z_BLOCK flush option to return from inflate at block boundary -- Set strm->data_type on return from inflate - - Indicate bits unused, if at block boundary, and if in last block -- Replace size_t with ptrdiff_t in crc32.c, and check for correct size -- Add condition so old NO_DEFLATE define still works for compatibility -- FAQ update regarding the Windows DLL [Truta] -- INDEX update: add qnx entry, remove aix entry [Truta] -- Install zlib.3 into mandir [Wilson] -- Move contrib/zlib_dll_FAQ.txt to win32/DLL_FAQ.txt; update [Truta] -- Adapt the zlib interface to the new DLL convention guidelines [Truta] -- Introduce ZLIB_WINAPI macro to allow the export of functions using - the WINAPI calling convention, for Visual Basic [Vollant, Truta] -- Update msdos and win32 scripts and makefiles [Truta] -- Export symbols by name, not by ordinal, in win32/zlib.def [Truta] -- Add contrib/ada [Anisimkov] -- Move asm files from contrib/vstudio/vc70_32 to contrib/asm386 [Truta] -- Rename contrib/asm386 to contrib/masmx86 [Truta, Vollant] -- Add contrib/masm686 [Truta] -- Fix offsets in contrib/inflate86 and contrib/masmx86/inffas32.asm - [Truta, Vollant] -- Update contrib/delphi; rename to contrib/pascal; add example [Truta] -- Remove contrib/delphi2; add a new contrib/delphi [Truta] -- Avoid inclusion of the nonstandard in contrib/iostream, - and fix some method prototypes [Truta] -- Fix the ZCR_SEED2 constant to avoid warnings in contrib/minizip - [Truta] -- Avoid the use of backslash (\) in contrib/minizip [Vollant] -- Fix file time handling in contrib/untgz; update makefiles [Truta] -- Update contrib/vstudio/vc70_32 to comply with the new DLL guidelines - [Vollant] -- Remove contrib/vstudio/vc15_16 [Vollant] -- Rename contrib/vstudio/vc70_32 to contrib/vstudio/vc7 [Truta] -- Update README.contrib [Truta] -- Invert the assignment order of match_head and s->prev[...] in - INSERT_STRING [Truta] -- Compare TOO_FAR with 32767 instead of 32768, to avoid 16-bit warnings - [Truta] -- Compare function pointers with 0, not with NULL or Z_NULL [Truta] -- Fix prototype of syncsearch in inflate.c [Truta] -- Introduce ASMINF macro to be enabled when using an ASM implementation - of inflate_fast [Truta] -- Change NO_DEFLATE to NO_GZCOMPRESS [Truta] -- Modify test_gzio in example.c to take a single file name as a - parameter [Truta] -- Exit the example.c program if gzopen fails [Truta] -- Add type casts around strlen in example.c [Truta] -- Remove casting to sizeof in minigzip.c; give a proper type - to the variable compared with SUFFIX_LEN [Truta] -- Update definitions of STDC and STDC99 in zconf.h [Truta] -- Synchronize zconf.h with the new Windows DLL interface [Truta] -- Use SYS16BIT instead of __32BIT__ to distinguish between - 16- and 32-bit platforms [Truta] -- Use far memory allocators in small 16-bit memory models for - Turbo C [Truta] -- Add info about the use of ASMV, ASMINF and ZLIB_WINAPI in - zlibCompileFlags [Truta] -- Cygwin has vsnprintf [Wilson] -- In Windows16, OS_CODE is 0, as in MSDOS [Truta] -- In Cygwin, OS_CODE is 3 (Unix), not 11 (Windows32) [Wilson] - -Changes in 1.2.0.4 (10 August 2003) -- Minor FAQ updates -- Be more strict when checking inflateInit2's windowBits parameter -- Change NO_GUNZIP compile option to NO_GZIP to cover deflate as well -- Add gzip wrapper option to deflateInit2 using windowBits -- Add updated QNX rule in configure and qnx directory [Bonnefoy] -- Make inflate distance-too-far checks more rigorous -- Clean up FAR usage in inflate -- Add casting to sizeof() in gzio.c and minigzip.c - -Changes in 1.2.0.3 (19 July 2003) -- Fix silly error in gzungetc() implementation [Vollant] -- Update contrib/minizip and contrib/vstudio [Vollant] -- Fix printf format in example.c -- Correct cdecl support in zconf.in.h [Anisimkov] -- Minor FAQ updates - -Changes in 1.2.0.2 (13 July 2003) -- Add ZLIB_VERNUM in zlib.h for numerical preprocessor comparisons -- Attempt to avoid warnings in crc32.c for pointer-int conversion -- Add AIX to configure, remove aix directory [Bakker] -- Add some casts to minigzip.c -- Improve checking after insecure sprintf() or vsprintf() calls -- Remove #elif's from crc32.c -- Change leave label to inf_leave in inflate.c and infback.c to avoid - library conflicts -- Remove inflate gzip decoding by default--only enable gzip decoding by - special request for stricter backward compatibility -- Add zlibCompileFlags() function to return compilation information -- More typecasting in deflate.c to avoid warnings -- Remove leading underscore from _Capital #defines [Truta] -- Fix configure to link shared library when testing -- Add some Windows CE target adjustments [Mai] -- Remove #define ZLIB_DLL in zconf.h [Vollant] -- Add zlib.3 [Rodgers] -- Update RFC URL in deflate.c and algorithm.txt [Mai] -- Add zlib_dll_FAQ.txt to contrib [Truta] -- Add UL to some constants [Truta] -- Update minizip and vstudio [Vollant] -- Remove vestigial NEED_DUMMY_RETURN from zconf.in.h -- Expand use of NO_DUMMY_DECL to avoid all dummy structures -- Added iostream3 to contrib [Schwardt] -- Replace rewind() with fseek() for WinCE [Truta] -- Improve setting of zlib format compression level flags - - Report 0 for huffman and rle strategies and for level == 0 or 1 - - Report 2 only for level == 6 -- Only deal with 64K limit when necessary at compile time [Truta] -- Allow TOO_FAR check to be turned off at compile time [Truta] -- Add gzclearerr() function [Souza] -- Add gzungetc() function - -Changes in 1.2.0.1 (17 March 2003) -- Add Z_RLE strategy for run-length encoding [Truta] - - When Z_RLE requested, restrict matches to distance one - - Update zlib.h, minigzip.c, gzopen(), gzdopen() for Z_RLE -- Correct FASTEST compilation to allow level == 0 -- Clean up what gets compiled for FASTEST -- Incorporate changes to zconf.in.h [Vollant] - - Refine detection of Turbo C need for dummy returns - - Refine ZLIB_DLL compilation - - Include additional header file on VMS for off_t typedef -- Try to use _vsnprintf where it supplants vsprintf [Vollant] -- Add some casts in inffast.c -- Enchance comments in zlib.h on what happens if gzprintf() tries to - write more than 4095 bytes before compression -- Remove unused state from inflateBackEnd() -- Remove exit(0) from minigzip.c, example.c -- Get rid of all those darn tabs -- Add "check" target to Makefile.in that does the same thing as "test" -- Add "mostlyclean" and "maintainer-clean" targets to Makefile.in -- Update contrib/inflate86 [Anderson] -- Update contrib/testzlib, contrib/vstudio, contrib/minizip [Vollant] -- Add msdos and win32 directories with makefiles [Truta] -- More additions and improvements to the FAQ - -Changes in 1.2.0 (9 March 2003) -- New and improved inflate code - - About 20% faster - - Does not allocate 32K window unless and until needed - - Automatically detects and decompresses gzip streams - - Raw inflate no longer needs an extra dummy byte at end - - Added inflateBack functions using a callback interface--even faster - than inflate, useful for file utilities (gzip, zip) - - Added inflateCopy() function to record state for random access on - externally generated deflate streams (e.g. in gzip files) - - More readable code (I hope) -- New and improved crc32() - - About 50% faster, thanks to suggestions from Rodney Brown -- Add deflateBound() and compressBound() functions -- Fix memory leak in deflateInit2() -- Permit setting dictionary for raw deflate (for parallel deflate) -- Fix const declaration for gzwrite() -- Check for some malloc() failures in gzio.c -- Fix bug in gzopen() on single-byte file 0x1f -- Fix bug in gzread() on concatenated file with 0x1f at end of buffer - and next buffer doesn't start with 0x8b -- Fix uncompress() to return Z_DATA_ERROR on truncated input -- Free memory at end of example.c -- Remove MAX #define in trees.c (conflicted with some libraries) -- Fix static const's in deflate.c, gzio.c, and zutil.[ch] -- Declare malloc() and free() in gzio.c if STDC not defined -- Use malloc() instead of calloc() in zutil.c if int big enough -- Define STDC for AIX -- Add aix/ with approach for compiling shared library on AIX -- Add HP-UX support for shared libraries in configure -- Add OpenUNIX support for shared libraries in configure -- Use $cc instead of gcc to build shared library -- Make prefix directory if needed when installing -- Correct Macintosh avoidance of typedef Byte in zconf.h -- Correct Turbo C memory allocation when under Linux -- Use libz.a instead of -lz in Makefile (assure use of compiled library) -- Update configure to check for snprintf or vsnprintf functions and their - return value, warn during make if using an insecure function -- Fix configure problem with compile-time knowledge of HAVE_UNISTD_H that - is lost when library is used--resolution is to build new zconf.h -- Documentation improvements (in zlib.h): - - Document raw deflate and inflate - - Update RFCs URL - - Point out that zlib and gzip formats are different - - Note that Z_BUF_ERROR is not fatal - - Document string limit for gzprintf() and possible buffer overflow - - Note requirement on avail_out when flushing - - Note permitted values of flush parameter of inflate() -- Add some FAQs (and even answers) to the FAQ -- Add contrib/inflate86/ for x86 faster inflate -- Add contrib/blast/ for PKWare Data Compression Library decompression -- Add contrib/puff/ simple inflate for deflate format description - -Changes in 1.1.4 (11 March 2002) -- ZFREE was repeated on same allocation on some error conditions. - This creates a security problem described in - http://www.zlib.org/advisory-2002-03-11.txt -- Returned incorrect error (Z_MEM_ERROR) on some invalid data -- Avoid accesses before window for invalid distances with inflate window - less than 32K. -- force windowBits > 8 to avoid a bug in the encoder for a window size - of 256 bytes. (A complete fix will be available in 1.1.5). - -Changes in 1.1.3 (9 July 1998) -- fix "an inflate input buffer bug that shows up on rare but persistent - occasions" (Mark) -- fix gzread and gztell for concatenated .gz files (Didier Le Botlan) -- fix gzseek(..., SEEK_SET) in write mode -- fix crc check after a gzeek (Frank Faubert) -- fix miniunzip when the last entry in a zip file is itself a zip file - (J Lillge) -- add contrib/asm586 and contrib/asm686 (Brian Raiter) - See http://www.muppetlabs.com/~breadbox/software/assembly.html -- add support for Delphi 3 in contrib/delphi (Bob Dellaca) -- add support for C++Builder 3 and Delphi 3 in contrib/delphi2 (Davide Moretti) -- do not exit prematurely in untgz if 0 at start of block (Magnus Holmgren) -- use macro EXTERN instead of extern to support DLL for BeOS (Sander Stoks) -- added a FAQ file - -- Support gzdopen on Mac with Metrowerks (Jason Linhart) -- Do not redefine Byte on Mac (Brad Pettit & Jason Linhart) -- define SEEK_END too if SEEK_SET is not defined (Albert Chin-A-Young) -- avoid some warnings with Borland C (Tom Tanner) -- fix a problem in contrib/minizip/zip.c for 16-bit MSDOS (Gilles Vollant) -- emulate utime() for WIN32 in contrib/untgz (Gilles Vollant) -- allow several arguments to configure (Tim Mooney, Frodo Looijaard) -- use libdir and includedir in Makefile.in (Tim Mooney) -- support shared libraries on OSF1 V4 (Tim Mooney) -- remove so_locations in "make clean" (Tim Mooney) -- fix maketree.c compilation error (Glenn, Mark) -- Python interface to zlib now in Python 1.5 (Jeremy Hylton) -- new Makefile.riscos (Rich Walker) -- initialize static descriptors in trees.c for embedded targets (Nick Smith) -- use "foo-gz" in example.c for RISCOS and VMS (Nick Smith) -- add the OS/2 files in Makefile.in too (Andrew Zabolotny) -- fix fdopen and halloc macros for Microsoft C 6.0 (Tom Lane) -- fix maketree.c to allow clean compilation of inffixed.h (Mark) -- fix parameter check in deflateCopy (Gunther Nikl) -- cleanup trees.c, use compressed_len only in debug mode (Christian Spieler) -- Many portability patches by Christian Spieler: - . zutil.c, zutil.h: added "const" for zmem* - . Make_vms.com: fixed some typos - . Make_vms.com: msdos/Makefile.*: removed zutil.h from some dependency lists - . msdos/Makefile.msc: remove "default rtl link library" info from obj files - . msdos/Makefile.*: use model-dependent name for the built zlib library - . msdos/Makefile.emx, nt/Makefile.emx, nt/Makefile.gcc: - new makefiles, for emx (DOS/OS2), emx&rsxnt and mingw32 (Windows 9x / NT) -- use define instead of typedef for Bytef also for MSC small/medium (Tom Lane) -- replace __far with _far for better portability (Christian Spieler, Tom Lane) -- fix test for errno.h in configure (Tim Newsham) - -Changes in 1.1.2 (19 March 98) -- added contrib/minzip, mini zip and unzip based on zlib (Gilles Vollant) - See http://www.winimage.com/zLibDll/unzip.html -- preinitialize the inflate tables for fixed codes, to make the code - completely thread safe (Mark) -- some simplifications and slight speed-up to the inflate code (Mark) -- fix gzeof on non-compressed files (Allan Schrum) -- add -std1 option in configure for OSF1 to fix gzprintf (Martin Mokrejs) -- use default value of 4K for Z_BUFSIZE for 16-bit MSDOS (Tim Wegner + Glenn) -- added os2/Makefile.def and os2/zlib.def (Andrew Zabolotny) -- add shared lib support for UNIX_SV4.2MP (MATSUURA Takanori) -- do not wrap extern "C" around system includes (Tom Lane) -- mention zlib binding for TCL in README (Andreas Kupries) -- added amiga/Makefile.pup for Amiga powerUP SAS/C PPC (Andreas Kleinert) -- allow "make install prefix=..." even after configure (Glenn Randers-Pehrson) -- allow "configure --prefix $HOME" (Tim Mooney) -- remove warnings in example.c and gzio.c (Glenn Randers-Pehrson) -- move Makefile.sas to amiga/Makefile.sas - -Changes in 1.1.1 (27 Feb 98) -- fix macros _tr_tally_* in deflate.h for debug mode (Glenn Randers-Pehrson) -- remove block truncation heuristic which had very marginal effect for zlib - (smaller lit_bufsize than in gzip 1.2.4) and degraded a little the - compression ratio on some files. This also allows inlining _tr_tally for - matches in deflate_slow. -- added msdos/Makefile.w32 for WIN32 Microsoft Visual C++ (Bob Frazier) - -Changes in 1.1.0 (24 Feb 98) -- do not return STREAM_END prematurely in inflate (John Bowler) -- revert to the zlib 1.0.8 inflate to avoid the gcc 2.8.0 bug (Jeremy Buhler) -- compile with -DFASTEST to get compression code optimized for speed only -- in minigzip, try mmap'ing the input file first (Miguel Albrecht) -- increase size of I/O buffers in minigzip.c and gzio.c (not a big gain - on Sun but significant on HP) - -- add a pointer to experimental unzip library in README (Gilles Vollant) -- initialize variable gcc in configure (Chris Herborth) - -Changes in 1.0.9 (17 Feb 1998) -- added gzputs and gzgets functions -- do not clear eof flag in gzseek (Mark Diekhans) -- fix gzseek for files in transparent mode (Mark Diekhans) -- do not assume that vsprintf returns the number of bytes written (Jens Krinke) -- replace EXPORT with ZEXPORT to avoid conflict with other programs -- added compress2 in zconf.h, zlib.def, zlib.dnt -- new asm code from Gilles Vollant in contrib/asm386 -- simplify the inflate code (Mark): - . Replace ZALLOC's in huft_build() with single ZALLOC in inflate_blocks_new() - . ZALLOC the length list in inflate_trees_fixed() instead of using stack - . ZALLOC the value area for huft_build() instead of using stack - . Simplify Z_FINISH check in inflate() - -- Avoid gcc 2.8.0 comparison bug a little differently than zlib 1.0.8 -- in inftrees.c, avoid cc -O bug on HP (Farshid Elahi) -- in zconf.h move the ZLIB_DLL stuff earlier to avoid problems with - the declaration of FAR (Gilles VOllant) -- install libz.so* with mode 755 (executable) instead of 644 (Marc Lehmann) -- read_buf buf parameter of type Bytef* instead of charf* -- zmemcpy parameters are of type Bytef*, not charf* (Joseph Strout) -- do not redeclare unlink in minigzip.c for WIN32 (John Bowler) -- fix check for presence of directories in "make install" (Ian Willis) - -Changes in 1.0.8 (27 Jan 1998) -- fixed offsets in contrib/asm386/gvmat32.asm (Gilles Vollant) -- fix gzgetc and gzputc for big endian systems (Markus Oberhumer) -- added compress2() to allow setting the compression level -- include sys/types.h to get off_t on some systems (Marc Lehmann & QingLong) -- use constant arrays for the static trees in trees.c instead of computing - them at run time (thanks to Ken Raeburn for this suggestion). To create - trees.h, compile with GEN_TREES_H and run "make test". -- check return code of example in "make test" and display result -- pass minigzip command line options to file_compress -- simplifying code of inflateSync to avoid gcc 2.8 bug - -- support CC="gcc -Wall" in configure -s (QingLong) -- avoid a flush caused by ftell in gzopen for write mode (Ken Raeburn) -- fix test for shared library support to avoid compiler warnings -- zlib.lib -> zlib.dll in msdos/zlib.rc (Gilles Vollant) -- check for TARGET_OS_MAC in addition to MACOS (Brad Pettit) -- do not use fdopen for Metrowerks on Mac (Brad Pettit)) -- add checks for gzputc and gzputc in example.c -- avoid warnings in gzio.c and deflate.c (Andreas Kleinert) -- use const for the CRC table (Ken Raeburn) -- fixed "make uninstall" for shared libraries -- use Tracev instead of Trace in infblock.c -- in example.c use correct compressed length for test_sync -- suppress +vnocompatwarnings in configure for HPUX (not always supported) - -Changes in 1.0.7 (20 Jan 1998) -- fix gzseek which was broken in write mode -- return error for gzseek to negative absolute position -- fix configure for Linux (Chun-Chung Chen) -- increase stack space for MSC (Tim Wegner) -- get_crc_table and inflateSyncPoint are EXPORTed (Gilles Vollant) -- define EXPORTVA for gzprintf (Gilles Vollant) -- added man page zlib.3 (Rick Rodgers) -- for contrib/untgz, fix makedir() and improve Makefile - -- check gzseek in write mode in example.c -- allocate extra buffer for seeks only if gzseek is actually called -- avoid signed/unsigned comparisons (Tim Wegner, Gilles Vollant) -- add inflateSyncPoint in zconf.h -- fix list of exported functions in nt/zlib.dnt and mdsos/zlib.def - -Changes in 1.0.6 (19 Jan 1998) -- add functions gzprintf, gzputc, gzgetc, gztell, gzeof, gzseek, gzrewind and - gzsetparams (thanks to Roland Giersig and Kevin Ruland for some of this code) -- Fix a deflate bug occurring only with compression level 0 (thanks to - Andy Buckler for finding this one). -- In minigzip, pass transparently also the first byte for .Z files. -- return Z_BUF_ERROR instead of Z_OK if output buffer full in uncompress() -- check Z_FINISH in inflate (thanks to Marc Schluper) -- Implement deflateCopy (thanks to Adam Costello) -- make static libraries by default in configure, add --shared option. -- move MSDOS or Windows specific files to directory msdos -- suppress the notion of partial flush to simplify the interface - (but the symbol Z_PARTIAL_FLUSH is kept for compatibility with 1.0.4) -- suppress history buffer provided by application to simplify the interface - (this feature was not implemented anyway in 1.0.4) -- next_in and avail_in must be initialized before calling inflateInit or - inflateInit2 -- add EXPORT in all exported functions (for Windows DLL) -- added Makefile.nt (thanks to Stephen Williams) -- added the unsupported "contrib" directory: - contrib/asm386/ by Gilles Vollant - 386 asm code replacing longest_match(). - contrib/iostream/ by Kevin Ruland - A C++ I/O streams interface to the zlib gz* functions - contrib/iostream2/ by Tyge Løvset - Another C++ I/O streams interface - contrib/untgz/ by "Pedro A. Aranda Guti\irrez" - A very simple tar.gz file extractor using zlib - contrib/visual-basic.txt by Carlos Rios - How to use compress(), uncompress() and the gz* functions from VB. -- pass params -f (filtered data), -h (huffman only), -1 to -9 (compression - level) in minigzip (thanks to Tom Lane) - -- use const for rommable constants in deflate -- added test for gzseek and gztell in example.c -- add undocumented function inflateSyncPoint() (hack for Paul Mackerras) -- add undocumented function zError to convert error code to string - (for Tim Smithers) -- Allow compilation of gzio with -DNO_DEFLATE to avoid the compression code. -- Use default memcpy for Symantec MSDOS compiler. -- Add EXPORT keyword for check_func (needed for Windows DLL) -- add current directory to LD_LIBRARY_PATH for "make test" -- create also a link for libz.so.1 -- added support for FUJITSU UXP/DS (thanks to Toshiaki Nomura) -- use $(SHAREDLIB) instead of libz.so in Makefile.in (for HPUX) -- added -soname for Linux in configure (Chun-Chung Chen, -- assign numbers to the exported functions in zlib.def (for Windows DLL) -- add advice in zlib.h for best usage of deflateSetDictionary -- work around compiler bug on Atari (cast Z_NULL in call of s->checkfn) -- allow compilation with ANSI keywords only enabled for TurboC in large model -- avoid "versionString"[0] (Borland bug) -- add NEED_DUMMY_RETURN for Borland -- use variable z_verbose for tracing in debug mode (L. Peter Deutsch). -- allow compilation with CC -- defined STDC for OS/2 (David Charlap) -- limit external names to 8 chars for MVS (Thomas Lund) -- in minigzip.c, use static buffers only for 16-bit systems -- fix suffix check for "minigzip -d foo.gz" -- do not return an error for the 2nd of two consecutive gzflush() (Felix Lee) -- use _fdopen instead of fdopen for MSC >= 6.0 (Thomas Fanslau) -- added makelcc.bat for lcc-win32 (Tom St Denis) -- in Makefile.dj2, use copy and del instead of install and rm (Frank Donahoe) -- Avoid expanded $Id$. Use "rcs -kb" or "cvs admin -kb" to avoid Id expansion. -- check for unistd.h in configure (for off_t) -- remove useless check parameter in inflate_blocks_free -- avoid useless assignment of s->check to itself in inflate_blocks_new -- do not flush twice in gzclose (thanks to Ken Raeburn) -- rename FOPEN as F_OPEN to avoid clash with /usr/include/sys/file.h -- use NO_ERRNO_H instead of enumeration of operating systems with errno.h -- work around buggy fclose on pipes for HP/UX -- support zlib DLL with BORLAND C++ 5.0 (thanks to Glenn Randers-Pehrson) -- fix configure if CC is already equal to gcc - -Changes in 1.0.5 (3 Jan 98) -- Fix inflate to terminate gracefully when fed corrupted or invalid data -- Use const for rommable constants in inflate -- Eliminate memory leaks on error conditions in inflate -- Removed some vestigial code in inflate -- Update web address in README - -Changes in 1.0.4 (24 Jul 96) -- In very rare conditions, deflate(s, Z_FINISH) could fail to produce an EOF - bit, so the decompressor could decompress all the correct data but went - on to attempt decompressing extra garbage data. This affected minigzip too. -- zlibVersion and gzerror return const char* (needed for DLL) -- port to RISCOS (no fdopen, no multiple dots, no unlink, no fileno) -- use z_error only for DEBUG (avoid problem with DLLs) - -Changes in 1.0.3 (2 Jul 96) -- use z_streamp instead of z_stream *, which is now a far pointer in MSDOS - small and medium models; this makes the library incompatible with previous - versions for these models. (No effect in large model or on other systems.) -- return OK instead of BUF_ERROR if previous deflate call returned with - avail_out as zero but there is nothing to do -- added memcmp for non STDC compilers -- define NO_DUMMY_DECL for more Mac compilers (.h files merged incorrectly) -- define __32BIT__ if __386__ or i386 is defined (pb. with Watcom and SCO) -- better check for 16-bit mode MSC (avoids problem with Symantec) - -Changes in 1.0.2 (23 May 96) -- added Windows DLL support -- added a function zlibVersion (for the DLL support) -- fixed declarations using Bytef in infutil.c (pb with MSDOS medium model) -- Bytef is define's instead of typedef'd only for Borland C -- avoid reading uninitialized memory in example.c -- mention in README that the zlib format is now RFC1950 -- updated Makefile.dj2 -- added algorithm.doc - -Changes in 1.0.1 (20 May 96) [1.0 skipped to avoid confusion] -- fix array overlay in deflate.c which sometimes caused bad compressed data -- fix inflate bug with empty stored block -- fix MSDOS medium model which was broken in 0.99 -- fix deflateParams() which could generated bad compressed data. -- Bytef is define'd instead of typedef'ed (work around Borland bug) -- added an INDEX file -- new makefiles for DJGPP (Makefile.dj2), 32-bit Borland (Makefile.b32), - Watcom (Makefile.wat), Amiga SAS/C (Makefile.sas) -- speed up adler32 for modern machines without auto-increment -- added -ansi for IRIX in configure -- static_init_done in trees.c is an int -- define unlink as delete for VMS -- fix configure for QNX -- add configure branch for SCO and HPUX -- avoid many warnings (unused variables, dead assignments, etc...) -- no fdopen for BeOS -- fix the Watcom fix for 32 bit mode (define FAR as empty) -- removed redefinition of Byte for MKWERKS -- work around an MWKERKS bug (incorrect merge of all .h files) - -Changes in 0.99 (27 Jan 96) -- allow preset dictionary shared between compressor and decompressor -- allow compression level 0 (no compression) -- add deflateParams in zlib.h: allow dynamic change of compression level - and compression strategy. -- test large buffers and deflateParams in example.c -- add optional "configure" to build zlib as a shared library -- suppress Makefile.qnx, use configure instead -- fixed deflate for 64-bit systems (detected on Cray) -- fixed inflate_blocks for 64-bit systems (detected on Alpha) -- declare Z_DEFLATED in zlib.h (possible parameter for deflateInit2) -- always return Z_BUF_ERROR when deflate() has nothing to do -- deflateInit and inflateInit are now macros to allow version checking -- prefix all global functions and types with z_ with -DZ_PREFIX -- make falloc completely reentrant (inftrees.c) -- fixed very unlikely race condition in ct_static_init -- free in reverse order of allocation to help memory manager -- use zlib-1.0/* instead of zlib/* inside the tar.gz -- make zlib warning-free with "gcc -O3 -Wall -Wwrite-strings -Wpointer-arith - -Wconversion -Wstrict-prototypes -Wmissing-prototypes" -- allow gzread on concatenated .gz files -- deflateEnd now returns Z_DATA_ERROR if it was premature -- deflate is finally (?) fully deterministic (no matches beyond end of input) -- Document Z_SYNC_FLUSH -- add uninstall in Makefile -- Check for __cpluplus in zlib.h -- Better test in ct_align for partial flush -- avoid harmless warnings for Borland C++ -- initialize hash_head in deflate.c -- avoid warning on fdopen (gzio.c) for HP cc -Aa -- include stdlib.h for STDC compilers -- include errno.h for Cray -- ignore error if ranlib doesn't exist -- call ranlib twice for NeXTSTEP -- use exec_prefix instead of prefix for libz.a -- renamed ct_* as _tr_* to avoid conflict with applications -- clear z->msg in inflateInit2 before any error return -- initialize opaque in example.c, gzio.c, deflate.c and inflate.c -- fixed typo in zconf.h (_GNUC__ => __GNUC__) -- check for WIN32 in zconf.h and zutil.c (avoid farmalloc in 32-bit mode) -- fix typo in Make_vms.com (f$trnlnm -> f$getsyi) -- in fcalloc, normalize pointer if size > 65520 bytes -- don't use special fcalloc for 32 bit Borland C++ -- use STDC instead of __GO32__ to avoid redeclaring exit, calloc, etc... -- use Z_BINARY instead of BINARY -- document that gzclose after gzdopen will close the file -- allow "a" as mode in gzopen. -- fix error checking in gzread -- allow skipping .gz extra-field on pipes -- added reference to Perl interface in README -- put the crc table in FAR data (I dislike more and more the medium model :) -- added get_crc_table -- added a dimension to all arrays (Borland C can't count). -- workaround Borland C bug in declaration of inflate_codes_new & inflate_fast -- guard against multiple inclusion of *.h (for precompiled header on Mac) -- Watcom C pretends to be Microsoft C small model even in 32 bit mode. -- don't use unsized arrays to avoid silly warnings by Visual C++: - warning C4746: 'inflate_mask' : unsized array treated as '__far' - (what's wrong with far data in far model?). -- define enum out of inflate_blocks_state to allow compilation with C++ - -Changes in 0.95 (16 Aug 95) -- fix MSDOS small and medium model (now easier to adapt to any compiler) -- inlined send_bits -- fix the final (:-) bug for deflate with flush (output was correct but - not completely flushed in rare occasions). -- default window size is same for compression and decompression - (it's now sufficient to set MAX_WBITS in zconf.h). -- voidp -> voidpf and voidnp -> voidp (for consistency with other - typedefs and because voidnp was not near in large model). - -Changes in 0.94 (13 Aug 95) -- support MSDOS medium model -- fix deflate with flush (could sometimes generate bad output) -- fix deflateReset (zlib header was incorrectly suppressed) -- added support for VMS -- allow a compression level in gzopen() -- gzflush now calls fflush -- For deflate with flush, flush even if no more input is provided. -- rename libgz.a as libz.a -- avoid complex expression in infcodes.c triggering Turbo C bug -- work around a problem with gcc on Alpha (in INSERT_STRING) -- don't use inline functions (problem with some gcc versions) -- allow renaming of Byte, uInt, etc... with #define. -- avoid warning about (unused) pointer before start of array in deflate.c -- avoid various warnings in gzio.c, example.c, infblock.c, adler32.c, zutil.c -- avoid reserved word 'new' in trees.c - -Changes in 0.93 (25 June 95) -- temporarily disable inline functions -- make deflate deterministic -- give enough lookahead for PARTIAL_FLUSH -- Set binary mode for stdin/stdout in minigzip.c for OS/2 -- don't even use signed char in inflate (not portable enough) -- fix inflate memory leak for segmented architectures - -Changes in 0.92 (3 May 95) -- don't assume that char is signed (problem on SGI) -- Clear bit buffer when starting a stored block -- no memcpy on Pyramid -- suppressed inftest.c -- optimized fill_window, put longest_match inline for gcc -- optimized inflate on stored blocks. -- untabify all sources to simplify patches - -Changes in 0.91 (2 May 95) -- Default MEM_LEVEL is 8 (not 9 for Unix) as documented in zlib.h -- Document the memory requirements in zconf.h -- added "make install" -- fix sync search logic in inflateSync -- deflate(Z_FULL_FLUSH) now works even if output buffer too short -- after inflateSync, don't scare people with just "lo world" -- added support for DJGPP - -Changes in 0.9 (1 May 95) -- don't assume that zalloc clears the allocated memory (the TurboC bug - was Mark's bug after all :) -- let again gzread copy uncompressed data unchanged (was working in 0.71) -- deflate(Z_FULL_FLUSH), inflateReset and inflateSync are now fully implemented -- added a test of inflateSync in example.c -- moved MAX_WBITS to zconf.h because users might want to change that. -- document explicitly that zalloc(64K) on MSDOS must return a normalized - pointer (zero offset) -- added Makefiles for Microsoft C, Turbo C, Borland C++ -- faster crc32() - -Changes in 0.8 (29 April 95) -- added fast inflate (inffast.c) -- deflate(Z_FINISH) now returns Z_STREAM_END when done. Warning: this - is incompatible with previous versions of zlib which returned Z_OK. -- work around a TurboC compiler bug (bad code for b << 0, see infutil.h) - (actually that was not a compiler bug, see 0.81 above) -- gzread no longer reads one extra byte in certain cases -- In gzio destroy(), don't reference a freed structure -- avoid many warnings for MSDOS -- avoid the ERROR symbol which is used by MS Windows - -Changes in 0.71 (14 April 95) -- Fixed more MSDOS compilation problems :( There is still a bug with - TurboC large model. - -Changes in 0.7 (14 April 95) -- Added full inflate support. -- Simplified the crc32() interface. The pre- and post-conditioning - (one's complement) is now done inside crc32(). WARNING: this is - incompatible with previous versions; see zlib.h for the new usage. - -Changes in 0.61 (12 April 95) -- workaround for a bug in TurboC. example and minigzip now work on MSDOS. - -Changes in 0.6 (11 April 95) -- added minigzip.c -- added gzdopen to reopen a file descriptor as gzFile -- added transparent reading of non-gziped files in gzread. -- fixed bug in gzread (don't read crc as data) -- fixed bug in destroy (gzio.c) (don't return Z_STREAM_END for gzclose). -- don't allocate big arrays in the stack (for MSDOS) -- fix some MSDOS compilation problems - -Changes in 0.5: -- do real compression in deflate.c. Z_PARTIAL_FLUSH is supported but - not yet Z_FULL_FLUSH. -- support decompression but only in a single step (forced Z_FINISH) -- added opaque object for zalloc and zfree. -- added deflateReset and inflateReset -- added a variable zlib_version for consistency checking. -- renamed the 'filter' parameter of deflateInit2 as 'strategy'. - Added Z_FILTERED and Z_HUFFMAN_ONLY constants. - -Changes in 0.4: -- avoid "zip" everywhere, use zlib instead of ziplib. -- suppress Z_BLOCK_FLUSH, interpret Z_PARTIAL_FLUSH as block flush - if compression method == 8. -- added adler32 and crc32 -- renamed deflateOptions as deflateInit2, call one or the other but not both -- added the method parameter for deflateInit2. -- added inflateInit2 -- simplied considerably deflateInit and inflateInit by not supporting - user-provided history buffer. This is supported only in deflateInit2 - and inflateInit2. - -Changes in 0.3: -- prefix all macro names with Z_ -- use Z_FINISH instead of deflateEnd to finish compression. -- added Z_HUFFMAN_ONLY -- added gzerror() diff --git a/dependencies/zlib/adler32.c b/dependencies/zlib/adler32.c deleted file mode 100644 index f201d670..00000000 --- a/dependencies/zlib/adler32.c +++ /dev/null @@ -1,149 +0,0 @@ -/* adler32.c -- compute the Adler-32 checksum of a data stream - * Copyright (C) 1995-2004 Mark Adler - * For conditions of distribution and use, see copyright notice in zlib.h - */ - -/* @(#) $Id$ */ - -#define ZLIB_INTERNAL -#include "zlib.h" - -#define BASE 65521UL /* largest prime smaller than 65536 */ -#define NMAX 5552 -/* NMAX is the largest n such that 255n(n+1)/2 + (n+1)(BASE-1) <= 2^32-1 */ - -#define DO1(buf,i) {adler += (buf)[i]; sum2 += adler;} -#define DO2(buf,i) DO1(buf,i); DO1(buf,i+1); -#define DO4(buf,i) DO2(buf,i); DO2(buf,i+2); -#define DO8(buf,i) DO4(buf,i); DO4(buf,i+4); -#define DO16(buf) DO8(buf,0); DO8(buf,8); - -/* use NO_DIVIDE if your processor does not do division in hardware */ -#ifdef NO_DIVIDE -# define MOD(a) \ - do { \ - if (a >= (BASE << 16)) a -= (BASE << 16); \ - if (a >= (BASE << 15)) a -= (BASE << 15); \ - if (a >= (BASE << 14)) a -= (BASE << 14); \ - if (a >= (BASE << 13)) a -= (BASE << 13); \ - if (a >= (BASE << 12)) a -= (BASE << 12); \ - if (a >= (BASE << 11)) a -= (BASE << 11); \ - if (a >= (BASE << 10)) a -= (BASE << 10); \ - if (a >= (BASE << 9)) a -= (BASE << 9); \ - if (a >= (BASE << 8)) a -= (BASE << 8); \ - if (a >= (BASE << 7)) a -= (BASE << 7); \ - if (a >= (BASE << 6)) a -= (BASE << 6); \ - if (a >= (BASE << 5)) a -= (BASE << 5); \ - if (a >= (BASE << 4)) a -= (BASE << 4); \ - if (a >= (BASE << 3)) a -= (BASE << 3); \ - if (a >= (BASE << 2)) a -= (BASE << 2); \ - if (a >= (BASE << 1)) a -= (BASE << 1); \ - if (a >= BASE) a -= BASE; \ - } while (0) -# define MOD4(a) \ - do { \ - if (a >= (BASE << 4)) a -= (BASE << 4); \ - if (a >= (BASE << 3)) a -= (BASE << 3); \ - if (a >= (BASE << 2)) a -= (BASE << 2); \ - if (a >= (BASE << 1)) a -= (BASE << 1); \ - if (a >= BASE) a -= BASE; \ - } while (0) -#else -# define MOD(a) a %= BASE -# define MOD4(a) a %= BASE -#endif - -/* ========================================================================= */ -uLong ZEXPORT adler32(adler, buf, len) - uLong adler; - const Bytef *buf; - uInt len; -{ - unsigned long sum2; - unsigned n; - - /* split Adler-32 into component sums */ - sum2 = (adler >> 16) & 0xffff; - adler &= 0xffff; - - /* in case user likes doing a byte at a time, keep it fast */ - if (len == 1) { - adler += buf[0]; - if (adler >= BASE) - adler -= BASE; - sum2 += adler; - if (sum2 >= BASE) - sum2 -= BASE; - return adler | (sum2 << 16); - } - - /* initial Adler-32 value (deferred check for len == 1 speed) */ - if (buf == Z_NULL) - return 1L; - - /* in case short lengths are provided, keep it somewhat fast */ - if (len < 16) { - while (len--) { - adler += *buf++; - sum2 += adler; - } - if (adler >= BASE) - adler -= BASE; - MOD4(sum2); /* only added so many BASE's */ - return adler | (sum2 << 16); - } - - /* do length NMAX blocks -- requires just one modulo operation */ - while (len >= NMAX) { - len -= NMAX; - n = NMAX / 16; /* NMAX is divisible by 16 */ - do { - DO16(buf); /* 16 sums unrolled */ - buf += 16; - } while (--n); - MOD(adler); - MOD(sum2); - } - - /* do remaining bytes (less than NMAX, still just one modulo) */ - if (len) { /* avoid modulos if none remaining */ - while (len >= 16) { - len -= 16; - DO16(buf); - buf += 16; - } - while (len--) { - adler += *buf++; - sum2 += adler; - } - MOD(adler); - MOD(sum2); - } - - /* return recombined sums */ - return adler | (sum2 << 16); -} - -/* ========================================================================= */ -uLong ZEXPORT adler32_combine(adler1, adler2, len2) - uLong adler1; - uLong adler2; - z_off_t len2; -{ - unsigned long sum1; - unsigned long sum2; - unsigned rem; - - /* the derivation of this formula is left as an exercise for the reader */ - rem = (unsigned)(len2 % BASE); - sum1 = adler1 & 0xffff; - sum2 = rem * sum1; - MOD(sum2); - sum1 += (adler2 & 0xffff) + BASE - 1; - sum2 += ((adler1 >> 16) & 0xffff) + ((adler2 >> 16) & 0xffff) + BASE - rem; - if (sum1 > BASE) sum1 -= BASE; - if (sum1 > BASE) sum1 -= BASE; - if (sum2 > (BASE << 1)) sum2 -= (BASE << 1); - if (sum2 > BASE) sum2 -= BASE; - return sum1 | (sum2 << 16); -} diff --git a/dependencies/zlib/compress.c b/dependencies/zlib/compress.c deleted file mode 100644 index d37e84f5..00000000 --- a/dependencies/zlib/compress.c +++ /dev/null @@ -1,79 +0,0 @@ -/* compress.c -- compress a memory buffer - * Copyright (C) 1995-2003 Jean-loup Gailly. - * For conditions of distribution and use, see copyright notice in zlib.h - */ - -/* @(#) $Id$ */ - -#define ZLIB_INTERNAL -#include "zlib.h" - -/* =========================================================================== - Compresses the source buffer into the destination buffer. The level - parameter has the same meaning as in deflateInit. sourceLen is the byte - length of the source buffer. Upon entry, destLen is the total size of the - destination buffer, which must be at least 0.1% larger than sourceLen plus - 12 bytes. Upon exit, destLen is the actual size of the compressed buffer. - - compress2 returns Z_OK if success, Z_MEM_ERROR if there was not enough - memory, Z_BUF_ERROR if there was not enough room in the output buffer, - Z_STREAM_ERROR if the level parameter is invalid. -*/ -int ZEXPORT compress2 (dest, destLen, source, sourceLen, level) - Bytef *dest; - uLongf *destLen; - const Bytef *source; - uLong sourceLen; - int level; -{ - z_stream stream; - int err; - - stream.next_in = (Bytef*)source; - stream.avail_in = (uInt)sourceLen; -#ifdef MAXSEG_64K - /* Check for source > 64K on 16-bit machine: */ - if ((uLong)stream.avail_in != sourceLen) return Z_BUF_ERROR; -#endif - stream.next_out = dest; - stream.avail_out = (uInt)*destLen; - if ((uLong)stream.avail_out != *destLen) return Z_BUF_ERROR; - - stream.zalloc = (alloc_func)0; - stream.zfree = (free_func)0; - stream.opaque = (voidpf)0; - - err = deflateInit(&stream, level); - if (err != Z_OK) return err; - - err = deflate(&stream, Z_FINISH); - if (err != Z_STREAM_END) { - deflateEnd(&stream); - return err == Z_OK ? Z_BUF_ERROR : err; - } - *destLen = stream.total_out; - - err = deflateEnd(&stream); - return err; -} - -/* =========================================================================== - */ -int ZEXPORT compress (dest, destLen, source, sourceLen) - Bytef *dest; - uLongf *destLen; - const Bytef *source; - uLong sourceLen; -{ - return compress2(dest, destLen, source, sourceLen, Z_DEFAULT_COMPRESSION); -} - -/* =========================================================================== - If the default memLevel or windowBits for deflateInit() is changed, then - this function needs to be updated. - */ -uLong ZEXPORT compressBound (sourceLen) - uLong sourceLen; -{ - return sourceLen + (sourceLen >> 12) + (sourceLen >> 14) + 11; -} diff --git a/dependencies/zlib/crc32.c b/dependencies/zlib/crc32.c deleted file mode 100644 index 32814c20..00000000 --- a/dependencies/zlib/crc32.c +++ /dev/null @@ -1,423 +0,0 @@ -/* crc32.c -- compute the CRC-32 of a data stream - * Copyright (C) 1995-2005 Mark Adler - * For conditions of distribution and use, see copyright notice in zlib.h - * - * Thanks to Rodney Brown for his contribution of faster - * CRC methods: exclusive-oring 32 bits of data at a time, and pre-computing - * tables for updating the shift register in one step with three exclusive-ors - * instead of four steps with four exclusive-ors. This results in about a - * factor of two increase in speed on a Power PC G4 (PPC7455) using gcc -O3. - */ - -/* @(#) $Id$ */ - -/* - Note on the use of DYNAMIC_CRC_TABLE: there is no mutex or semaphore - protection on the static variables used to control the first-use generation - of the crc tables. Therefore, if you #define DYNAMIC_CRC_TABLE, you should - first call get_crc_table() to initialize the tables before allowing more than - one thread to use crc32(). - */ - -#ifdef MAKECRCH -# include -# ifndef DYNAMIC_CRC_TABLE -# define DYNAMIC_CRC_TABLE -# endif /* !DYNAMIC_CRC_TABLE */ -#endif /* MAKECRCH */ - -#include "zutil.h" /* for STDC and FAR definitions */ - -#define local static - -/* Find a four-byte integer type for crc32_little() and crc32_big(). */ -#ifndef NOBYFOUR -# ifdef STDC /* need ANSI C limits.h to determine sizes */ -# include -# define BYFOUR -# if (UINT_MAX == 0xffffffffUL) - typedef unsigned int u4; -# else -# if (ULONG_MAX == 0xffffffffUL) - typedef unsigned long u4; -# else -# if (USHRT_MAX == 0xffffffffUL) - typedef unsigned short u4; -# else -# undef BYFOUR /* can't find a four-byte integer type! */ -# endif -# endif -# endif -# endif /* STDC */ -#endif /* !NOBYFOUR */ - -/* Definitions for doing the crc four data bytes at a time. */ -#ifdef BYFOUR -# define REV(w) (((w)>>24)+(((w)>>8)&0xff00)+ \ - (((w)&0xff00)<<8)+(((w)&0xff)<<24)) - local unsigned long crc32_little OF((unsigned long, - const unsigned char FAR *, unsigned)); - local unsigned long crc32_big OF((unsigned long, - const unsigned char FAR *, unsigned)); -# define TBLS 8 -#else -# define TBLS 1 -#endif /* BYFOUR */ - -/* Local functions for crc concatenation */ -local unsigned long gf2_matrix_times OF((unsigned long *mat, - unsigned long vec)); -local void gf2_matrix_square OF((unsigned long *square, unsigned long *mat)); - -#ifdef DYNAMIC_CRC_TABLE - -local volatile int crc_table_empty = 1; -local unsigned long FAR crc_table[TBLS][256]; -local void make_crc_table OF((void)); -#ifdef MAKECRCH - local void write_table OF((FILE *, const unsigned long FAR *)); -#endif /* MAKECRCH */ -/* - Generate tables for a byte-wise 32-bit CRC calculation on the polynomial: - x^32+x^26+x^23+x^22+x^16+x^12+x^11+x^10+x^8+x^7+x^5+x^4+x^2+x+1. - - Polynomials over GF(2) are represented in binary, one bit per coefficient, - with the lowest powers in the most significant bit. Then adding polynomials - is just exclusive-or, and multiplying a polynomial by x is a right shift by - one. If we call the above polynomial p, and represent a byte as the - polynomial q, also with the lowest power in the most significant bit (so the - byte 0xb1 is the polynomial x^7+x^3+x+1), then the CRC is (q*x^32) mod p, - where a mod b means the remainder after dividing a by b. - - This calculation is done using the shift-register method of multiplying and - taking the remainder. The register is initialized to zero, and for each - incoming bit, x^32 is added mod p to the register if the bit is a one (where - x^32 mod p is p+x^32 = x^26+...+1), and the register is multiplied mod p by - x (which is shifting right by one and adding x^32 mod p if the bit shifted - out is a one). We start with the highest power (least significant bit) of - q and repeat for all eight bits of q. - - The first table is simply the CRC of all possible eight bit values. This is - all the information needed to generate CRCs on data a byte at a time for all - combinations of CRC register values and incoming bytes. The remaining tables - allow for word-at-a-time CRC calculation for both big-endian and little- - endian machines, where a word is four bytes. -*/ -local void make_crc_table() -{ - unsigned long c; - int n, k; - unsigned long poly; /* polynomial exclusive-or pattern */ - /* terms of polynomial defining this crc (except x^32): */ - static volatile int first = 1; /* flag to limit concurrent making */ - static const unsigned char p[] = {0,1,2,4,5,7,8,10,11,12,16,22,23,26}; - - /* See if another task is already doing this (not thread-safe, but better - than nothing -- significantly reduces duration of vulnerability in - case the advice about DYNAMIC_CRC_TABLE is ignored) */ - if (first) { - first = 0; - - /* make exclusive-or pattern from polynomial (0xedb88320UL) */ - poly = 0UL; - for (n = 0; n < sizeof(p)/sizeof(unsigned char); n++) - poly |= 1UL << (31 - p[n]); - - /* generate a crc for every 8-bit value */ - for (n = 0; n < 256; n++) { - c = (unsigned long)n; - for (k = 0; k < 8; k++) - c = c & 1 ? poly ^ (c >> 1) : c >> 1; - crc_table[0][n] = c; - } - -#ifdef BYFOUR - /* generate crc for each value followed by one, two, and three zeros, - and then the byte reversal of those as well as the first table */ - for (n = 0; n < 256; n++) { - c = crc_table[0][n]; - crc_table[4][n] = REV(c); - for (k = 1; k < 4; k++) { - c = crc_table[0][c & 0xff] ^ (c >> 8); - crc_table[k][n] = c; - crc_table[k + 4][n] = REV(c); - } - } -#endif /* BYFOUR */ - - crc_table_empty = 0; - } - else { /* not first */ - /* wait for the other guy to finish (not efficient, but rare) */ - while (crc_table_empty) - ; - } - -#ifdef MAKECRCH - /* write out CRC tables to crc32.h */ - { - FILE *out; - - out = fopen("crc32.h", "w"); - if (out == NULL) return; - fprintf(out, "/* crc32.h -- tables for rapid CRC calculation\n"); - fprintf(out, " * Generated automatically by crc32.c\n */\n\n"); - fprintf(out, "local const unsigned long FAR "); - fprintf(out, "crc_table[TBLS][256] =\n{\n {\n"); - write_table(out, crc_table[0]); -# ifdef BYFOUR - fprintf(out, "#ifdef BYFOUR\n"); - for (k = 1; k < 8; k++) { - fprintf(out, " },\n {\n"); - write_table(out, crc_table[k]); - } - fprintf(out, "#endif\n"); -# endif /* BYFOUR */ - fprintf(out, " }\n};\n"); - fclose(out); - } -#endif /* MAKECRCH */ -} - -#ifdef MAKECRCH -local void write_table(out, table) - FILE *out; - const unsigned long FAR *table; -{ - int n; - - for (n = 0; n < 256; n++) - fprintf(out, "%s0x%08lxUL%s", n % 5 ? "" : " ", table[n], - n == 255 ? "\n" : (n % 5 == 4 ? ",\n" : ", ")); -} -#endif /* MAKECRCH */ - -#else /* !DYNAMIC_CRC_TABLE */ -/* ======================================================================== - * Tables of CRC-32s of all single-byte values, made by make_crc_table(). - */ -#include "crc32.h" -#endif /* DYNAMIC_CRC_TABLE */ - -/* ========================================================================= - * This function can be used by asm versions of crc32() - */ -const unsigned long FAR * ZEXPORT get_crc_table() -{ -#ifdef DYNAMIC_CRC_TABLE - if (crc_table_empty) - make_crc_table(); -#endif /* DYNAMIC_CRC_TABLE */ - return (const unsigned long FAR *)crc_table; -} - -/* ========================================================================= */ -#define DO1 crc = crc_table[0][((int)crc ^ (*buf++)) & 0xff] ^ (crc >> 8) -#define DO8 DO1; DO1; DO1; DO1; DO1; DO1; DO1; DO1 - -/* ========================================================================= */ -unsigned long ZEXPORT crc32(crc, buf, len) - unsigned long crc; - const unsigned char FAR *buf; - unsigned len; -{ - if (buf == Z_NULL) return 0UL; - -#ifdef DYNAMIC_CRC_TABLE - if (crc_table_empty) - make_crc_table(); -#endif /* DYNAMIC_CRC_TABLE */ - -#ifdef BYFOUR - if (sizeof(void *) == sizeof(ptrdiff_t)) { - u4 endian; - - endian = 1; - if (*((unsigned char *)(&endian))) - return crc32_little(crc, buf, len); - else - return crc32_big(crc, buf, len); - } -#endif /* BYFOUR */ - crc = crc ^ 0xffffffffUL; - while (len >= 8) { - DO8; - len -= 8; - } - if (len) do { - DO1; - } while (--len); - return crc ^ 0xffffffffUL; -} - -#ifdef BYFOUR - -/* ========================================================================= */ -#define DOLIT4 c ^= *buf4++; \ - c = crc_table[3][c & 0xff] ^ crc_table[2][(c >> 8) & 0xff] ^ \ - crc_table[1][(c >> 16) & 0xff] ^ crc_table[0][c >> 24] -#define DOLIT32 DOLIT4; DOLIT4; DOLIT4; DOLIT4; DOLIT4; DOLIT4; DOLIT4; DOLIT4 - -/* ========================================================================= */ -local unsigned long crc32_little(crc, buf, len) - unsigned long crc; - const unsigned char FAR *buf; - unsigned len; -{ - register u4 c; - register const u4 FAR *buf4; - - c = (u4)crc; - c = ~c; - while (len && ((ptrdiff_t)buf & 3)) { - c = crc_table[0][(c ^ *buf++) & 0xff] ^ (c >> 8); - len--; - } - - buf4 = (const u4 FAR *)(const void FAR *)buf; - while (len >= 32) { - DOLIT32; - len -= 32; - } - while (len >= 4) { - DOLIT4; - len -= 4; - } - buf = (const unsigned char FAR *)buf4; - - if (len) do { - c = crc_table[0][(c ^ *buf++) & 0xff] ^ (c >> 8); - } while (--len); - c = ~c; - return (unsigned long)c; -} - -/* ========================================================================= */ -#define DOBIG4 c ^= *++buf4; \ - c = crc_table[4][c & 0xff] ^ crc_table[5][(c >> 8) & 0xff] ^ \ - crc_table[6][(c >> 16) & 0xff] ^ crc_table[7][c >> 24] -#define DOBIG32 DOBIG4; DOBIG4; DOBIG4; DOBIG4; DOBIG4; DOBIG4; DOBIG4; DOBIG4 - -/* ========================================================================= */ -local unsigned long crc32_big(crc, buf, len) - unsigned long crc; - const unsigned char FAR *buf; - unsigned len; -{ - register u4 c; - register const u4 FAR *buf4; - - c = REV((u4)crc); - c = ~c; - while (len && ((ptrdiff_t)buf & 3)) { - c = crc_table[4][(c >> 24) ^ *buf++] ^ (c << 8); - len--; - } - - buf4 = (const u4 FAR *)(const void FAR *)buf; - buf4--; - while (len >= 32) { - DOBIG32; - len -= 32; - } - while (len >= 4) { - DOBIG4; - len -= 4; - } - buf4++; - buf = (const unsigned char FAR *)buf4; - - if (len) do { - c = crc_table[4][(c >> 24) ^ *buf++] ^ (c << 8); - } while (--len); - c = ~c; - return (unsigned long)(REV(c)); -} - -#endif /* BYFOUR */ - -#define GF2_DIM 32 /* dimension of GF(2) vectors (length of CRC) */ - -/* ========================================================================= */ -local unsigned long gf2_matrix_times(mat, vec) - unsigned long *mat; - unsigned long vec; -{ - unsigned long sum; - - sum = 0; - while (vec) { - if (vec & 1) - sum ^= *mat; - vec >>= 1; - mat++; - } - return sum; -} - -/* ========================================================================= */ -local void gf2_matrix_square(square, mat) - unsigned long *square; - unsigned long *mat; -{ - int n; - - for (n = 0; n < GF2_DIM; n++) - square[n] = gf2_matrix_times(mat, mat[n]); -} - -/* ========================================================================= */ -uLong ZEXPORT crc32_combine(crc1, crc2, len2) - uLong crc1; - uLong crc2; - z_off_t len2; -{ - int n; - unsigned long row; - unsigned long even[GF2_DIM]; /* even-power-of-two zeros operator */ - unsigned long odd[GF2_DIM]; /* odd-power-of-two zeros operator */ - - /* degenerate case */ - if (len2 == 0) - return crc1; - - /* put operator for one zero bit in odd */ - odd[0] = 0xedb88320L; /* CRC-32 polynomial */ - row = 1; - for (n = 1; n < GF2_DIM; n++) { - odd[n] = row; - row <<= 1; - } - - /* put operator for two zero bits in even */ - gf2_matrix_square(even, odd); - - /* put operator for four zero bits in odd */ - gf2_matrix_square(odd, even); - - /* apply len2 zeros to crc1 (first square will put the operator for one - zero byte, eight zero bits, in even) */ - do { - /* apply zeros operator for this bit of len2 */ - gf2_matrix_square(even, odd); - if (len2 & 1) - crc1 = gf2_matrix_times(even, crc1); - len2 >>= 1; - - /* if no more bits set, then done */ - if (len2 == 0) - break; - - /* another iteration of the loop with odd and even swapped */ - gf2_matrix_square(odd, even); - if (len2 & 1) - crc1 = gf2_matrix_times(odd, crc1); - len2 >>= 1; - - /* if no more bits set, then done */ - } while (len2 != 0); - - /* return combined crc */ - crc1 ^= crc2; - return crc1; -} diff --git a/dependencies/zlib/crc32.h b/dependencies/zlib/crc32.h deleted file mode 100644 index 5de49bc9..00000000 --- a/dependencies/zlib/crc32.h +++ /dev/null @@ -1,441 +0,0 @@ -/* crc32.h -- tables for rapid CRC calculation - * Generated automatically by crc32.c - */ - -local const unsigned long FAR crc_table[TBLS][256] = -{ - { - 0x00000000UL, 0x77073096UL, 0xee0e612cUL, 0x990951baUL, 0x076dc419UL, - 0x706af48fUL, 0xe963a535UL, 0x9e6495a3UL, 0x0edb8832UL, 0x79dcb8a4UL, - 0xe0d5e91eUL, 0x97d2d988UL, 0x09b64c2bUL, 0x7eb17cbdUL, 0xe7b82d07UL, - 0x90bf1d91UL, 0x1db71064UL, 0x6ab020f2UL, 0xf3b97148UL, 0x84be41deUL, - 0x1adad47dUL, 0x6ddde4ebUL, 0xf4d4b551UL, 0x83d385c7UL, 0x136c9856UL, - 0x646ba8c0UL, 0xfd62f97aUL, 0x8a65c9ecUL, 0x14015c4fUL, 0x63066cd9UL, - 0xfa0f3d63UL, 0x8d080df5UL, 0x3b6e20c8UL, 0x4c69105eUL, 0xd56041e4UL, - 0xa2677172UL, 0x3c03e4d1UL, 0x4b04d447UL, 0xd20d85fdUL, 0xa50ab56bUL, - 0x35b5a8faUL, 0x42b2986cUL, 0xdbbbc9d6UL, 0xacbcf940UL, 0x32d86ce3UL, - 0x45df5c75UL, 0xdcd60dcfUL, 0xabd13d59UL, 0x26d930acUL, 0x51de003aUL, - 0xc8d75180UL, 0xbfd06116UL, 0x21b4f4b5UL, 0x56b3c423UL, 0xcfba9599UL, - 0xb8bda50fUL, 0x2802b89eUL, 0x5f058808UL, 0xc60cd9b2UL, 0xb10be924UL, - 0x2f6f7c87UL, 0x58684c11UL, 0xc1611dabUL, 0xb6662d3dUL, 0x76dc4190UL, - 0x01db7106UL, 0x98d220bcUL, 0xefd5102aUL, 0x71b18589UL, 0x06b6b51fUL, - 0x9fbfe4a5UL, 0xe8b8d433UL, 0x7807c9a2UL, 0x0f00f934UL, 0x9609a88eUL, - 0xe10e9818UL, 0x7f6a0dbbUL, 0x086d3d2dUL, 0x91646c97UL, 0xe6635c01UL, - 0x6b6b51f4UL, 0x1c6c6162UL, 0x856530d8UL, 0xf262004eUL, 0x6c0695edUL, - 0x1b01a57bUL, 0x8208f4c1UL, 0xf50fc457UL, 0x65b0d9c6UL, 0x12b7e950UL, - 0x8bbeb8eaUL, 0xfcb9887cUL, 0x62dd1ddfUL, 0x15da2d49UL, 0x8cd37cf3UL, - 0xfbd44c65UL, 0x4db26158UL, 0x3ab551ceUL, 0xa3bc0074UL, 0xd4bb30e2UL, - 0x4adfa541UL, 0x3dd895d7UL, 0xa4d1c46dUL, 0xd3d6f4fbUL, 0x4369e96aUL, - 0x346ed9fcUL, 0xad678846UL, 0xda60b8d0UL, 0x44042d73UL, 0x33031de5UL, - 0xaa0a4c5fUL, 0xdd0d7cc9UL, 0x5005713cUL, 0x270241aaUL, 0xbe0b1010UL, - 0xc90c2086UL, 0x5768b525UL, 0x206f85b3UL, 0xb966d409UL, 0xce61e49fUL, - 0x5edef90eUL, 0x29d9c998UL, 0xb0d09822UL, 0xc7d7a8b4UL, 0x59b33d17UL, - 0x2eb40d81UL, 0xb7bd5c3bUL, 0xc0ba6cadUL, 0xedb88320UL, 0x9abfb3b6UL, - 0x03b6e20cUL, 0x74b1d29aUL, 0xead54739UL, 0x9dd277afUL, 0x04db2615UL, - 0x73dc1683UL, 0xe3630b12UL, 0x94643b84UL, 0x0d6d6a3eUL, 0x7a6a5aa8UL, - 0xe40ecf0bUL, 0x9309ff9dUL, 0x0a00ae27UL, 0x7d079eb1UL, 0xf00f9344UL, - 0x8708a3d2UL, 0x1e01f268UL, 0x6906c2feUL, 0xf762575dUL, 0x806567cbUL, - 0x196c3671UL, 0x6e6b06e7UL, 0xfed41b76UL, 0x89d32be0UL, 0x10da7a5aUL, - 0x67dd4accUL, 0xf9b9df6fUL, 0x8ebeeff9UL, 0x17b7be43UL, 0x60b08ed5UL, - 0xd6d6a3e8UL, 0xa1d1937eUL, 0x38d8c2c4UL, 0x4fdff252UL, 0xd1bb67f1UL, - 0xa6bc5767UL, 0x3fb506ddUL, 0x48b2364bUL, 0xd80d2bdaUL, 0xaf0a1b4cUL, - 0x36034af6UL, 0x41047a60UL, 0xdf60efc3UL, 0xa867df55UL, 0x316e8eefUL, - 0x4669be79UL, 0xcb61b38cUL, 0xbc66831aUL, 0x256fd2a0UL, 0x5268e236UL, - 0xcc0c7795UL, 0xbb0b4703UL, 0x220216b9UL, 0x5505262fUL, 0xc5ba3bbeUL, - 0xb2bd0b28UL, 0x2bb45a92UL, 0x5cb36a04UL, 0xc2d7ffa7UL, 0xb5d0cf31UL, - 0x2cd99e8bUL, 0x5bdeae1dUL, 0x9b64c2b0UL, 0xec63f226UL, 0x756aa39cUL, - 0x026d930aUL, 0x9c0906a9UL, 0xeb0e363fUL, 0x72076785UL, 0x05005713UL, - 0x95bf4a82UL, 0xe2b87a14UL, 0x7bb12baeUL, 0x0cb61b38UL, 0x92d28e9bUL, - 0xe5d5be0dUL, 0x7cdcefb7UL, 0x0bdbdf21UL, 0x86d3d2d4UL, 0xf1d4e242UL, - 0x68ddb3f8UL, 0x1fda836eUL, 0x81be16cdUL, 0xf6b9265bUL, 0x6fb077e1UL, - 0x18b74777UL, 0x88085ae6UL, 0xff0f6a70UL, 0x66063bcaUL, 0x11010b5cUL, - 0x8f659effUL, 0xf862ae69UL, 0x616bffd3UL, 0x166ccf45UL, 0xa00ae278UL, - 0xd70dd2eeUL, 0x4e048354UL, 0x3903b3c2UL, 0xa7672661UL, 0xd06016f7UL, - 0x4969474dUL, 0x3e6e77dbUL, 0xaed16a4aUL, 0xd9d65adcUL, 0x40df0b66UL, - 0x37d83bf0UL, 0xa9bcae53UL, 0xdebb9ec5UL, 0x47b2cf7fUL, 0x30b5ffe9UL, - 0xbdbdf21cUL, 0xcabac28aUL, 0x53b39330UL, 0x24b4a3a6UL, 0xbad03605UL, - 0xcdd70693UL, 0x54de5729UL, 0x23d967bfUL, 0xb3667a2eUL, 0xc4614ab8UL, - 0x5d681b02UL, 0x2a6f2b94UL, 0xb40bbe37UL, 0xc30c8ea1UL, 0x5a05df1bUL, - 0x2d02ef8dUL -#ifdef BYFOUR - }, - { - 0x00000000UL, 0x191b3141UL, 0x32366282UL, 0x2b2d53c3UL, 0x646cc504UL, - 0x7d77f445UL, 0x565aa786UL, 0x4f4196c7UL, 0xc8d98a08UL, 0xd1c2bb49UL, - 0xfaefe88aUL, 0xe3f4d9cbUL, 0xacb54f0cUL, 0xb5ae7e4dUL, 0x9e832d8eUL, - 0x87981ccfUL, 0x4ac21251UL, 0x53d92310UL, 0x78f470d3UL, 0x61ef4192UL, - 0x2eaed755UL, 0x37b5e614UL, 0x1c98b5d7UL, 0x05838496UL, 0x821b9859UL, - 0x9b00a918UL, 0xb02dfadbUL, 0xa936cb9aUL, 0xe6775d5dUL, 0xff6c6c1cUL, - 0xd4413fdfUL, 0xcd5a0e9eUL, 0x958424a2UL, 0x8c9f15e3UL, 0xa7b24620UL, - 0xbea97761UL, 0xf1e8e1a6UL, 0xe8f3d0e7UL, 0xc3de8324UL, 0xdac5b265UL, - 0x5d5daeaaUL, 0x44469febUL, 0x6f6bcc28UL, 0x7670fd69UL, 0x39316baeUL, - 0x202a5aefUL, 0x0b07092cUL, 0x121c386dUL, 0xdf4636f3UL, 0xc65d07b2UL, - 0xed705471UL, 0xf46b6530UL, 0xbb2af3f7UL, 0xa231c2b6UL, 0x891c9175UL, - 0x9007a034UL, 0x179fbcfbUL, 0x0e848dbaUL, 0x25a9de79UL, 0x3cb2ef38UL, - 0x73f379ffUL, 0x6ae848beUL, 0x41c51b7dUL, 0x58de2a3cUL, 0xf0794f05UL, - 0xe9627e44UL, 0xc24f2d87UL, 0xdb541cc6UL, 0x94158a01UL, 0x8d0ebb40UL, - 0xa623e883UL, 0xbf38d9c2UL, 0x38a0c50dUL, 0x21bbf44cUL, 0x0a96a78fUL, - 0x138d96ceUL, 0x5ccc0009UL, 0x45d73148UL, 0x6efa628bUL, 0x77e153caUL, - 0xbabb5d54UL, 0xa3a06c15UL, 0x888d3fd6UL, 0x91960e97UL, 0xded79850UL, - 0xc7cca911UL, 0xece1fad2UL, 0xf5facb93UL, 0x7262d75cUL, 0x6b79e61dUL, - 0x4054b5deUL, 0x594f849fUL, 0x160e1258UL, 0x0f152319UL, 0x243870daUL, - 0x3d23419bUL, 0x65fd6ba7UL, 0x7ce65ae6UL, 0x57cb0925UL, 0x4ed03864UL, - 0x0191aea3UL, 0x188a9fe2UL, 0x33a7cc21UL, 0x2abcfd60UL, 0xad24e1afUL, - 0xb43fd0eeUL, 0x9f12832dUL, 0x8609b26cUL, 0xc94824abUL, 0xd05315eaUL, - 0xfb7e4629UL, 0xe2657768UL, 0x2f3f79f6UL, 0x362448b7UL, 0x1d091b74UL, - 0x04122a35UL, 0x4b53bcf2UL, 0x52488db3UL, 0x7965de70UL, 0x607eef31UL, - 0xe7e6f3feUL, 0xfefdc2bfUL, 0xd5d0917cUL, 0xcccba03dUL, 0x838a36faUL, - 0x9a9107bbUL, 0xb1bc5478UL, 0xa8a76539UL, 0x3b83984bUL, 0x2298a90aUL, - 0x09b5fac9UL, 0x10aecb88UL, 0x5fef5d4fUL, 0x46f46c0eUL, 0x6dd93fcdUL, - 0x74c20e8cUL, 0xf35a1243UL, 0xea412302UL, 0xc16c70c1UL, 0xd8774180UL, - 0x9736d747UL, 0x8e2de606UL, 0xa500b5c5UL, 0xbc1b8484UL, 0x71418a1aUL, - 0x685abb5bUL, 0x4377e898UL, 0x5a6cd9d9UL, 0x152d4f1eUL, 0x0c367e5fUL, - 0x271b2d9cUL, 0x3e001cddUL, 0xb9980012UL, 0xa0833153UL, 0x8bae6290UL, - 0x92b553d1UL, 0xddf4c516UL, 0xc4eff457UL, 0xefc2a794UL, 0xf6d996d5UL, - 0xae07bce9UL, 0xb71c8da8UL, 0x9c31de6bUL, 0x852aef2aUL, 0xca6b79edUL, - 0xd37048acUL, 0xf85d1b6fUL, 0xe1462a2eUL, 0x66de36e1UL, 0x7fc507a0UL, - 0x54e85463UL, 0x4df36522UL, 0x02b2f3e5UL, 0x1ba9c2a4UL, 0x30849167UL, - 0x299fa026UL, 0xe4c5aeb8UL, 0xfdde9ff9UL, 0xd6f3cc3aUL, 0xcfe8fd7bUL, - 0x80a96bbcUL, 0x99b25afdUL, 0xb29f093eUL, 0xab84387fUL, 0x2c1c24b0UL, - 0x350715f1UL, 0x1e2a4632UL, 0x07317773UL, 0x4870e1b4UL, 0x516bd0f5UL, - 0x7a468336UL, 0x635db277UL, 0xcbfad74eUL, 0xd2e1e60fUL, 0xf9ccb5ccUL, - 0xe0d7848dUL, 0xaf96124aUL, 0xb68d230bUL, 0x9da070c8UL, 0x84bb4189UL, - 0x03235d46UL, 0x1a386c07UL, 0x31153fc4UL, 0x280e0e85UL, 0x674f9842UL, - 0x7e54a903UL, 0x5579fac0UL, 0x4c62cb81UL, 0x8138c51fUL, 0x9823f45eUL, - 0xb30ea79dUL, 0xaa1596dcUL, 0xe554001bUL, 0xfc4f315aUL, 0xd7626299UL, - 0xce7953d8UL, 0x49e14f17UL, 0x50fa7e56UL, 0x7bd72d95UL, 0x62cc1cd4UL, - 0x2d8d8a13UL, 0x3496bb52UL, 0x1fbbe891UL, 0x06a0d9d0UL, 0x5e7ef3ecUL, - 0x4765c2adUL, 0x6c48916eUL, 0x7553a02fUL, 0x3a1236e8UL, 0x230907a9UL, - 0x0824546aUL, 0x113f652bUL, 0x96a779e4UL, 0x8fbc48a5UL, 0xa4911b66UL, - 0xbd8a2a27UL, 0xf2cbbce0UL, 0xebd08da1UL, 0xc0fdde62UL, 0xd9e6ef23UL, - 0x14bce1bdUL, 0x0da7d0fcUL, 0x268a833fUL, 0x3f91b27eUL, 0x70d024b9UL, - 0x69cb15f8UL, 0x42e6463bUL, 0x5bfd777aUL, 0xdc656bb5UL, 0xc57e5af4UL, - 0xee530937UL, 0xf7483876UL, 0xb809aeb1UL, 0xa1129ff0UL, 0x8a3fcc33UL, - 0x9324fd72UL - }, - { - 0x00000000UL, 0x01c26a37UL, 0x0384d46eUL, 0x0246be59UL, 0x0709a8dcUL, - 0x06cbc2ebUL, 0x048d7cb2UL, 0x054f1685UL, 0x0e1351b8UL, 0x0fd13b8fUL, - 0x0d9785d6UL, 0x0c55efe1UL, 0x091af964UL, 0x08d89353UL, 0x0a9e2d0aUL, - 0x0b5c473dUL, 0x1c26a370UL, 0x1de4c947UL, 0x1fa2771eUL, 0x1e601d29UL, - 0x1b2f0bacUL, 0x1aed619bUL, 0x18abdfc2UL, 0x1969b5f5UL, 0x1235f2c8UL, - 0x13f798ffUL, 0x11b126a6UL, 0x10734c91UL, 0x153c5a14UL, 0x14fe3023UL, - 0x16b88e7aUL, 0x177ae44dUL, 0x384d46e0UL, 0x398f2cd7UL, 0x3bc9928eUL, - 0x3a0bf8b9UL, 0x3f44ee3cUL, 0x3e86840bUL, 0x3cc03a52UL, 0x3d025065UL, - 0x365e1758UL, 0x379c7d6fUL, 0x35dac336UL, 0x3418a901UL, 0x3157bf84UL, - 0x3095d5b3UL, 0x32d36beaUL, 0x331101ddUL, 0x246be590UL, 0x25a98fa7UL, - 0x27ef31feUL, 0x262d5bc9UL, 0x23624d4cUL, 0x22a0277bUL, 0x20e69922UL, - 0x2124f315UL, 0x2a78b428UL, 0x2bbade1fUL, 0x29fc6046UL, 0x283e0a71UL, - 0x2d711cf4UL, 0x2cb376c3UL, 0x2ef5c89aUL, 0x2f37a2adUL, 0x709a8dc0UL, - 0x7158e7f7UL, 0x731e59aeUL, 0x72dc3399UL, 0x7793251cUL, 0x76514f2bUL, - 0x7417f172UL, 0x75d59b45UL, 0x7e89dc78UL, 0x7f4bb64fUL, 0x7d0d0816UL, - 0x7ccf6221UL, 0x798074a4UL, 0x78421e93UL, 0x7a04a0caUL, 0x7bc6cafdUL, - 0x6cbc2eb0UL, 0x6d7e4487UL, 0x6f38fadeUL, 0x6efa90e9UL, 0x6bb5866cUL, - 0x6a77ec5bUL, 0x68315202UL, 0x69f33835UL, 0x62af7f08UL, 0x636d153fUL, - 0x612bab66UL, 0x60e9c151UL, 0x65a6d7d4UL, 0x6464bde3UL, 0x662203baUL, - 0x67e0698dUL, 0x48d7cb20UL, 0x4915a117UL, 0x4b531f4eUL, 0x4a917579UL, - 0x4fde63fcUL, 0x4e1c09cbUL, 0x4c5ab792UL, 0x4d98dda5UL, 0x46c49a98UL, - 0x4706f0afUL, 0x45404ef6UL, 0x448224c1UL, 0x41cd3244UL, 0x400f5873UL, - 0x4249e62aUL, 0x438b8c1dUL, 0x54f16850UL, 0x55330267UL, 0x5775bc3eUL, - 0x56b7d609UL, 0x53f8c08cUL, 0x523aaabbUL, 0x507c14e2UL, 0x51be7ed5UL, - 0x5ae239e8UL, 0x5b2053dfUL, 0x5966ed86UL, 0x58a487b1UL, 0x5deb9134UL, - 0x5c29fb03UL, 0x5e6f455aUL, 0x5fad2f6dUL, 0xe1351b80UL, 0xe0f771b7UL, - 0xe2b1cfeeUL, 0xe373a5d9UL, 0xe63cb35cUL, 0xe7fed96bUL, 0xe5b86732UL, - 0xe47a0d05UL, 0xef264a38UL, 0xeee4200fUL, 0xeca29e56UL, 0xed60f461UL, - 0xe82fe2e4UL, 0xe9ed88d3UL, 0xebab368aUL, 0xea695cbdUL, 0xfd13b8f0UL, - 0xfcd1d2c7UL, 0xfe976c9eUL, 0xff5506a9UL, 0xfa1a102cUL, 0xfbd87a1bUL, - 0xf99ec442UL, 0xf85cae75UL, 0xf300e948UL, 0xf2c2837fUL, 0xf0843d26UL, - 0xf1465711UL, 0xf4094194UL, 0xf5cb2ba3UL, 0xf78d95faUL, 0xf64fffcdUL, - 0xd9785d60UL, 0xd8ba3757UL, 0xdafc890eUL, 0xdb3ee339UL, 0xde71f5bcUL, - 0xdfb39f8bUL, 0xddf521d2UL, 0xdc374be5UL, 0xd76b0cd8UL, 0xd6a966efUL, - 0xd4efd8b6UL, 0xd52db281UL, 0xd062a404UL, 0xd1a0ce33UL, 0xd3e6706aUL, - 0xd2241a5dUL, 0xc55efe10UL, 0xc49c9427UL, 0xc6da2a7eUL, 0xc7184049UL, - 0xc25756ccUL, 0xc3953cfbUL, 0xc1d382a2UL, 0xc011e895UL, 0xcb4dafa8UL, - 0xca8fc59fUL, 0xc8c97bc6UL, 0xc90b11f1UL, 0xcc440774UL, 0xcd866d43UL, - 0xcfc0d31aUL, 0xce02b92dUL, 0x91af9640UL, 0x906dfc77UL, 0x922b422eUL, - 0x93e92819UL, 0x96a63e9cUL, 0x976454abUL, 0x9522eaf2UL, 0x94e080c5UL, - 0x9fbcc7f8UL, 0x9e7eadcfUL, 0x9c381396UL, 0x9dfa79a1UL, 0x98b56f24UL, - 0x99770513UL, 0x9b31bb4aUL, 0x9af3d17dUL, 0x8d893530UL, 0x8c4b5f07UL, - 0x8e0de15eUL, 0x8fcf8b69UL, 0x8a809decUL, 0x8b42f7dbUL, 0x89044982UL, - 0x88c623b5UL, 0x839a6488UL, 0x82580ebfUL, 0x801eb0e6UL, 0x81dcdad1UL, - 0x8493cc54UL, 0x8551a663UL, 0x8717183aUL, 0x86d5720dUL, 0xa9e2d0a0UL, - 0xa820ba97UL, 0xaa6604ceUL, 0xaba46ef9UL, 0xaeeb787cUL, 0xaf29124bUL, - 0xad6fac12UL, 0xacadc625UL, 0xa7f18118UL, 0xa633eb2fUL, 0xa4755576UL, - 0xa5b73f41UL, 0xa0f829c4UL, 0xa13a43f3UL, 0xa37cfdaaUL, 0xa2be979dUL, - 0xb5c473d0UL, 0xb40619e7UL, 0xb640a7beUL, 0xb782cd89UL, 0xb2cddb0cUL, - 0xb30fb13bUL, 0xb1490f62UL, 0xb08b6555UL, 0xbbd72268UL, 0xba15485fUL, - 0xb853f606UL, 0xb9919c31UL, 0xbcde8ab4UL, 0xbd1ce083UL, 0xbf5a5edaUL, - 0xbe9834edUL - }, - { - 0x00000000UL, 0xb8bc6765UL, 0xaa09c88bUL, 0x12b5afeeUL, 0x8f629757UL, - 0x37def032UL, 0x256b5fdcUL, 0x9dd738b9UL, 0xc5b428efUL, 0x7d084f8aUL, - 0x6fbde064UL, 0xd7018701UL, 0x4ad6bfb8UL, 0xf26ad8ddUL, 0xe0df7733UL, - 0x58631056UL, 0x5019579fUL, 0xe8a530faUL, 0xfa109f14UL, 0x42acf871UL, - 0xdf7bc0c8UL, 0x67c7a7adUL, 0x75720843UL, 0xcdce6f26UL, 0x95ad7f70UL, - 0x2d111815UL, 0x3fa4b7fbUL, 0x8718d09eUL, 0x1acfe827UL, 0xa2738f42UL, - 0xb0c620acUL, 0x087a47c9UL, 0xa032af3eUL, 0x188ec85bUL, 0x0a3b67b5UL, - 0xb28700d0UL, 0x2f503869UL, 0x97ec5f0cUL, 0x8559f0e2UL, 0x3de59787UL, - 0x658687d1UL, 0xdd3ae0b4UL, 0xcf8f4f5aUL, 0x7733283fUL, 0xeae41086UL, - 0x525877e3UL, 0x40edd80dUL, 0xf851bf68UL, 0xf02bf8a1UL, 0x48979fc4UL, - 0x5a22302aUL, 0xe29e574fUL, 0x7f496ff6UL, 0xc7f50893UL, 0xd540a77dUL, - 0x6dfcc018UL, 0x359fd04eUL, 0x8d23b72bUL, 0x9f9618c5UL, 0x272a7fa0UL, - 0xbafd4719UL, 0x0241207cUL, 0x10f48f92UL, 0xa848e8f7UL, 0x9b14583dUL, - 0x23a83f58UL, 0x311d90b6UL, 0x89a1f7d3UL, 0x1476cf6aUL, 0xaccaa80fUL, - 0xbe7f07e1UL, 0x06c36084UL, 0x5ea070d2UL, 0xe61c17b7UL, 0xf4a9b859UL, - 0x4c15df3cUL, 0xd1c2e785UL, 0x697e80e0UL, 0x7bcb2f0eUL, 0xc377486bUL, - 0xcb0d0fa2UL, 0x73b168c7UL, 0x6104c729UL, 0xd9b8a04cUL, 0x446f98f5UL, - 0xfcd3ff90UL, 0xee66507eUL, 0x56da371bUL, 0x0eb9274dUL, 0xb6054028UL, - 0xa4b0efc6UL, 0x1c0c88a3UL, 0x81dbb01aUL, 0x3967d77fUL, 0x2bd27891UL, - 0x936e1ff4UL, 0x3b26f703UL, 0x839a9066UL, 0x912f3f88UL, 0x299358edUL, - 0xb4446054UL, 0x0cf80731UL, 0x1e4da8dfUL, 0xa6f1cfbaUL, 0xfe92dfecUL, - 0x462eb889UL, 0x549b1767UL, 0xec277002UL, 0x71f048bbUL, 0xc94c2fdeUL, - 0xdbf98030UL, 0x6345e755UL, 0x6b3fa09cUL, 0xd383c7f9UL, 0xc1366817UL, - 0x798a0f72UL, 0xe45d37cbUL, 0x5ce150aeUL, 0x4e54ff40UL, 0xf6e89825UL, - 0xae8b8873UL, 0x1637ef16UL, 0x048240f8UL, 0xbc3e279dUL, 0x21e91f24UL, - 0x99557841UL, 0x8be0d7afUL, 0x335cb0caUL, 0xed59b63bUL, 0x55e5d15eUL, - 0x47507eb0UL, 0xffec19d5UL, 0x623b216cUL, 0xda874609UL, 0xc832e9e7UL, - 0x708e8e82UL, 0x28ed9ed4UL, 0x9051f9b1UL, 0x82e4565fUL, 0x3a58313aUL, - 0xa78f0983UL, 0x1f336ee6UL, 0x0d86c108UL, 0xb53aa66dUL, 0xbd40e1a4UL, - 0x05fc86c1UL, 0x1749292fUL, 0xaff54e4aUL, 0x322276f3UL, 0x8a9e1196UL, - 0x982bbe78UL, 0x2097d91dUL, 0x78f4c94bUL, 0xc048ae2eUL, 0xd2fd01c0UL, - 0x6a4166a5UL, 0xf7965e1cUL, 0x4f2a3979UL, 0x5d9f9697UL, 0xe523f1f2UL, - 0x4d6b1905UL, 0xf5d77e60UL, 0xe762d18eUL, 0x5fdeb6ebUL, 0xc2098e52UL, - 0x7ab5e937UL, 0x680046d9UL, 0xd0bc21bcUL, 0x88df31eaUL, 0x3063568fUL, - 0x22d6f961UL, 0x9a6a9e04UL, 0x07bda6bdUL, 0xbf01c1d8UL, 0xadb46e36UL, - 0x15080953UL, 0x1d724e9aUL, 0xa5ce29ffUL, 0xb77b8611UL, 0x0fc7e174UL, - 0x9210d9cdUL, 0x2aacbea8UL, 0x38191146UL, 0x80a57623UL, 0xd8c66675UL, - 0x607a0110UL, 0x72cfaefeUL, 0xca73c99bUL, 0x57a4f122UL, 0xef189647UL, - 0xfdad39a9UL, 0x45115eccUL, 0x764dee06UL, 0xcef18963UL, 0xdc44268dUL, - 0x64f841e8UL, 0xf92f7951UL, 0x41931e34UL, 0x5326b1daUL, 0xeb9ad6bfUL, - 0xb3f9c6e9UL, 0x0b45a18cUL, 0x19f00e62UL, 0xa14c6907UL, 0x3c9b51beUL, - 0x842736dbUL, 0x96929935UL, 0x2e2efe50UL, 0x2654b999UL, 0x9ee8defcUL, - 0x8c5d7112UL, 0x34e11677UL, 0xa9362eceUL, 0x118a49abUL, 0x033fe645UL, - 0xbb838120UL, 0xe3e09176UL, 0x5b5cf613UL, 0x49e959fdUL, 0xf1553e98UL, - 0x6c820621UL, 0xd43e6144UL, 0xc68bceaaUL, 0x7e37a9cfUL, 0xd67f4138UL, - 0x6ec3265dUL, 0x7c7689b3UL, 0xc4caeed6UL, 0x591dd66fUL, 0xe1a1b10aUL, - 0xf3141ee4UL, 0x4ba87981UL, 0x13cb69d7UL, 0xab770eb2UL, 0xb9c2a15cUL, - 0x017ec639UL, 0x9ca9fe80UL, 0x241599e5UL, 0x36a0360bUL, 0x8e1c516eUL, - 0x866616a7UL, 0x3eda71c2UL, 0x2c6fde2cUL, 0x94d3b949UL, 0x090481f0UL, - 0xb1b8e695UL, 0xa30d497bUL, 0x1bb12e1eUL, 0x43d23e48UL, 0xfb6e592dUL, - 0xe9dbf6c3UL, 0x516791a6UL, 0xccb0a91fUL, 0x740cce7aUL, 0x66b96194UL, - 0xde0506f1UL - }, - { - 0x00000000UL, 0x96300777UL, 0x2c610eeeUL, 0xba510999UL, 0x19c46d07UL, - 0x8ff46a70UL, 0x35a563e9UL, 0xa395649eUL, 0x3288db0eUL, 0xa4b8dc79UL, - 0x1ee9d5e0UL, 0x88d9d297UL, 0x2b4cb609UL, 0xbd7cb17eUL, 0x072db8e7UL, - 0x911dbf90UL, 0x6410b71dUL, 0xf220b06aUL, 0x4871b9f3UL, 0xde41be84UL, - 0x7dd4da1aUL, 0xebe4dd6dUL, 0x51b5d4f4UL, 0xc785d383UL, 0x56986c13UL, - 0xc0a86b64UL, 0x7af962fdUL, 0xecc9658aUL, 0x4f5c0114UL, 0xd96c0663UL, - 0x633d0ffaUL, 0xf50d088dUL, 0xc8206e3bUL, 0x5e10694cUL, 0xe44160d5UL, - 0x727167a2UL, 0xd1e4033cUL, 0x47d4044bUL, 0xfd850dd2UL, 0x6bb50aa5UL, - 0xfaa8b535UL, 0x6c98b242UL, 0xd6c9bbdbUL, 0x40f9bcacUL, 0xe36cd832UL, - 0x755cdf45UL, 0xcf0dd6dcUL, 0x593dd1abUL, 0xac30d926UL, 0x3a00de51UL, - 0x8051d7c8UL, 0x1661d0bfUL, 0xb5f4b421UL, 0x23c4b356UL, 0x9995bacfUL, - 0x0fa5bdb8UL, 0x9eb80228UL, 0x0888055fUL, 0xb2d90cc6UL, 0x24e90bb1UL, - 0x877c6f2fUL, 0x114c6858UL, 0xab1d61c1UL, 0x3d2d66b6UL, 0x9041dc76UL, - 0x0671db01UL, 0xbc20d298UL, 0x2a10d5efUL, 0x8985b171UL, 0x1fb5b606UL, - 0xa5e4bf9fUL, 0x33d4b8e8UL, 0xa2c90778UL, 0x34f9000fUL, 0x8ea80996UL, - 0x18980ee1UL, 0xbb0d6a7fUL, 0x2d3d6d08UL, 0x976c6491UL, 0x015c63e6UL, - 0xf4516b6bUL, 0x62616c1cUL, 0xd8306585UL, 0x4e0062f2UL, 0xed95066cUL, - 0x7ba5011bUL, 0xc1f40882UL, 0x57c40ff5UL, 0xc6d9b065UL, 0x50e9b712UL, - 0xeab8be8bUL, 0x7c88b9fcUL, 0xdf1ddd62UL, 0x492dda15UL, 0xf37cd38cUL, - 0x654cd4fbUL, 0x5861b24dUL, 0xce51b53aUL, 0x7400bca3UL, 0xe230bbd4UL, - 0x41a5df4aUL, 0xd795d83dUL, 0x6dc4d1a4UL, 0xfbf4d6d3UL, 0x6ae96943UL, - 0xfcd96e34UL, 0x468867adUL, 0xd0b860daUL, 0x732d0444UL, 0xe51d0333UL, - 0x5f4c0aaaUL, 0xc97c0dddUL, 0x3c710550UL, 0xaa410227UL, 0x10100bbeUL, - 0x86200cc9UL, 0x25b56857UL, 0xb3856f20UL, 0x09d466b9UL, 0x9fe461ceUL, - 0x0ef9de5eUL, 0x98c9d929UL, 0x2298d0b0UL, 0xb4a8d7c7UL, 0x173db359UL, - 0x810db42eUL, 0x3b5cbdb7UL, 0xad6cbac0UL, 0x2083b8edUL, 0xb6b3bf9aUL, - 0x0ce2b603UL, 0x9ad2b174UL, 0x3947d5eaUL, 0xaf77d29dUL, 0x1526db04UL, - 0x8316dc73UL, 0x120b63e3UL, 0x843b6494UL, 0x3e6a6d0dUL, 0xa85a6a7aUL, - 0x0bcf0ee4UL, 0x9dff0993UL, 0x27ae000aUL, 0xb19e077dUL, 0x44930ff0UL, - 0xd2a30887UL, 0x68f2011eUL, 0xfec20669UL, 0x5d5762f7UL, 0xcb676580UL, - 0x71366c19UL, 0xe7066b6eUL, 0x761bd4feUL, 0xe02bd389UL, 0x5a7ada10UL, - 0xcc4add67UL, 0x6fdfb9f9UL, 0xf9efbe8eUL, 0x43beb717UL, 0xd58eb060UL, - 0xe8a3d6d6UL, 0x7e93d1a1UL, 0xc4c2d838UL, 0x52f2df4fUL, 0xf167bbd1UL, - 0x6757bca6UL, 0xdd06b53fUL, 0x4b36b248UL, 0xda2b0dd8UL, 0x4c1b0aafUL, - 0xf64a0336UL, 0x607a0441UL, 0xc3ef60dfUL, 0x55df67a8UL, 0xef8e6e31UL, - 0x79be6946UL, 0x8cb361cbUL, 0x1a8366bcUL, 0xa0d26f25UL, 0x36e26852UL, - 0x95770cccUL, 0x03470bbbUL, 0xb9160222UL, 0x2f260555UL, 0xbe3bbac5UL, - 0x280bbdb2UL, 0x925ab42bUL, 0x046ab35cUL, 0xa7ffd7c2UL, 0x31cfd0b5UL, - 0x8b9ed92cUL, 0x1daede5bUL, 0xb0c2649bUL, 0x26f263ecUL, 0x9ca36a75UL, - 0x0a936d02UL, 0xa906099cUL, 0x3f360eebUL, 0x85670772UL, 0x13570005UL, - 0x824abf95UL, 0x147ab8e2UL, 0xae2bb17bUL, 0x381bb60cUL, 0x9b8ed292UL, - 0x0dbed5e5UL, 0xb7efdc7cUL, 0x21dfdb0bUL, 0xd4d2d386UL, 0x42e2d4f1UL, - 0xf8b3dd68UL, 0x6e83da1fUL, 0xcd16be81UL, 0x5b26b9f6UL, 0xe177b06fUL, - 0x7747b718UL, 0xe65a0888UL, 0x706a0fffUL, 0xca3b0666UL, 0x5c0b0111UL, - 0xff9e658fUL, 0x69ae62f8UL, 0xd3ff6b61UL, 0x45cf6c16UL, 0x78e20aa0UL, - 0xeed20dd7UL, 0x5483044eUL, 0xc2b30339UL, 0x612667a7UL, 0xf71660d0UL, - 0x4d476949UL, 0xdb776e3eUL, 0x4a6ad1aeUL, 0xdc5ad6d9UL, 0x660bdf40UL, - 0xf03bd837UL, 0x53aebca9UL, 0xc59ebbdeUL, 0x7fcfb247UL, 0xe9ffb530UL, - 0x1cf2bdbdUL, 0x8ac2bacaUL, 0x3093b353UL, 0xa6a3b424UL, 0x0536d0baUL, - 0x9306d7cdUL, 0x2957de54UL, 0xbf67d923UL, 0x2e7a66b3UL, 0xb84a61c4UL, - 0x021b685dUL, 0x942b6f2aUL, 0x37be0bb4UL, 0xa18e0cc3UL, 0x1bdf055aUL, - 0x8def022dUL - }, - { - 0x00000000UL, 0x41311b19UL, 0x82623632UL, 0xc3532d2bUL, 0x04c56c64UL, - 0x45f4777dUL, 0x86a75a56UL, 0xc796414fUL, 0x088ad9c8UL, 0x49bbc2d1UL, - 0x8ae8effaUL, 0xcbd9f4e3UL, 0x0c4fb5acUL, 0x4d7eaeb5UL, 0x8e2d839eUL, - 0xcf1c9887UL, 0x5112c24aUL, 0x1023d953UL, 0xd370f478UL, 0x9241ef61UL, - 0x55d7ae2eUL, 0x14e6b537UL, 0xd7b5981cUL, 0x96848305UL, 0x59981b82UL, - 0x18a9009bUL, 0xdbfa2db0UL, 0x9acb36a9UL, 0x5d5d77e6UL, 0x1c6c6cffUL, - 0xdf3f41d4UL, 0x9e0e5acdUL, 0xa2248495UL, 0xe3159f8cUL, 0x2046b2a7UL, - 0x6177a9beUL, 0xa6e1e8f1UL, 0xe7d0f3e8UL, 0x2483dec3UL, 0x65b2c5daUL, - 0xaaae5d5dUL, 0xeb9f4644UL, 0x28cc6b6fUL, 0x69fd7076UL, 0xae6b3139UL, - 0xef5a2a20UL, 0x2c09070bUL, 0x6d381c12UL, 0xf33646dfUL, 0xb2075dc6UL, - 0x715470edUL, 0x30656bf4UL, 0xf7f32abbUL, 0xb6c231a2UL, 0x75911c89UL, - 0x34a00790UL, 0xfbbc9f17UL, 0xba8d840eUL, 0x79dea925UL, 0x38efb23cUL, - 0xff79f373UL, 0xbe48e86aUL, 0x7d1bc541UL, 0x3c2ade58UL, 0x054f79f0UL, - 0x447e62e9UL, 0x872d4fc2UL, 0xc61c54dbUL, 0x018a1594UL, 0x40bb0e8dUL, - 0x83e823a6UL, 0xc2d938bfUL, 0x0dc5a038UL, 0x4cf4bb21UL, 0x8fa7960aUL, - 0xce968d13UL, 0x0900cc5cUL, 0x4831d745UL, 0x8b62fa6eUL, 0xca53e177UL, - 0x545dbbbaUL, 0x156ca0a3UL, 0xd63f8d88UL, 0x970e9691UL, 0x5098d7deUL, - 0x11a9ccc7UL, 0xd2fae1ecUL, 0x93cbfaf5UL, 0x5cd76272UL, 0x1de6796bUL, - 0xdeb55440UL, 0x9f844f59UL, 0x58120e16UL, 0x1923150fUL, 0xda703824UL, - 0x9b41233dUL, 0xa76bfd65UL, 0xe65ae67cUL, 0x2509cb57UL, 0x6438d04eUL, - 0xa3ae9101UL, 0xe29f8a18UL, 0x21cca733UL, 0x60fdbc2aUL, 0xafe124adUL, - 0xeed03fb4UL, 0x2d83129fUL, 0x6cb20986UL, 0xab2448c9UL, 0xea1553d0UL, - 0x29467efbUL, 0x687765e2UL, 0xf6793f2fUL, 0xb7482436UL, 0x741b091dUL, - 0x352a1204UL, 0xf2bc534bUL, 0xb38d4852UL, 0x70de6579UL, 0x31ef7e60UL, - 0xfef3e6e7UL, 0xbfc2fdfeUL, 0x7c91d0d5UL, 0x3da0cbccUL, 0xfa368a83UL, - 0xbb07919aUL, 0x7854bcb1UL, 0x3965a7a8UL, 0x4b98833bUL, 0x0aa99822UL, - 0xc9fab509UL, 0x88cbae10UL, 0x4f5def5fUL, 0x0e6cf446UL, 0xcd3fd96dUL, - 0x8c0ec274UL, 0x43125af3UL, 0x022341eaUL, 0xc1706cc1UL, 0x804177d8UL, - 0x47d73697UL, 0x06e62d8eUL, 0xc5b500a5UL, 0x84841bbcUL, 0x1a8a4171UL, - 0x5bbb5a68UL, 0x98e87743UL, 0xd9d96c5aUL, 0x1e4f2d15UL, 0x5f7e360cUL, - 0x9c2d1b27UL, 0xdd1c003eUL, 0x120098b9UL, 0x533183a0UL, 0x9062ae8bUL, - 0xd153b592UL, 0x16c5f4ddUL, 0x57f4efc4UL, 0x94a7c2efUL, 0xd596d9f6UL, - 0xe9bc07aeUL, 0xa88d1cb7UL, 0x6bde319cUL, 0x2aef2a85UL, 0xed796bcaUL, - 0xac4870d3UL, 0x6f1b5df8UL, 0x2e2a46e1UL, 0xe136de66UL, 0xa007c57fUL, - 0x6354e854UL, 0x2265f34dUL, 0xe5f3b202UL, 0xa4c2a91bUL, 0x67918430UL, - 0x26a09f29UL, 0xb8aec5e4UL, 0xf99fdefdUL, 0x3accf3d6UL, 0x7bfde8cfUL, - 0xbc6ba980UL, 0xfd5ab299UL, 0x3e099fb2UL, 0x7f3884abUL, 0xb0241c2cUL, - 0xf1150735UL, 0x32462a1eUL, 0x73773107UL, 0xb4e17048UL, 0xf5d06b51UL, - 0x3683467aUL, 0x77b25d63UL, 0x4ed7facbUL, 0x0fe6e1d2UL, 0xccb5ccf9UL, - 0x8d84d7e0UL, 0x4a1296afUL, 0x0b238db6UL, 0xc870a09dUL, 0x8941bb84UL, - 0x465d2303UL, 0x076c381aUL, 0xc43f1531UL, 0x850e0e28UL, 0x42984f67UL, - 0x03a9547eUL, 0xc0fa7955UL, 0x81cb624cUL, 0x1fc53881UL, 0x5ef42398UL, - 0x9da70eb3UL, 0xdc9615aaUL, 0x1b0054e5UL, 0x5a314ffcUL, 0x996262d7UL, - 0xd85379ceUL, 0x174fe149UL, 0x567efa50UL, 0x952dd77bUL, 0xd41ccc62UL, - 0x138a8d2dUL, 0x52bb9634UL, 0x91e8bb1fUL, 0xd0d9a006UL, 0xecf37e5eUL, - 0xadc26547UL, 0x6e91486cUL, 0x2fa05375UL, 0xe836123aUL, 0xa9070923UL, - 0x6a542408UL, 0x2b653f11UL, 0xe479a796UL, 0xa548bc8fUL, 0x661b91a4UL, - 0x272a8abdUL, 0xe0bccbf2UL, 0xa18dd0ebUL, 0x62defdc0UL, 0x23efe6d9UL, - 0xbde1bc14UL, 0xfcd0a70dUL, 0x3f838a26UL, 0x7eb2913fUL, 0xb924d070UL, - 0xf815cb69UL, 0x3b46e642UL, 0x7a77fd5bUL, 0xb56b65dcUL, 0xf45a7ec5UL, - 0x370953eeUL, 0x763848f7UL, 0xb1ae09b8UL, 0xf09f12a1UL, 0x33cc3f8aUL, - 0x72fd2493UL - }, - { - 0x00000000UL, 0x376ac201UL, 0x6ed48403UL, 0x59be4602UL, 0xdca80907UL, - 0xebc2cb06UL, 0xb27c8d04UL, 0x85164f05UL, 0xb851130eUL, 0x8f3bd10fUL, - 0xd685970dUL, 0xe1ef550cUL, 0x64f91a09UL, 0x5393d808UL, 0x0a2d9e0aUL, - 0x3d475c0bUL, 0x70a3261cUL, 0x47c9e41dUL, 0x1e77a21fUL, 0x291d601eUL, - 0xac0b2f1bUL, 0x9b61ed1aUL, 0xc2dfab18UL, 0xf5b56919UL, 0xc8f23512UL, - 0xff98f713UL, 0xa626b111UL, 0x914c7310UL, 0x145a3c15UL, 0x2330fe14UL, - 0x7a8eb816UL, 0x4de47a17UL, 0xe0464d38UL, 0xd72c8f39UL, 0x8e92c93bUL, - 0xb9f80b3aUL, 0x3cee443fUL, 0x0b84863eUL, 0x523ac03cUL, 0x6550023dUL, - 0x58175e36UL, 0x6f7d9c37UL, 0x36c3da35UL, 0x01a91834UL, 0x84bf5731UL, - 0xb3d59530UL, 0xea6bd332UL, 0xdd011133UL, 0x90e56b24UL, 0xa78fa925UL, - 0xfe31ef27UL, 0xc95b2d26UL, 0x4c4d6223UL, 0x7b27a022UL, 0x2299e620UL, - 0x15f32421UL, 0x28b4782aUL, 0x1fdeba2bUL, 0x4660fc29UL, 0x710a3e28UL, - 0xf41c712dUL, 0xc376b32cUL, 0x9ac8f52eUL, 0xada2372fUL, 0xc08d9a70UL, - 0xf7e75871UL, 0xae591e73UL, 0x9933dc72UL, 0x1c259377UL, 0x2b4f5176UL, - 0x72f11774UL, 0x459bd575UL, 0x78dc897eUL, 0x4fb64b7fUL, 0x16080d7dUL, - 0x2162cf7cUL, 0xa4748079UL, 0x931e4278UL, 0xcaa0047aUL, 0xfdcac67bUL, - 0xb02ebc6cUL, 0x87447e6dUL, 0xdefa386fUL, 0xe990fa6eUL, 0x6c86b56bUL, - 0x5bec776aUL, 0x02523168UL, 0x3538f369UL, 0x087faf62UL, 0x3f156d63UL, - 0x66ab2b61UL, 0x51c1e960UL, 0xd4d7a665UL, 0xe3bd6464UL, 0xba032266UL, - 0x8d69e067UL, 0x20cbd748UL, 0x17a11549UL, 0x4e1f534bUL, 0x7975914aUL, - 0xfc63de4fUL, 0xcb091c4eUL, 0x92b75a4cUL, 0xa5dd984dUL, 0x989ac446UL, - 0xaff00647UL, 0xf64e4045UL, 0xc1248244UL, 0x4432cd41UL, 0x73580f40UL, - 0x2ae64942UL, 0x1d8c8b43UL, 0x5068f154UL, 0x67023355UL, 0x3ebc7557UL, - 0x09d6b756UL, 0x8cc0f853UL, 0xbbaa3a52UL, 0xe2147c50UL, 0xd57ebe51UL, - 0xe839e25aUL, 0xdf53205bUL, 0x86ed6659UL, 0xb187a458UL, 0x3491eb5dUL, - 0x03fb295cUL, 0x5a456f5eUL, 0x6d2fad5fUL, 0x801b35e1UL, 0xb771f7e0UL, - 0xeecfb1e2UL, 0xd9a573e3UL, 0x5cb33ce6UL, 0x6bd9fee7UL, 0x3267b8e5UL, - 0x050d7ae4UL, 0x384a26efUL, 0x0f20e4eeUL, 0x569ea2ecUL, 0x61f460edUL, - 0xe4e22fe8UL, 0xd388ede9UL, 0x8a36abebUL, 0xbd5c69eaUL, 0xf0b813fdUL, - 0xc7d2d1fcUL, 0x9e6c97feUL, 0xa90655ffUL, 0x2c101afaUL, 0x1b7ad8fbUL, - 0x42c49ef9UL, 0x75ae5cf8UL, 0x48e900f3UL, 0x7f83c2f2UL, 0x263d84f0UL, - 0x115746f1UL, 0x944109f4UL, 0xa32bcbf5UL, 0xfa958df7UL, 0xcdff4ff6UL, - 0x605d78d9UL, 0x5737bad8UL, 0x0e89fcdaUL, 0x39e33edbUL, 0xbcf571deUL, - 0x8b9fb3dfUL, 0xd221f5ddUL, 0xe54b37dcUL, 0xd80c6bd7UL, 0xef66a9d6UL, - 0xb6d8efd4UL, 0x81b22dd5UL, 0x04a462d0UL, 0x33cea0d1UL, 0x6a70e6d3UL, - 0x5d1a24d2UL, 0x10fe5ec5UL, 0x27949cc4UL, 0x7e2adac6UL, 0x494018c7UL, - 0xcc5657c2UL, 0xfb3c95c3UL, 0xa282d3c1UL, 0x95e811c0UL, 0xa8af4dcbUL, - 0x9fc58fcaUL, 0xc67bc9c8UL, 0xf1110bc9UL, 0x740744ccUL, 0x436d86cdUL, - 0x1ad3c0cfUL, 0x2db902ceUL, 0x4096af91UL, 0x77fc6d90UL, 0x2e422b92UL, - 0x1928e993UL, 0x9c3ea696UL, 0xab546497UL, 0xf2ea2295UL, 0xc580e094UL, - 0xf8c7bc9fUL, 0xcfad7e9eUL, 0x9613389cUL, 0xa179fa9dUL, 0x246fb598UL, - 0x13057799UL, 0x4abb319bUL, 0x7dd1f39aUL, 0x3035898dUL, 0x075f4b8cUL, - 0x5ee10d8eUL, 0x698bcf8fUL, 0xec9d808aUL, 0xdbf7428bUL, 0x82490489UL, - 0xb523c688UL, 0x88649a83UL, 0xbf0e5882UL, 0xe6b01e80UL, 0xd1dadc81UL, - 0x54cc9384UL, 0x63a65185UL, 0x3a181787UL, 0x0d72d586UL, 0xa0d0e2a9UL, - 0x97ba20a8UL, 0xce0466aaUL, 0xf96ea4abUL, 0x7c78ebaeUL, 0x4b1229afUL, - 0x12ac6fadUL, 0x25c6adacUL, 0x1881f1a7UL, 0x2feb33a6UL, 0x765575a4UL, - 0x413fb7a5UL, 0xc429f8a0UL, 0xf3433aa1UL, 0xaafd7ca3UL, 0x9d97bea2UL, - 0xd073c4b5UL, 0xe71906b4UL, 0xbea740b6UL, 0x89cd82b7UL, 0x0cdbcdb2UL, - 0x3bb10fb3UL, 0x620f49b1UL, 0x55658bb0UL, 0x6822d7bbUL, 0x5f4815baUL, - 0x06f653b8UL, 0x319c91b9UL, 0xb48adebcUL, 0x83e01cbdUL, 0xda5e5abfUL, - 0xed3498beUL - }, - { - 0x00000000UL, 0x6567bcb8UL, 0x8bc809aaUL, 0xeeafb512UL, 0x5797628fUL, - 0x32f0de37UL, 0xdc5f6b25UL, 0xb938d79dUL, 0xef28b4c5UL, 0x8a4f087dUL, - 0x64e0bd6fUL, 0x018701d7UL, 0xb8bfd64aUL, 0xddd86af2UL, 0x3377dfe0UL, - 0x56106358UL, 0x9f571950UL, 0xfa30a5e8UL, 0x149f10faUL, 0x71f8ac42UL, - 0xc8c07bdfUL, 0xada7c767UL, 0x43087275UL, 0x266fcecdUL, 0x707fad95UL, - 0x1518112dUL, 0xfbb7a43fUL, 0x9ed01887UL, 0x27e8cf1aUL, 0x428f73a2UL, - 0xac20c6b0UL, 0xc9477a08UL, 0x3eaf32a0UL, 0x5bc88e18UL, 0xb5673b0aUL, - 0xd00087b2UL, 0x6938502fUL, 0x0c5fec97UL, 0xe2f05985UL, 0x8797e53dUL, - 0xd1878665UL, 0xb4e03addUL, 0x5a4f8fcfUL, 0x3f283377UL, 0x8610e4eaUL, - 0xe3775852UL, 0x0dd8ed40UL, 0x68bf51f8UL, 0xa1f82bf0UL, 0xc49f9748UL, - 0x2a30225aUL, 0x4f579ee2UL, 0xf66f497fUL, 0x9308f5c7UL, 0x7da740d5UL, - 0x18c0fc6dUL, 0x4ed09f35UL, 0x2bb7238dUL, 0xc518969fUL, 0xa07f2a27UL, - 0x1947fdbaUL, 0x7c204102UL, 0x928ff410UL, 0xf7e848a8UL, 0x3d58149bUL, - 0x583fa823UL, 0xb6901d31UL, 0xd3f7a189UL, 0x6acf7614UL, 0x0fa8caacUL, - 0xe1077fbeUL, 0x8460c306UL, 0xd270a05eUL, 0xb7171ce6UL, 0x59b8a9f4UL, - 0x3cdf154cUL, 0x85e7c2d1UL, 0xe0807e69UL, 0x0e2fcb7bUL, 0x6b4877c3UL, - 0xa20f0dcbUL, 0xc768b173UL, 0x29c70461UL, 0x4ca0b8d9UL, 0xf5986f44UL, - 0x90ffd3fcUL, 0x7e5066eeUL, 0x1b37da56UL, 0x4d27b90eUL, 0x284005b6UL, - 0xc6efb0a4UL, 0xa3880c1cUL, 0x1ab0db81UL, 0x7fd76739UL, 0x9178d22bUL, - 0xf41f6e93UL, 0x03f7263bUL, 0x66909a83UL, 0x883f2f91UL, 0xed589329UL, - 0x546044b4UL, 0x3107f80cUL, 0xdfa84d1eUL, 0xbacff1a6UL, 0xecdf92feUL, - 0x89b82e46UL, 0x67179b54UL, 0x027027ecUL, 0xbb48f071UL, 0xde2f4cc9UL, - 0x3080f9dbUL, 0x55e74563UL, 0x9ca03f6bUL, 0xf9c783d3UL, 0x176836c1UL, - 0x720f8a79UL, 0xcb375de4UL, 0xae50e15cUL, 0x40ff544eUL, 0x2598e8f6UL, - 0x73888baeUL, 0x16ef3716UL, 0xf8408204UL, 0x9d273ebcUL, 0x241fe921UL, - 0x41785599UL, 0xafd7e08bUL, 0xcab05c33UL, 0x3bb659edUL, 0x5ed1e555UL, - 0xb07e5047UL, 0xd519ecffUL, 0x6c213b62UL, 0x094687daUL, 0xe7e932c8UL, - 0x828e8e70UL, 0xd49eed28UL, 0xb1f95190UL, 0x5f56e482UL, 0x3a31583aUL, - 0x83098fa7UL, 0xe66e331fUL, 0x08c1860dUL, 0x6da63ab5UL, 0xa4e140bdUL, - 0xc186fc05UL, 0x2f294917UL, 0x4a4ef5afUL, 0xf3762232UL, 0x96119e8aUL, - 0x78be2b98UL, 0x1dd99720UL, 0x4bc9f478UL, 0x2eae48c0UL, 0xc001fdd2UL, - 0xa566416aUL, 0x1c5e96f7UL, 0x79392a4fUL, 0x97969f5dUL, 0xf2f123e5UL, - 0x05196b4dUL, 0x607ed7f5UL, 0x8ed162e7UL, 0xebb6de5fUL, 0x528e09c2UL, - 0x37e9b57aUL, 0xd9460068UL, 0xbc21bcd0UL, 0xea31df88UL, 0x8f566330UL, - 0x61f9d622UL, 0x049e6a9aUL, 0xbda6bd07UL, 0xd8c101bfUL, 0x366eb4adUL, - 0x53090815UL, 0x9a4e721dUL, 0xff29cea5UL, 0x11867bb7UL, 0x74e1c70fUL, - 0xcdd91092UL, 0xa8beac2aUL, 0x46111938UL, 0x2376a580UL, 0x7566c6d8UL, - 0x10017a60UL, 0xfeaecf72UL, 0x9bc973caUL, 0x22f1a457UL, 0x479618efUL, - 0xa939adfdUL, 0xcc5e1145UL, 0x06ee4d76UL, 0x6389f1ceUL, 0x8d2644dcUL, - 0xe841f864UL, 0x51792ff9UL, 0x341e9341UL, 0xdab12653UL, 0xbfd69aebUL, - 0xe9c6f9b3UL, 0x8ca1450bUL, 0x620ef019UL, 0x07694ca1UL, 0xbe519b3cUL, - 0xdb362784UL, 0x35999296UL, 0x50fe2e2eUL, 0x99b95426UL, 0xfcdee89eUL, - 0x12715d8cUL, 0x7716e134UL, 0xce2e36a9UL, 0xab498a11UL, 0x45e63f03UL, - 0x208183bbUL, 0x7691e0e3UL, 0x13f65c5bUL, 0xfd59e949UL, 0x983e55f1UL, - 0x2106826cUL, 0x44613ed4UL, 0xaace8bc6UL, 0xcfa9377eUL, 0x38417fd6UL, - 0x5d26c36eUL, 0xb389767cUL, 0xd6eecac4UL, 0x6fd61d59UL, 0x0ab1a1e1UL, - 0xe41e14f3UL, 0x8179a84bUL, 0xd769cb13UL, 0xb20e77abUL, 0x5ca1c2b9UL, - 0x39c67e01UL, 0x80fea99cUL, 0xe5991524UL, 0x0b36a036UL, 0x6e511c8eUL, - 0xa7166686UL, 0xc271da3eUL, 0x2cde6f2cUL, 0x49b9d394UL, 0xf0810409UL, - 0x95e6b8b1UL, 0x7b490da3UL, 0x1e2eb11bUL, 0x483ed243UL, 0x2d596efbUL, - 0xc3f6dbe9UL, 0xa6916751UL, 0x1fa9b0ccUL, 0x7ace0c74UL, 0x9461b966UL, - 0xf10605deUL -#endif - } -}; diff --git a/dependencies/zlib/deflate.c b/dependencies/zlib/deflate.c deleted file mode 100644 index 529f716b..00000000 --- a/dependencies/zlib/deflate.c +++ /dev/null @@ -1,1736 +0,0 @@ -/* deflate.c -- compress data using the deflation algorithm - * Copyright (C) 1995-2005 Jean-loup Gailly. - * For conditions of distribution and use, see copyright notice in zlib.h - */ - -/* - * ALGORITHM - * - * The "deflation" process depends on being able to identify portions - * of the input text which are identical to earlier input (within a - * sliding window trailing behind the input currently being processed). - * - * The most straightforward technique turns out to be the fastest for - * most input files: try all possible matches and select the longest. - * The key feature of this algorithm is that insertions into the string - * dictionary are very simple and thus fast, and deletions are avoided - * completely. Insertions are performed at each input character, whereas - * string matches are performed only when the previous match ends. So it - * is preferable to spend more time in matches to allow very fast string - * insertions and avoid deletions. The matching algorithm for small - * strings is inspired from that of Rabin & Karp. A brute force approach - * is used to find longer strings when a small match has been found. - * A similar algorithm is used in comic (by Jan-Mark Wams) and freeze - * (by Leonid Broukhis). - * A previous version of this file used a more sophisticated algorithm - * (by Fiala and Greene) which is guaranteed to run in linear amortized - * time, but has a larger average cost, uses more memory and is patented. - * However the F&G algorithm may be faster for some highly redundant - * files if the parameter max_chain_length (described below) is too large. - * - * ACKNOWLEDGEMENTS - * - * The idea of lazy evaluation of matches is due to Jan-Mark Wams, and - * I found it in 'freeze' written by Leonid Broukhis. - * Thanks to many people for bug reports and testing. - * - * REFERENCES - * - * Deutsch, L.P.,"DEFLATE Compressed Data Format Specification". - * Available in http://www.ietf.org/rfc/rfc1951.txt - * - * A description of the Rabin and Karp algorithm is given in the book - * "Algorithms" by R. Sedgewick, Addison-Wesley, p252. - * - * Fiala,E.R., and Greene,D.H. - * Data Compression with Finite Windows, Comm.ACM, 32,4 (1989) 490-595 - * - */ - -/* @(#) $Id$ */ - -#include "deflate.h" - -const char deflate_copyright[] = - " deflate 1.2.3 Copyright 1995-2005 Jean-loup Gailly "; -/* - If you use the zlib library in a product, an acknowledgment is welcome - in the documentation of your product. If for some reason you cannot - include such an acknowledgment, I would appreciate that you keep this - copyright string in the executable of your product. - */ - -/* =========================================================================== - * Function prototypes. - */ -typedef enum { - need_more, /* block not completed, need more input or more output */ - block_done, /* block flush performed */ - finish_started, /* finish started, need only more output at next deflate */ - finish_done /* finish done, accept no more input or output */ -} block_state; - -typedef block_state (*compress_func) OF((deflate_state *s, int flush)); -/* Compression function. Returns the block state after the call. */ - -local void fill_window OF((deflate_state *s)); -local block_state deflate_stored OF((deflate_state *s, int flush)); -local block_state deflate_fast OF((deflate_state *s, int flush)); -#ifndef FASTEST -local block_state deflate_slow OF((deflate_state *s, int flush)); -#endif -local void lm_init OF((deflate_state *s)); -local void putShortMSB OF((deflate_state *s, uInt b)); -local void flush_pending OF((z_streamp strm)); -local int read_buf OF((z_streamp strm, Bytef *buf, unsigned size)); -#ifndef FASTEST -#ifdef ASMV - void match_init OF((void)); /* asm code initialization */ - uInt longest_match OF((deflate_state *s, IPos cur_match)); -#else -local uInt longest_match OF((deflate_state *s, IPos cur_match)); -#endif -#endif -local uInt longest_match_fast OF((deflate_state *s, IPos cur_match)); - -#ifdef DEBUG -local void check_match OF((deflate_state *s, IPos start, IPos match, - int length)); -#endif - -/* =========================================================================== - * Local data - */ - -#define NIL 0 -/* Tail of hash chains */ - -#ifndef TOO_FAR -# define TOO_FAR 4096 -#endif -/* Matches of length 3 are discarded if their distance exceeds TOO_FAR */ - -#define MIN_LOOKAHEAD (MAX_MATCH+MIN_MATCH+1) -/* Minimum amount of lookahead, except at the end of the input file. - * See deflate.c for comments about the MIN_MATCH+1. - */ - -/* Values for max_lazy_match, good_match and max_chain_length, depending on - * the desired pack level (0..9). The values given below have been tuned to - * exclude worst case performance for pathological files. Better values may be - * found for specific files. - */ -typedef struct config_s { - ush good_length; /* reduce lazy search above this match length */ - ush max_lazy; /* do not perform lazy search above this match length */ - ush nice_length; /* quit search above this match length */ - ush max_chain; - compress_func func; -} config; - -#ifdef FASTEST -local const config configuration_table[2] = { -/* good lazy nice chain */ -/* 0 */ {0, 0, 0, 0, deflate_stored}, /* store only */ -/* 1 */ {4, 4, 8, 4, deflate_fast}}; /* max speed, no lazy matches */ -#else -local const config configuration_table[10] = { -/* good lazy nice chain */ -/* 0 */ {0, 0, 0, 0, deflate_stored}, /* store only */ -/* 1 */ {4, 4, 8, 4, deflate_fast}, /* max speed, no lazy matches */ -/* 2 */ {4, 5, 16, 8, deflate_fast}, -/* 3 */ {4, 6, 32, 32, deflate_fast}, - -/* 4 */ {4, 4, 16, 16, deflate_slow}, /* lazy matches */ -/* 5 */ {8, 16, 32, 32, deflate_slow}, -/* 6 */ {8, 16, 128, 128, deflate_slow}, -/* 7 */ {8, 32, 128, 256, deflate_slow}, -/* 8 */ {32, 128, 258, 1024, deflate_slow}, -/* 9 */ {32, 258, 258, 4096, deflate_slow}}; /* max compression */ -#endif - -/* Note: the deflate() code requires max_lazy >= MIN_MATCH and max_chain >= 4 - * For deflate_fast() (levels <= 3) good is ignored and lazy has a different - * meaning. - */ - -#define EQUAL 0 -/* result of memcmp for equal strings */ - -#ifndef NO_DUMMY_DECL -struct static_tree_desc_s {int dummy;}; /* for buggy compilers */ -#endif - -/* =========================================================================== - * Update a hash value with the given input byte - * IN assertion: all calls to to UPDATE_HASH are made with consecutive - * input characters, so that a running hash key can be computed from the - * previous key instead of complete recalculation each time. - */ -#define UPDATE_HASH(s,h,c) (h = (((h)<hash_shift) ^ (c)) & s->hash_mask) - - -/* =========================================================================== - * Insert string str in the dictionary and set match_head to the previous head - * of the hash chain (the most recent string with same hash key). Return - * the previous length of the hash chain. - * If this file is compiled with -DFASTEST, the compression level is forced - * to 1, and no hash chains are maintained. - * IN assertion: all calls to to INSERT_STRING are made with consecutive - * input characters and the first MIN_MATCH bytes of str are valid - * (except for the last MIN_MATCH-1 bytes of the input file). - */ -#ifdef FASTEST -#define INSERT_STRING(s, str, match_head) \ - (UPDATE_HASH(s, s->ins_h, s->window[(str) + (MIN_MATCH-1)]), \ - match_head = s->head[s->ins_h], \ - s->head[s->ins_h] = (Pos)(str)) -#else -#define INSERT_STRING(s, str, match_head) \ - (UPDATE_HASH(s, s->ins_h, s->window[(str) + (MIN_MATCH-1)]), \ - match_head = s->prev[(str) & s->w_mask] = s->head[s->ins_h], \ - s->head[s->ins_h] = (Pos)(str)) -#endif - -/* =========================================================================== - * Initialize the hash table (avoiding 64K overflow for 16 bit systems). - * prev[] will be initialized on the fly. - */ -#define CLEAR_HASH(s) \ - s->head[s->hash_size-1] = NIL; \ - zmemzero((Bytef *)s->head, (unsigned)(s->hash_size-1)*sizeof(*s->head)); - -/* ========================================================================= */ -int ZEXPORT deflateInit_(strm, level, version, stream_size) - z_streamp strm; - int level; - const char *version; - int stream_size; -{ - return deflateInit2_(strm, level, Z_DEFLATED, MAX_WBITS, DEF_MEM_LEVEL, - Z_DEFAULT_STRATEGY, version, stream_size); - /* To do: ignore strm->next_in if we use it as window */ -} - -/* ========================================================================= */ -int ZEXPORT deflateInit2_(strm, level, method, windowBits, memLevel, strategy, - version, stream_size) - z_streamp strm; - int level; - int method; - int windowBits; - int memLevel; - int strategy; - const char *version; - int stream_size; -{ - deflate_state *s; - int wrap = 1; - static const char my_version[] = ZLIB_VERSION; - - ushf *overlay; - /* We overlay pending_buf and d_buf+l_buf. This works since the average - * output size for (length,distance) codes is <= 24 bits. - */ - - if (version == Z_NULL || version[0] != my_version[0] || - stream_size != sizeof(z_stream)) { - return Z_VERSION_ERROR; - } - if (strm == Z_NULL) return Z_STREAM_ERROR; - - strm->msg = Z_NULL; - if (strm->zalloc == (alloc_func)0) { - strm->zalloc = zcalloc; - strm->opaque = (voidpf)0; - } - if (strm->zfree == (free_func)0) strm->zfree = zcfree; - -#ifdef FASTEST - if (level != 0) level = 1; -#else - if (level == Z_DEFAULT_COMPRESSION) level = 6; -#endif - - if (windowBits < 0) { /* suppress zlib wrapper */ - wrap = 0; - windowBits = -windowBits; - } -#ifdef GZIP - else if (windowBits > 15) { - wrap = 2; /* write gzip wrapper instead */ - windowBits -= 16; - } -#endif - if (memLevel < 1 || memLevel > MAX_MEM_LEVEL || method != Z_DEFLATED || - windowBits < 8 || windowBits > 15 || level < 0 || level > 9 || - strategy < 0 || strategy > Z_FIXED) { - return Z_STREAM_ERROR; - } - if (windowBits == 8) windowBits = 9; /* until 256-byte window bug fixed */ - s = (deflate_state *) ZALLOC(strm, 1, sizeof(deflate_state)); - if (s == Z_NULL) return Z_MEM_ERROR; - strm->state = (struct internal_state FAR *)s; - s->strm = strm; - - s->wrap = wrap; - s->gzhead = Z_NULL; - s->w_bits = windowBits; - s->w_size = 1 << s->w_bits; - s->w_mask = s->w_size - 1; - - s->hash_bits = memLevel + 7; - s->hash_size = 1 << s->hash_bits; - s->hash_mask = s->hash_size - 1; - s->hash_shift = ((s->hash_bits+MIN_MATCH-1)/MIN_MATCH); - - s->window = (Bytef *) ZALLOC(strm, s->w_size, 2*sizeof(Byte)); - s->prev = (Posf *) ZALLOC(strm, s->w_size, sizeof(Pos)); - s->head = (Posf *) ZALLOC(strm, s->hash_size, sizeof(Pos)); - - s->lit_bufsize = 1 << (memLevel + 6); /* 16K elements by default */ - - overlay = (ushf *) ZALLOC(strm, s->lit_bufsize, sizeof(ush)+2); - s->pending_buf = (uchf *) overlay; - s->pending_buf_size = (ulg)s->lit_bufsize * (sizeof(ush)+2L); - - if (s->window == Z_NULL || s->prev == Z_NULL || s->head == Z_NULL || - s->pending_buf == Z_NULL) { - s->status = FINISH_STATE; - strm->msg = (char*)ERR_MSG(Z_MEM_ERROR); - deflateEnd (strm); - return Z_MEM_ERROR; - } - s->d_buf = overlay + s->lit_bufsize/sizeof(ush); - s->l_buf = s->pending_buf + (1+sizeof(ush))*s->lit_bufsize; - - s->level = level; - s->strategy = strategy; - s->method = (Byte)method; - - return deflateReset(strm); -} - -/* ========================================================================= */ -int ZEXPORT deflateSetDictionary (strm, dictionary, dictLength) - z_streamp strm; - const Bytef *dictionary; - uInt dictLength; -{ - deflate_state *s; - uInt length = dictLength; - uInt n; - IPos hash_head = 0; - - if (strm == Z_NULL || strm->state == Z_NULL || dictionary == Z_NULL || - strm->state->wrap == 2 || - (strm->state->wrap == 1 && strm->state->status != INIT_STATE)) - return Z_STREAM_ERROR; - - s = strm->state; - if (s->wrap) - strm->adler = adler32(strm->adler, dictionary, dictLength); - - if (length < MIN_MATCH) return Z_OK; - if (length > MAX_DIST(s)) { - length = MAX_DIST(s); - dictionary += dictLength - length; /* use the tail of the dictionary */ - } - zmemcpy(s->window, dictionary, length); - s->strstart = length; - s->block_start = (long)length; - - /* Insert all strings in the hash table (except for the last two bytes). - * s->lookahead stays null, so s->ins_h will be recomputed at the next - * call of fill_window. - */ - s->ins_h = s->window[0]; - UPDATE_HASH(s, s->ins_h, s->window[1]); - for (n = 0; n <= length - MIN_MATCH; n++) { - INSERT_STRING(s, n, hash_head); - } - if (hash_head) hash_head = 0; /* to make compiler happy */ - return Z_OK; -} - -/* ========================================================================= */ -int ZEXPORT deflateReset (strm) - z_streamp strm; -{ - deflate_state *s; - - if (strm == Z_NULL || strm->state == Z_NULL || - strm->zalloc == (alloc_func)0 || strm->zfree == (free_func)0) { - return Z_STREAM_ERROR; - } - - strm->total_in = strm->total_out = 0; - strm->msg = Z_NULL; /* use zfree if we ever allocate msg dynamically */ - strm->data_type = Z_UNKNOWN; - - s = (deflate_state *)strm->state; - s->pending = 0; - s->pending_out = s->pending_buf; - - if (s->wrap < 0) { - s->wrap = -s->wrap; /* was made negative by deflate(..., Z_FINISH); */ - } - s->status = s->wrap ? INIT_STATE : BUSY_STATE; - strm->adler = -#ifdef GZIP - s->wrap == 2 ? crc32(0L, Z_NULL, 0) : -#endif - adler32(0L, Z_NULL, 0); - s->last_flush = Z_NO_FLUSH; - - _tr_init(s); - lm_init(s); - - return Z_OK; -} - -/* ========================================================================= */ -int ZEXPORT deflateSetHeader (strm, head) - z_streamp strm; - gz_headerp head; -{ - if (strm == Z_NULL || strm->state == Z_NULL) return Z_STREAM_ERROR; - if (strm->state->wrap != 2) return Z_STREAM_ERROR; - strm->state->gzhead = head; - return Z_OK; -} - -/* ========================================================================= */ -int ZEXPORT deflatePrime (strm, bits, value) - z_streamp strm; - int bits; - int value; -{ - if (strm == Z_NULL || strm->state == Z_NULL) return Z_STREAM_ERROR; - strm->state->bi_valid = bits; - strm->state->bi_buf = (ush)(value & ((1 << bits) - 1)); - return Z_OK; -} - -/* ========================================================================= */ -int ZEXPORT deflateParams(strm, level, strategy) - z_streamp strm; - int level; - int strategy; -{ - deflate_state *s; - compress_func func; - int err = Z_OK; - - if (strm == Z_NULL || strm->state == Z_NULL) return Z_STREAM_ERROR; - s = strm->state; - -#ifdef FASTEST - if (level != 0) level = 1; -#else - if (level == Z_DEFAULT_COMPRESSION) level = 6; -#endif - if (level < 0 || level > 9 || strategy < 0 || strategy > Z_FIXED) { - return Z_STREAM_ERROR; - } - func = configuration_table[s->level].func; - - if (func != configuration_table[level].func && strm->total_in != 0) { - /* Flush the last buffer: */ - err = deflate(strm, Z_PARTIAL_FLUSH); - } - if (s->level != level) { - s->level = level; - s->max_lazy_match = configuration_table[level].max_lazy; - s->good_match = configuration_table[level].good_length; - s->nice_match = configuration_table[level].nice_length; - s->max_chain_length = configuration_table[level].max_chain; - } - s->strategy = strategy; - return err; -} - -/* ========================================================================= */ -int ZEXPORT deflateTune(strm, good_length, max_lazy, nice_length, max_chain) - z_streamp strm; - int good_length; - int max_lazy; - int nice_length; - int max_chain; -{ - deflate_state *s; - - if (strm == Z_NULL || strm->state == Z_NULL) return Z_STREAM_ERROR; - s = strm->state; - s->good_match = good_length; - s->max_lazy_match = max_lazy; - s->nice_match = nice_length; - s->max_chain_length = max_chain; - return Z_OK; -} - -/* ========================================================================= - * For the default windowBits of 15 and memLevel of 8, this function returns - * a close to exact, as well as small, upper bound on the compressed size. - * They are coded as constants here for a reason--if the #define's are - * changed, then this function needs to be changed as well. The return - * value for 15 and 8 only works for those exact settings. - * - * For any setting other than those defaults for windowBits and memLevel, - * the value returned is a conservative worst case for the maximum expansion - * resulting from using fixed blocks instead of stored blocks, which deflate - * can emit on compressed data for some combinations of the parameters. - * - * This function could be more sophisticated to provide closer upper bounds - * for every combination of windowBits and memLevel, as well as wrap. - * But even the conservative upper bound of about 14% expansion does not - * seem onerous for output buffer allocation. - */ -uLong ZEXPORT deflateBound(strm, sourceLen) - z_streamp strm; - uLong sourceLen; -{ - deflate_state *s; - uLong destLen; - - /* conservative upper bound */ - destLen = sourceLen + - ((sourceLen + 7) >> 3) + ((sourceLen + 63) >> 6) + 11; - - /* if can't get parameters, return conservative bound */ - if (strm == Z_NULL || strm->state == Z_NULL) - return destLen; - - /* if not default parameters, return conservative bound */ - s = strm->state; - if (s->w_bits != 15 || s->hash_bits != 8 + 7) - return destLen; - - /* default settings: return tight bound for that case */ - return compressBound(sourceLen); -} - -/* ========================================================================= - * Put a short in the pending buffer. The 16-bit value is put in MSB order. - * IN assertion: the stream state is correct and there is enough room in - * pending_buf. - */ -local void putShortMSB (s, b) - deflate_state *s; - uInt b; -{ - put_byte(s, (Byte)(b >> 8)); - put_byte(s, (Byte)(b & 0xff)); -} - -/* ========================================================================= - * Flush as much pending output as possible. All deflate() output goes - * through this function so some applications may wish to modify it - * to avoid allocating a large strm->next_out buffer and copying into it. - * (See also read_buf()). - */ -local void flush_pending(strm) - z_streamp strm; -{ - unsigned len = strm->state->pending; - - if (len > strm->avail_out) len = strm->avail_out; - if (len == 0) return; - - zmemcpy(strm->next_out, strm->state->pending_out, len); - strm->next_out += len; - strm->state->pending_out += len; - strm->total_out += len; - strm->avail_out -= len; - strm->state->pending -= len; - if (strm->state->pending == 0) { - strm->state->pending_out = strm->state->pending_buf; - } -} - -/* ========================================================================= */ -int ZEXPORT deflate (strm, flush) - z_streamp strm; - int flush; -{ - int old_flush; /* value of flush param for previous deflate call */ - deflate_state *s; - - if (strm == Z_NULL || strm->state == Z_NULL || - flush > Z_FINISH || flush < 0) { - return Z_STREAM_ERROR; - } - s = strm->state; - - if (strm->next_out == Z_NULL || - (strm->next_in == Z_NULL && strm->avail_in != 0) || - (s->status == FINISH_STATE && flush != Z_FINISH)) { - ERR_RETURN(strm, Z_STREAM_ERROR); - } - if (strm->avail_out == 0) ERR_RETURN(strm, Z_BUF_ERROR); - - s->strm = strm; /* just in case */ - old_flush = s->last_flush; - s->last_flush = flush; - - /* Write the header */ - if (s->status == INIT_STATE) { -#ifdef GZIP - if (s->wrap == 2) { - strm->adler = crc32(0L, Z_NULL, 0); - put_byte(s, 31); - put_byte(s, 139); - put_byte(s, 8); - if (s->gzhead == NULL) { - put_byte(s, 0); - put_byte(s, 0); - put_byte(s, 0); - put_byte(s, 0); - put_byte(s, 0); - put_byte(s, s->level == 9 ? 2 : - (s->strategy >= Z_HUFFMAN_ONLY || s->level < 2 ? - 4 : 0)); - put_byte(s, OS_CODE); - s->status = BUSY_STATE; - } - else { - put_byte(s, (s->gzhead->text ? 1 : 0) + - (s->gzhead->hcrc ? 2 : 0) + - (s->gzhead->extra == Z_NULL ? 0 : 4) + - (s->gzhead->name == Z_NULL ? 0 : 8) + - (s->gzhead->comment == Z_NULL ? 0 : 16) - ); - put_byte(s, (Byte)(s->gzhead->time & 0xff)); - put_byte(s, (Byte)((s->gzhead->time >> 8) & 0xff)); - put_byte(s, (Byte)((s->gzhead->time >> 16) & 0xff)); - put_byte(s, (Byte)((s->gzhead->time >> 24) & 0xff)); - put_byte(s, s->level == 9 ? 2 : - (s->strategy >= Z_HUFFMAN_ONLY || s->level < 2 ? - 4 : 0)); - put_byte(s, s->gzhead->os & 0xff); - if (s->gzhead->extra != NULL) { - put_byte(s, s->gzhead->extra_len & 0xff); - put_byte(s, (s->gzhead->extra_len >> 8) & 0xff); - } - if (s->gzhead->hcrc) - strm->adler = crc32(strm->adler, s->pending_buf, - s->pending); - s->gzindex = 0; - s->status = EXTRA_STATE; - } - } - else -#endif - { - uInt header = (Z_DEFLATED + ((s->w_bits-8)<<4)) << 8; - uInt level_flags; - - if (s->strategy >= Z_HUFFMAN_ONLY || s->level < 2) - level_flags = 0; - else if (s->level < 6) - level_flags = 1; - else if (s->level == 6) - level_flags = 2; - else - level_flags = 3; - header |= (level_flags << 6); - if (s->strstart != 0) header |= PRESET_DICT; - header += 31 - (header % 31); - - s->status = BUSY_STATE; - putShortMSB(s, header); - - /* Save the adler32 of the preset dictionary: */ - if (s->strstart != 0) { - putShortMSB(s, (uInt)(strm->adler >> 16)); - putShortMSB(s, (uInt)(strm->adler & 0xffff)); - } - strm->adler = adler32(0L, Z_NULL, 0); - } - } -#ifdef GZIP - if (s->status == EXTRA_STATE) { - if (s->gzhead->extra != NULL) { - uInt beg = s->pending; /* start of bytes to update crc */ - - while (s->gzindex < (s->gzhead->extra_len & 0xffff)) { - if (s->pending == s->pending_buf_size) { - if (s->gzhead->hcrc && s->pending > beg) - strm->adler = crc32(strm->adler, s->pending_buf + beg, - s->pending - beg); - flush_pending(strm); - beg = s->pending; - if (s->pending == s->pending_buf_size) - break; - } - put_byte(s, s->gzhead->extra[s->gzindex]); - s->gzindex++; - } - if (s->gzhead->hcrc && s->pending > beg) - strm->adler = crc32(strm->adler, s->pending_buf + beg, - s->pending - beg); - if (s->gzindex == s->gzhead->extra_len) { - s->gzindex = 0; - s->status = NAME_STATE; - } - } - else - s->status = NAME_STATE; - } - if (s->status == NAME_STATE) { - if (s->gzhead->name != NULL) { - uInt beg = s->pending; /* start of bytes to update crc */ - int val; - - do { - if (s->pending == s->pending_buf_size) { - if (s->gzhead->hcrc && s->pending > beg) - strm->adler = crc32(strm->adler, s->pending_buf + beg, - s->pending - beg); - flush_pending(strm); - beg = s->pending; - if (s->pending == s->pending_buf_size) { - val = 1; - break; - } - } - val = s->gzhead->name[s->gzindex++]; - put_byte(s, val); - } while (val != 0); - if (s->gzhead->hcrc && s->pending > beg) - strm->adler = crc32(strm->adler, s->pending_buf + beg, - s->pending - beg); - if (val == 0) { - s->gzindex = 0; - s->status = COMMENT_STATE; - } - } - else - s->status = COMMENT_STATE; - } - if (s->status == COMMENT_STATE) { - if (s->gzhead->comment != NULL) { - uInt beg = s->pending; /* start of bytes to update crc */ - int val; - - do { - if (s->pending == s->pending_buf_size) { - if (s->gzhead->hcrc && s->pending > beg) - strm->adler = crc32(strm->adler, s->pending_buf + beg, - s->pending - beg); - flush_pending(strm); - beg = s->pending; - if (s->pending == s->pending_buf_size) { - val = 1; - break; - } - } - val = s->gzhead->comment[s->gzindex++]; - put_byte(s, val); - } while (val != 0); - if (s->gzhead->hcrc && s->pending > beg) - strm->adler = crc32(strm->adler, s->pending_buf + beg, - s->pending - beg); - if (val == 0) - s->status = HCRC_STATE; - } - else - s->status = HCRC_STATE; - } - if (s->status == HCRC_STATE) { - if (s->gzhead->hcrc) { - if (s->pending + 2 > s->pending_buf_size) - flush_pending(strm); - if (s->pending + 2 <= s->pending_buf_size) { - put_byte(s, (Byte)(strm->adler & 0xff)); - put_byte(s, (Byte)((strm->adler >> 8) & 0xff)); - strm->adler = crc32(0L, Z_NULL, 0); - s->status = BUSY_STATE; - } - } - else - s->status = BUSY_STATE; - } -#endif - - /* Flush as much pending output as possible */ - if (s->pending != 0) { - flush_pending(strm); - if (strm->avail_out == 0) { - /* Since avail_out is 0, deflate will be called again with - * more output space, but possibly with both pending and - * avail_in equal to zero. There won't be anything to do, - * but this is not an error situation so make sure we - * return OK instead of BUF_ERROR at next call of deflate: - */ - s->last_flush = -1; - return Z_OK; - } - - /* Make sure there is something to do and avoid duplicate consecutive - * flushes. For repeated and useless calls with Z_FINISH, we keep - * returning Z_STREAM_END instead of Z_BUF_ERROR. - */ - } else if (strm->avail_in == 0 && flush <= old_flush && - flush != Z_FINISH) { - ERR_RETURN(strm, Z_BUF_ERROR); - } - - /* User must not provide more input after the first FINISH: */ - if (s->status == FINISH_STATE && strm->avail_in != 0) { - ERR_RETURN(strm, Z_BUF_ERROR); - } - - /* Start a new block or continue the current one. - */ - if (strm->avail_in != 0 || s->lookahead != 0 || - (flush != Z_NO_FLUSH && s->status != FINISH_STATE)) { - block_state bstate; - - bstate = (*(configuration_table[s->level].func))(s, flush); - - if (bstate == finish_started || bstate == finish_done) { - s->status = FINISH_STATE; - } - if (bstate == need_more || bstate == finish_started) { - if (strm->avail_out == 0) { - s->last_flush = -1; /* avoid BUF_ERROR next call, see above */ - } - return Z_OK; - /* If flush != Z_NO_FLUSH && avail_out == 0, the next call - * of deflate should use the same flush parameter to make sure - * that the flush is complete. So we don't have to output an - * empty block here, this will be done at next call. This also - * ensures that for a very small output buffer, we emit at most - * one empty block. - */ - } - if (bstate == block_done) { - if (flush == Z_PARTIAL_FLUSH) { - _tr_align(s); - } else { /* FULL_FLUSH or SYNC_FLUSH */ - _tr_stored_block(s, (char*)0, 0L, 0); - /* For a full flush, this empty block will be recognized - * as a special marker by inflate_sync(). - */ - if (flush == Z_FULL_FLUSH) { - CLEAR_HASH(s); /* forget history */ - } - } - flush_pending(strm); - if (strm->avail_out == 0) { - s->last_flush = -1; /* avoid BUF_ERROR at next call, see above */ - return Z_OK; - } - } - } - Assert(strm->avail_out > 0, "bug2"); - - if (flush != Z_FINISH) return Z_OK; - if (s->wrap <= 0) return Z_STREAM_END; - - /* Write the trailer */ -#ifdef GZIP - if (s->wrap == 2) { - put_byte(s, (Byte)(strm->adler & 0xff)); - put_byte(s, (Byte)((strm->adler >> 8) & 0xff)); - put_byte(s, (Byte)((strm->adler >> 16) & 0xff)); - put_byte(s, (Byte)((strm->adler >> 24) & 0xff)); - put_byte(s, (Byte)(strm->total_in & 0xff)); - put_byte(s, (Byte)((strm->total_in >> 8) & 0xff)); - put_byte(s, (Byte)((strm->total_in >> 16) & 0xff)); - put_byte(s, (Byte)((strm->total_in >> 24) & 0xff)); - } - else -#endif - { - putShortMSB(s, (uInt)(strm->adler >> 16)); - putShortMSB(s, (uInt)(strm->adler & 0xffff)); - } - flush_pending(strm); - /* If avail_out is zero, the application will call deflate again - * to flush the rest. - */ - if (s->wrap > 0) s->wrap = -s->wrap; /* write the trailer only once! */ - return s->pending != 0 ? Z_OK : Z_STREAM_END; -} - -/* ========================================================================= */ -int ZEXPORT deflateEnd (strm) - z_streamp strm; -{ - int status; - - if (strm == Z_NULL || strm->state == Z_NULL) return Z_STREAM_ERROR; - - status = strm->state->status; - if (status != INIT_STATE && - status != EXTRA_STATE && - status != NAME_STATE && - status != COMMENT_STATE && - status != HCRC_STATE && - status != BUSY_STATE && - status != FINISH_STATE) { - return Z_STREAM_ERROR; - } - - /* Deallocate in reverse order of allocations: */ - TRY_FREE(strm, strm->state->pending_buf); - TRY_FREE(strm, strm->state->head); - TRY_FREE(strm, strm->state->prev); - TRY_FREE(strm, strm->state->window); - - ZFREE(strm, strm->state); - strm->state = Z_NULL; - - return status == BUSY_STATE ? Z_DATA_ERROR : Z_OK; -} - -/* ========================================================================= - * Copy the source state to the destination state. - * To simplify the source, this is not supported for 16-bit MSDOS (which - * doesn't have enough memory anyway to duplicate compression states). - */ -int ZEXPORT deflateCopy (dest, source) - z_streamp dest; - z_streamp source; -{ -#ifdef MAXSEG_64K - return Z_STREAM_ERROR; -#else - deflate_state *ds; - deflate_state *ss; - ushf *overlay; - - - if (source == Z_NULL || dest == Z_NULL || source->state == Z_NULL) { - return Z_STREAM_ERROR; - } - - ss = source->state; - - zmemcpy(dest, source, sizeof(z_stream)); - - ds = (deflate_state *) ZALLOC(dest, 1, sizeof(deflate_state)); - if (ds == Z_NULL) return Z_MEM_ERROR; - dest->state = (struct internal_state FAR *) ds; - zmemcpy(ds, ss, sizeof(deflate_state)); - ds->strm = dest; - - ds->window = (Bytef *) ZALLOC(dest, ds->w_size, 2*sizeof(Byte)); - ds->prev = (Posf *) ZALLOC(dest, ds->w_size, sizeof(Pos)); - ds->head = (Posf *) ZALLOC(dest, ds->hash_size, sizeof(Pos)); - overlay = (ushf *) ZALLOC(dest, ds->lit_bufsize, sizeof(ush)+2); - ds->pending_buf = (uchf *) overlay; - - if (ds->window == Z_NULL || ds->prev == Z_NULL || ds->head == Z_NULL || - ds->pending_buf == Z_NULL) { - deflateEnd (dest); - return Z_MEM_ERROR; - } - /* following zmemcpy do not work for 16-bit MSDOS */ - zmemcpy(ds->window, ss->window, ds->w_size * 2 * sizeof(Byte)); - zmemcpy(ds->prev, ss->prev, ds->w_size * sizeof(Pos)); - zmemcpy(ds->head, ss->head, ds->hash_size * sizeof(Pos)); - zmemcpy(ds->pending_buf, ss->pending_buf, (uInt)ds->pending_buf_size); - - ds->pending_out = ds->pending_buf + (ss->pending_out - ss->pending_buf); - ds->d_buf = overlay + ds->lit_bufsize/sizeof(ush); - ds->l_buf = ds->pending_buf + (1+sizeof(ush))*ds->lit_bufsize; - - ds->l_desc.dyn_tree = ds->dyn_ltree; - ds->d_desc.dyn_tree = ds->dyn_dtree; - ds->bl_desc.dyn_tree = ds->bl_tree; - - return Z_OK; -#endif /* MAXSEG_64K */ -} - -/* =========================================================================== - * Read a new buffer from the current input stream, update the adler32 - * and total number of bytes read. All deflate() input goes through - * this function so some applications may wish to modify it to avoid - * allocating a large strm->next_in buffer and copying from it. - * (See also flush_pending()). - */ -local int read_buf(strm, buf, size) - z_streamp strm; - Bytef *buf; - unsigned size; -{ - unsigned len = strm->avail_in; - - if (len > size) len = size; - if (len == 0) return 0; - - strm->avail_in -= len; - - if (strm->state->wrap == 1) { - strm->adler = adler32(strm->adler, strm->next_in, len); - } -#ifdef GZIP - else if (strm->state->wrap == 2) { - strm->adler = crc32(strm->adler, strm->next_in, len); - } -#endif - zmemcpy(buf, strm->next_in, len); - strm->next_in += len; - strm->total_in += len; - - return (int)len; -} - -/* =========================================================================== - * Initialize the "longest match" routines for a new zlib stream - */ -local void lm_init (s) - deflate_state *s; -{ - s->window_size = (ulg)2L*s->w_size; - - CLEAR_HASH(s); - - /* Set the default configuration parameters: - */ - s->max_lazy_match = configuration_table[s->level].max_lazy; - s->good_match = configuration_table[s->level].good_length; - s->nice_match = configuration_table[s->level].nice_length; - s->max_chain_length = configuration_table[s->level].max_chain; - - s->strstart = 0; - s->block_start = 0L; - s->lookahead = 0; - s->match_length = s->prev_length = MIN_MATCH-1; - s->match_available = 0; - s->ins_h = 0; -#ifndef FASTEST -#ifdef ASMV - match_init(); /* initialize the asm code */ -#endif -#endif -} - -#ifndef FASTEST -/* =========================================================================== - * Set match_start to the longest match starting at the given string and - * return its length. Matches shorter or equal to prev_length are discarded, - * in which case the result is equal to prev_length and match_start is - * garbage. - * IN assertions: cur_match is the head of the hash chain for the current - * string (strstart) and its distance is <= MAX_DIST, and prev_length >= 1 - * OUT assertion: the match length is not greater than s->lookahead. - */ -#ifndef ASMV -/* For 80x86 and 680x0, an optimized version will be provided in match.asm or - * match.S. The code will be functionally equivalent. - */ -local uInt longest_match(s, cur_match) - deflate_state *s; - IPos cur_match; /* current match */ -{ - unsigned chain_length = s->max_chain_length;/* max hash chain length */ - register Bytef *scan = s->window + s->strstart; /* current string */ - register Bytef *match; /* matched string */ - register int len; /* length of current match */ - int best_len = s->prev_length; /* best match length so far */ - int nice_match = s->nice_match; /* stop if match long enough */ - IPos limit = s->strstart > (IPos)MAX_DIST(s) ? - s->strstart - (IPos)MAX_DIST(s) : NIL; - /* Stop when cur_match becomes <= limit. To simplify the code, - * we prevent matches with the string of window index 0. - */ - Posf *prev = s->prev; - uInt wmask = s->w_mask; - -#ifdef UNALIGNED_OK - /* Compare two bytes at a time. Note: this is not always beneficial. - * Try with and without -DUNALIGNED_OK to check. - */ - register Bytef *strend = s->window + s->strstart + MAX_MATCH - 1; - register ush scan_start = *(ushf*)scan; - register ush scan_end = *(ushf*)(scan+best_len-1); -#else - register Bytef *strend = s->window + s->strstart + MAX_MATCH; - register Byte scan_end1 = scan[best_len-1]; - register Byte scan_end = scan[best_len]; -#endif - - /* The code is optimized for HASH_BITS >= 8 and MAX_MATCH-2 multiple of 16. - * It is easy to get rid of this optimization if necessary. - */ - Assert(s->hash_bits >= 8 && MAX_MATCH == 258, "Code too clever"); - - /* Do not waste too much time if we already have a good match: */ - if (s->prev_length >= s->good_match) { - chain_length >>= 2; - } - /* Do not look for matches beyond the end of the input. This is necessary - * to make deflate deterministic. - */ - if ((uInt)nice_match > s->lookahead) nice_match = s->lookahead; - - Assert((ulg)s->strstart <= s->window_size-MIN_LOOKAHEAD, "need lookahead"); - - do { - Assert(cur_match < s->strstart, "no future"); - match = s->window + cur_match; - - /* Skip to next match if the match length cannot increase - * or if the match length is less than 2. Note that the checks below - * for insufficient lookahead only occur occasionally for performance - * reasons. Therefore uninitialized memory will be accessed, and - * conditional jumps will be made that depend on those values. - * However the length of the match is limited to the lookahead, so - * the output of deflate is not affected by the uninitialized values. - */ -#if (defined(UNALIGNED_OK) && MAX_MATCH == 258) - /* This code assumes sizeof(unsigned short) == 2. Do not use - * UNALIGNED_OK if your compiler uses a different size. - */ - if (*(ushf*)(match+best_len-1) != scan_end || - *(ushf*)match != scan_start) continue; - - /* It is not necessary to compare scan[2] and match[2] since they are - * always equal when the other bytes match, given that the hash keys - * are equal and that HASH_BITS >= 8. Compare 2 bytes at a time at - * strstart+3, +5, ... up to strstart+257. We check for insufficient - * lookahead only every 4th comparison; the 128th check will be made - * at strstart+257. If MAX_MATCH-2 is not a multiple of 8, it is - * necessary to put more guard bytes at the end of the window, or - * to check more often for insufficient lookahead. - */ - Assert(scan[2] == match[2], "scan[2]?"); - scan++, match++; - do { - } while (*(ushf*)(scan+=2) == *(ushf*)(match+=2) && - *(ushf*)(scan+=2) == *(ushf*)(match+=2) && - *(ushf*)(scan+=2) == *(ushf*)(match+=2) && - *(ushf*)(scan+=2) == *(ushf*)(match+=2) && - scan < strend); - /* The funny "do {}" generates better code on most compilers */ - - /* Here, scan <= window+strstart+257 */ - Assert(scan <= s->window+(unsigned)(s->window_size-1), "wild scan"); - if (*scan == *match) scan++; - - len = (MAX_MATCH - 1) - (int)(strend-scan); - scan = strend - (MAX_MATCH-1); - -#else /* UNALIGNED_OK */ - - if (match[best_len] != scan_end || - match[best_len-1] != scan_end1 || - *match != *scan || - *++match != scan[1]) continue; - - /* The check at best_len-1 can be removed because it will be made - * again later. (This heuristic is not always a win.) - * It is not necessary to compare scan[2] and match[2] since they - * are always equal when the other bytes match, given that - * the hash keys are equal and that HASH_BITS >= 8. - */ - scan += 2, match++; - Assert(*scan == *match, "match[2]?"); - - /* We check for insufficient lookahead only every 8th comparison; - * the 256th check will be made at strstart+258. - */ - do { - } while (*++scan == *++match && *++scan == *++match && - *++scan == *++match && *++scan == *++match && - *++scan == *++match && *++scan == *++match && - *++scan == *++match && *++scan == *++match && - scan < strend); - - Assert(scan <= s->window+(unsigned)(s->window_size-1), "wild scan"); - - len = MAX_MATCH - (int)(strend - scan); - scan = strend - MAX_MATCH; - -#endif /* UNALIGNED_OK */ - - if (len > best_len) { - s->match_start = cur_match; - best_len = len; - if (len >= nice_match) break; -#ifdef UNALIGNED_OK - scan_end = *(ushf*)(scan+best_len-1); -#else - scan_end1 = scan[best_len-1]; - scan_end = scan[best_len]; -#endif - } - } while ((cur_match = prev[cur_match & wmask]) > limit - && --chain_length != 0); - - if ((uInt)best_len <= s->lookahead) return (uInt)best_len; - return s->lookahead; -} -#endif /* ASMV */ -#endif /* FASTEST */ - -/* --------------------------------------------------------------------------- - * Optimized version for level == 1 or strategy == Z_RLE only - */ -local uInt longest_match_fast(s, cur_match) - deflate_state *s; - IPos cur_match; /* current match */ -{ - register Bytef *scan = s->window + s->strstart; /* current string */ - register Bytef *match; /* matched string */ - register int len; /* length of current match */ - register Bytef *strend = s->window + s->strstart + MAX_MATCH; - - /* The code is optimized for HASH_BITS >= 8 and MAX_MATCH-2 multiple of 16. - * It is easy to get rid of this optimization if necessary. - */ - Assert(s->hash_bits >= 8 && MAX_MATCH == 258, "Code too clever"); - - Assert((ulg)s->strstart <= s->window_size-MIN_LOOKAHEAD, "need lookahead"); - - Assert(cur_match < s->strstart, "no future"); - - match = s->window + cur_match; - - /* Return failure if the match length is less than 2: - */ - if (match[0] != scan[0] || match[1] != scan[1]) return MIN_MATCH-1; - - /* The check at best_len-1 can be removed because it will be made - * again later. (This heuristic is not always a win.) - * It is not necessary to compare scan[2] and match[2] since they - * are always equal when the other bytes match, given that - * the hash keys are equal and that HASH_BITS >= 8. - */ - scan += 2, match += 2; - Assert(*scan == *match, "match[2]?"); - - /* We check for insufficient lookahead only every 8th comparison; - * the 256th check will be made at strstart+258. - */ - do { - } while (*++scan == *++match && *++scan == *++match && - *++scan == *++match && *++scan == *++match && - *++scan == *++match && *++scan == *++match && - *++scan == *++match && *++scan == *++match && - scan < strend); - - Assert(scan <= s->window+(unsigned)(s->window_size-1), "wild scan"); - - len = MAX_MATCH - (int)(strend - scan); - - if (len < MIN_MATCH) return MIN_MATCH - 1; - - s->match_start = cur_match; - return (uInt)len <= s->lookahead ? (uInt)len : s->lookahead; -} - -#ifdef DEBUG -/* =========================================================================== - * Check that the match at match_start is indeed a match. - */ -local void check_match(s, start, match, length) - deflate_state *s; - IPos start, match; - int length; -{ - /* check that the match is indeed a match */ - if (zmemcmp(s->window + match, - s->window + start, length) != EQUAL) { - fprintf(stderr, " start %u, match %u, length %d\n", - start, match, length); - do { - fprintf(stderr, "%c%c", s->window[match++], s->window[start++]); - } while (--length != 0); - z_error("invalid match"); - } - if (z_verbose > 1) { - fprintf(stderr,"\\[%d,%d]", start-match, length); - do { putc(s->window[start++], stderr); } while (--length != 0); - } -} -#else -# define check_match(s, start, match, length) -#endif /* DEBUG */ - -/* =========================================================================== - * Fill the window when the lookahead becomes insufficient. - * Updates strstart and lookahead. - * - * IN assertion: lookahead < MIN_LOOKAHEAD - * OUT assertions: strstart <= window_size-MIN_LOOKAHEAD - * At least one byte has been read, or avail_in == 0; reads are - * performed for at least two bytes (required for the zip translate_eol - * option -- not supported here). - */ -local void fill_window(s) - deflate_state *s; -{ - register unsigned n, m; - register Posf *p; - unsigned more; /* Amount of free space at the end of the window. */ - uInt wsize = s->w_size; - - do { - more = (unsigned)(s->window_size -(ulg)s->lookahead -(ulg)s->strstart); - - /* Deal with !@#$% 64K limit: */ - if (sizeof(int) <= 2) { - if (more == 0 && s->strstart == 0 && s->lookahead == 0) { - more = wsize; - - } else if (more == (unsigned)(-1)) { - /* Very unlikely, but possible on 16 bit machine if - * strstart == 0 && lookahead == 1 (input done a byte at time) - */ - more--; - } - } - - /* If the window is almost full and there is insufficient lookahead, - * move the upper half to the lower one to make room in the upper half. - */ - if (s->strstart >= wsize+MAX_DIST(s)) { - - zmemcpy(s->window, s->window+wsize, (unsigned)wsize); - s->match_start -= wsize; - s->strstart -= wsize; /* we now have strstart >= MAX_DIST */ - s->block_start -= (long) wsize; - - /* Slide the hash table (could be avoided with 32 bit values - at the expense of memory usage). We slide even when level == 0 - to keep the hash table consistent if we switch back to level > 0 - later. (Using level 0 permanently is not an optimal usage of - zlib, so we don't care about this pathological case.) - */ - /* %%% avoid this when Z_RLE */ - n = s->hash_size; - p = &s->head[n]; - do { - m = *--p; - *p = (Pos)(m >= wsize ? m-wsize : NIL); - } while (--n); - - n = wsize; -#ifndef FASTEST - p = &s->prev[n]; - do { - m = *--p; - *p = (Pos)(m >= wsize ? m-wsize : NIL); - /* If n is not on any hash chain, prev[n] is garbage but - * its value will never be used. - */ - } while (--n); -#endif - more += wsize; - } - if (s->strm->avail_in == 0) return; - - /* If there was no sliding: - * strstart <= WSIZE+MAX_DIST-1 && lookahead <= MIN_LOOKAHEAD - 1 && - * more == window_size - lookahead - strstart - * => more >= window_size - (MIN_LOOKAHEAD-1 + WSIZE + MAX_DIST-1) - * => more >= window_size - 2*WSIZE + 2 - * In the BIG_MEM or MMAP case (not yet supported), - * window_size == input_size + MIN_LOOKAHEAD && - * strstart + s->lookahead <= input_size => more >= MIN_LOOKAHEAD. - * Otherwise, window_size == 2*WSIZE so more >= 2. - * If there was sliding, more >= WSIZE. So in all cases, more >= 2. - */ - Assert(more >= 2, "more < 2"); - - n = read_buf(s->strm, s->window + s->strstart + s->lookahead, more); - s->lookahead += n; - - /* Initialize the hash value now that we have some input: */ - if (s->lookahead >= MIN_MATCH) { - s->ins_h = s->window[s->strstart]; - UPDATE_HASH(s, s->ins_h, s->window[s->strstart+1]); -#if MIN_MATCH != 3 - Call UPDATE_HASH() MIN_MATCH-3 more times -#endif - } - /* If the whole input has less than MIN_MATCH bytes, ins_h is garbage, - * but this is not important since only literal bytes will be emitted. - */ - - } while (s->lookahead < MIN_LOOKAHEAD && s->strm->avail_in != 0); -} - -/* =========================================================================== - * Flush the current block, with given end-of-file flag. - * IN assertion: strstart is set to the end of the current match. - */ -#define FLUSH_BLOCK_ONLY(s, eof) { \ - _tr_flush_block(s, (s->block_start >= 0L ? \ - (charf *)&s->window[(unsigned)s->block_start] : \ - (charf *)Z_NULL), \ - (ulg)((long)s->strstart - s->block_start), \ - (eof)); \ - s->block_start = s->strstart; \ - flush_pending(s->strm); \ - Tracev((stderr,"[FLUSH]")); \ -} - -/* Same but force premature exit if necessary. */ -#define FLUSH_BLOCK(s, eof) { \ - FLUSH_BLOCK_ONLY(s, eof); \ - if (s->strm->avail_out == 0) return (eof) ? finish_started : need_more; \ -} - -/* =========================================================================== - * Copy without compression as much as possible from the input stream, return - * the current block state. - * This function does not insert new strings in the dictionary since - * uncompressible data is probably not useful. This function is used - * only for the level=0 compression option. - * NOTE: this function should be optimized to avoid extra copying from - * window to pending_buf. - */ -local block_state deflate_stored(s, flush) - deflate_state *s; - int flush; -{ - /* Stored blocks are limited to 0xffff bytes, pending_buf is limited - * to pending_buf_size, and each stored block has a 5 byte header: - */ - ulg max_block_size = 0xffff; - ulg max_start; - - if (max_block_size > s->pending_buf_size - 5) { - max_block_size = s->pending_buf_size - 5; - } - - /* Copy as much as possible from input to output: */ - for (;;) { - /* Fill the window as much as possible: */ - if (s->lookahead <= 1) { - - Assert(s->strstart < s->w_size+MAX_DIST(s) || - s->block_start >= (long)s->w_size, "slide too late"); - - fill_window(s); - if (s->lookahead == 0 && flush == Z_NO_FLUSH) return need_more; - - if (s->lookahead == 0) break; /* flush the current block */ - } - Assert(s->block_start >= 0L, "block gone"); - - s->strstart += s->lookahead; - s->lookahead = 0; - - /* Emit a stored block if pending_buf will be full: */ - max_start = s->block_start + max_block_size; - if (s->strstart == 0 || (ulg)s->strstart >= max_start) { - /* strstart == 0 is possible when wraparound on 16-bit machine */ - s->lookahead = (uInt)(s->strstart - max_start); - s->strstart = (uInt)max_start; - FLUSH_BLOCK(s, 0); - } - /* Flush if we may have to slide, otherwise block_start may become - * negative and the data will be gone: - */ - if (s->strstart - (uInt)s->block_start >= MAX_DIST(s)) { - FLUSH_BLOCK(s, 0); - } - } - FLUSH_BLOCK(s, flush == Z_FINISH); - return flush == Z_FINISH ? finish_done : block_done; -} - -/* =========================================================================== - * Compress as much as possible from the input stream, return the current - * block state. - * This function does not perform lazy evaluation of matches and inserts - * new strings in the dictionary only for unmatched strings or for short - * matches. It is used only for the fast compression options. - */ -local block_state deflate_fast(s, flush) - deflate_state *s; - int flush; -{ - IPos hash_head = NIL; /* head of the hash chain */ - int bflush; /* set if current block must be flushed */ - - for (;;) { - /* Make sure that we always have enough lookahead, except - * at the end of the input file. We need MAX_MATCH bytes - * for the next match, plus MIN_MATCH bytes to insert the - * string following the next match. - */ - if (s->lookahead < MIN_LOOKAHEAD) { - fill_window(s); - if (s->lookahead < MIN_LOOKAHEAD && flush == Z_NO_FLUSH) { - return need_more; - } - if (s->lookahead == 0) break; /* flush the current block */ - } - - /* Insert the string window[strstart .. strstart+2] in the - * dictionary, and set hash_head to the head of the hash chain: - */ - if (s->lookahead >= MIN_MATCH) { - INSERT_STRING(s, s->strstart, hash_head); - } - - /* Find the longest match, discarding those <= prev_length. - * At this point we have always match_length < MIN_MATCH - */ - if (hash_head != NIL && s->strstart - hash_head <= MAX_DIST(s)) { - /* To simplify the code, we prevent matches with the string - * of window index 0 (in particular we have to avoid a match - * of the string with itself at the start of the input file). - */ -#ifdef FASTEST - if ((s->strategy != Z_HUFFMAN_ONLY && s->strategy != Z_RLE) || - (s->strategy == Z_RLE && s->strstart - hash_head == 1)) { - s->match_length = longest_match_fast (s, hash_head); - } -#else - if (s->strategy != Z_HUFFMAN_ONLY && s->strategy != Z_RLE) { - s->match_length = longest_match (s, hash_head); - } else if (s->strategy == Z_RLE && s->strstart - hash_head == 1) { - s->match_length = longest_match_fast (s, hash_head); - } -#endif - /* longest_match() or longest_match_fast() sets match_start */ - } - if (s->match_length >= MIN_MATCH) { - check_match(s, s->strstart, s->match_start, s->match_length); - - _tr_tally_dist(s, s->strstart - s->match_start, - s->match_length - MIN_MATCH, bflush); - - s->lookahead -= s->match_length; - - /* Insert new strings in the hash table only if the match length - * is not too large. This saves time but degrades compression. - */ -#ifndef FASTEST - if (s->match_length <= s->max_insert_length && - s->lookahead >= MIN_MATCH) { - s->match_length--; /* string at strstart already in table */ - do { - s->strstart++; - INSERT_STRING(s, s->strstart, hash_head); - /* strstart never exceeds WSIZE-MAX_MATCH, so there are - * always MIN_MATCH bytes ahead. - */ - } while (--s->match_length != 0); - s->strstart++; - } else -#endif - { - s->strstart += s->match_length; - s->match_length = 0; - s->ins_h = s->window[s->strstart]; - UPDATE_HASH(s, s->ins_h, s->window[s->strstart+1]); -#if MIN_MATCH != 3 - Call UPDATE_HASH() MIN_MATCH-3 more times -#endif - /* If lookahead < MIN_MATCH, ins_h is garbage, but it does not - * matter since it will be recomputed at next deflate call. - */ - } - } else { - /* No match, output a literal byte */ - Tracevv((stderr,"%c", s->window[s->strstart])); - _tr_tally_lit (s, s->window[s->strstart], bflush); - s->lookahead--; - s->strstart++; - } - if (bflush) FLUSH_BLOCK(s, 0); - } - FLUSH_BLOCK(s, flush == Z_FINISH); - return flush == Z_FINISH ? finish_done : block_done; -} - -#ifndef FASTEST -/* =========================================================================== - * Same as above, but achieves better compression. We use a lazy - * evaluation for matches: a match is finally adopted only if there is - * no better match at the next window position. - */ -local block_state deflate_slow(s, flush) - deflate_state *s; - int flush; -{ - IPos hash_head = NIL; /* head of hash chain */ - int bflush; /* set if current block must be flushed */ - - /* Process the input block. */ - for (;;) { - /* Make sure that we always have enough lookahead, except - * at the end of the input file. We need MAX_MATCH bytes - * for the next match, plus MIN_MATCH bytes to insert the - * string following the next match. - */ - if (s->lookahead < MIN_LOOKAHEAD) { - fill_window(s); - if (s->lookahead < MIN_LOOKAHEAD && flush == Z_NO_FLUSH) { - return need_more; - } - if (s->lookahead == 0) break; /* flush the current block */ - } - - /* Insert the string window[strstart .. strstart+2] in the - * dictionary, and set hash_head to the head of the hash chain: - */ - if (s->lookahead >= MIN_MATCH) { - INSERT_STRING(s, s->strstart, hash_head); - } - - /* Find the longest match, discarding those <= prev_length. - */ - s->prev_length = s->match_length, s->prev_match = s->match_start; - s->match_length = MIN_MATCH-1; - - if (hash_head != NIL && s->prev_length < s->max_lazy_match && - s->strstart - hash_head <= MAX_DIST(s)) { - /* To simplify the code, we prevent matches with the string - * of window index 0 (in particular we have to avoid a match - * of the string with itself at the start of the input file). - */ - if (s->strategy != Z_HUFFMAN_ONLY && s->strategy != Z_RLE) { - s->match_length = longest_match (s, hash_head); - } else if (s->strategy == Z_RLE && s->strstart - hash_head == 1) { - s->match_length = longest_match_fast (s, hash_head); - } - /* longest_match() or longest_match_fast() sets match_start */ - - if (s->match_length <= 5 && (s->strategy == Z_FILTERED -#if TOO_FAR <= 32767 - || (s->match_length == MIN_MATCH && - s->strstart - s->match_start > TOO_FAR) -#endif - )) { - - /* If prev_match is also MIN_MATCH, match_start is garbage - * but we will ignore the current match anyway. - */ - s->match_length = MIN_MATCH-1; - } - } - /* If there was a match at the previous step and the current - * match is not better, output the previous match: - */ - if (s->prev_length >= MIN_MATCH && s->match_length <= s->prev_length) { - uInt max_insert = s->strstart + s->lookahead - MIN_MATCH; - /* Do not insert strings in hash table beyond this. */ - - check_match(s, s->strstart-1, s->prev_match, s->prev_length); - - _tr_tally_dist(s, s->strstart -1 - s->prev_match, - s->prev_length - MIN_MATCH, bflush); - - /* Insert in hash table all strings up to the end of the match. - * strstart-1 and strstart are already inserted. If there is not - * enough lookahead, the last two strings are not inserted in - * the hash table. - */ - s->lookahead -= s->prev_length-1; - s->prev_length -= 2; - do { - if (++s->strstart <= max_insert) { - INSERT_STRING(s, s->strstart, hash_head); - } - } while (--s->prev_length != 0); - s->match_available = 0; - s->match_length = MIN_MATCH-1; - s->strstart++; - - if (bflush) FLUSH_BLOCK(s, 0); - - } else if (s->match_available) { - /* If there was no match at the previous position, output a - * single literal. If there was a match but the current match - * is longer, truncate the previous match to a single literal. - */ - Tracevv((stderr,"%c", s->window[s->strstart-1])); - _tr_tally_lit(s, s->window[s->strstart-1], bflush); - if (bflush) { - FLUSH_BLOCK_ONLY(s, 0); - } - s->strstart++; - s->lookahead--; - if (s->strm->avail_out == 0) return need_more; - } else { - /* There is no previous match to compare with, wait for - * the next step to decide. - */ - s->match_available = 1; - s->strstart++; - s->lookahead--; - } - } - Assert (flush != Z_NO_FLUSH, "no flush?"); - if (s->match_available) { - Tracevv((stderr,"%c", s->window[s->strstart-1])); - _tr_tally_lit(s, s->window[s->strstart-1], bflush); - s->match_available = 0; - } - FLUSH_BLOCK(s, flush == Z_FINISH); - return flush == Z_FINISH ? finish_done : block_done; -} -#endif /* FASTEST */ - -#if 0 -/* =========================================================================== - * For Z_RLE, simply look for runs of bytes, generate matches only of distance - * one. Do not maintain a hash table. (It will be regenerated if this run of - * deflate switches away from Z_RLE.) - */ -local block_state deflate_rle(s, flush) - deflate_state *s; - int flush; -{ - int bflush; /* set if current block must be flushed */ - uInt run; /* length of run */ - uInt max; /* maximum length of run */ - uInt prev; /* byte at distance one to match */ - Bytef *scan; /* scan for end of run */ - - for (;;) { - /* Make sure that we always have enough lookahead, except - * at the end of the input file. We need MAX_MATCH bytes - * for the longest encodable run. - */ - if (s->lookahead < MAX_MATCH) { - fill_window(s); - if (s->lookahead < MAX_MATCH && flush == Z_NO_FLUSH) { - return need_more; - } - if (s->lookahead == 0) break; /* flush the current block */ - } - - /* See how many times the previous byte repeats */ - run = 0; - if (s->strstart > 0) { /* if there is a previous byte, that is */ - max = s->lookahead < MAX_MATCH ? s->lookahead : MAX_MATCH; - scan = s->window + s->strstart - 1; - prev = *scan++; - do { - if (*scan++ != prev) - break; - } while (++run < max); - } - - /* Emit match if have run of MIN_MATCH or longer, else emit literal */ - if (run >= MIN_MATCH) { - check_match(s, s->strstart, s->strstart - 1, run); - _tr_tally_dist(s, 1, run - MIN_MATCH, bflush); - s->lookahead -= run; - s->strstart += run; - } else { - /* No match, output a literal byte */ - Tracevv((stderr,"%c", s->window[s->strstart])); - _tr_tally_lit (s, s->window[s->strstart], bflush); - s->lookahead--; - s->strstart++; - } - if (bflush) FLUSH_BLOCK(s, 0); - } - FLUSH_BLOCK(s, flush == Z_FINISH); - return flush == Z_FINISH ? finish_done : block_done; -} -#endif diff --git a/dependencies/zlib/deflate.h b/dependencies/zlib/deflate.h deleted file mode 100644 index 222c53e0..00000000 --- a/dependencies/zlib/deflate.h +++ /dev/null @@ -1,331 +0,0 @@ -/* deflate.h -- internal compression state - * Copyright (C) 1995-2004 Jean-loup Gailly - * For conditions of distribution and use, see copyright notice in zlib.h - */ - -/* WARNING: this file should *not* be used by applications. It is - part of the implementation of the compression library and is - subject to change. Applications should only use zlib.h. - */ - -/* @(#) $Id$ */ - -#ifndef DEFLATE_H -#define DEFLATE_H - -#include "zutil.h" - -/* define NO_GZIP when compiling if you want to disable gzip header and - trailer creation by deflate(). NO_GZIP would be used to avoid linking in - the crc code when it is not needed. For shared libraries, gzip encoding - should be left enabled. */ -#ifndef NO_GZIP -# define GZIP -#endif - -/* =========================================================================== - * Internal compression state. - */ - -#define LENGTH_CODES 29 -/* number of length codes, not counting the special END_BLOCK code */ - -#define LITERALS 256 -/* number of literal bytes 0..255 */ - -#define L_CODES (LITERALS+1+LENGTH_CODES) -/* number of Literal or Length codes, including the END_BLOCK code */ - -#define D_CODES 30 -/* number of distance codes */ - -#define BL_CODES 19 -/* number of codes used to transfer the bit lengths */ - -#define HEAP_SIZE (2*L_CODES+1) -/* maximum heap size */ - -#define MAX_BITS 15 -/* All codes must not exceed MAX_BITS bits */ - -#define INIT_STATE 42 -#define EXTRA_STATE 69 -#define NAME_STATE 73 -#define COMMENT_STATE 91 -#define HCRC_STATE 103 -#define BUSY_STATE 113 -#define FINISH_STATE 666 -/* Stream status */ - - -/* Data structure describing a single value and its code string. */ -typedef struct ct_data_s { - union { - ush freq; /* frequency count */ - ush code; /* bit string */ - } fc; - union { - ush dad; /* father node in Huffman tree */ - ush len; /* length of bit string */ - } dl; -} FAR ct_data; - -#define Freq fc.freq -#define Code fc.code -#define Dad dl.dad -#define Len dl.len - -typedef struct static_tree_desc_s static_tree_desc; - -typedef struct tree_desc_s { - ct_data *dyn_tree; /* the dynamic tree */ - int max_code; /* largest code with non zero frequency */ - static_tree_desc *stat_desc; /* the corresponding static tree */ -} FAR tree_desc; - -typedef ush Pos; -typedef Pos FAR Posf; -typedef unsigned IPos; - -/* A Pos is an index in the character window. We use short instead of int to - * save space in the various tables. IPos is used only for parameter passing. - */ - -typedef struct internal_state { - z_streamp strm; /* pointer back to this zlib stream */ - int status; /* as the name implies */ - Bytef *pending_buf; /* output still pending */ - ulg pending_buf_size; /* size of pending_buf */ - Bytef *pending_out; /* next pending byte to output to the stream */ - uInt pending; /* nb of bytes in the pending buffer */ - int wrap; /* bit 0 true for zlib, bit 1 true for gzip */ - gz_headerp gzhead; /* gzip header information to write */ - uInt gzindex; /* where in extra, name, or comment */ - Byte method; /* STORED (for zip only) or DEFLATED */ - int last_flush; /* value of flush param for previous deflate call */ - - /* used by deflate.c: */ - - uInt w_size; /* LZ77 window size (32K by default) */ - uInt w_bits; /* log2(w_size) (8..16) */ - uInt w_mask; /* w_size - 1 */ - - Bytef *window; - /* Sliding window. Input bytes are read into the second half of the window, - * and move to the first half later to keep a dictionary of at least wSize - * bytes. With this organization, matches are limited to a distance of - * wSize-MAX_MATCH bytes, but this ensures that IO is always - * performed with a length multiple of the block size. Also, it limits - * the window size to 64K, which is quite useful on MSDOS. - * To do: use the user input buffer as sliding window. - */ - - ulg window_size; - /* Actual size of window: 2*wSize, except when the user input buffer - * is directly used as sliding window. - */ - - Posf *prev; - /* Link to older string with same hash index. To limit the size of this - * array to 64K, this link is maintained only for the last 32K strings. - * An index in this array is thus a window index modulo 32K. - */ - - Posf *head; /* Heads of the hash chains or NIL. */ - - uInt ins_h; /* hash index of string to be inserted */ - uInt hash_size; /* number of elements in hash table */ - uInt hash_bits; /* log2(hash_size) */ - uInt hash_mask; /* hash_size-1 */ - - uInt hash_shift; - /* Number of bits by which ins_h must be shifted at each input - * step. It must be such that after MIN_MATCH steps, the oldest - * byte no longer takes part in the hash key, that is: - * hash_shift * MIN_MATCH >= hash_bits - */ - - long block_start; - /* Window position at the beginning of the current output block. Gets - * negative when the window is moved backwards. - */ - - uInt match_length; /* length of best match */ - IPos prev_match; /* previous match */ - int match_available; /* set if previous match exists */ - uInt strstart; /* start of string to insert */ - uInt match_start; /* start of matching string */ - uInt lookahead; /* number of valid bytes ahead in window */ - - uInt prev_length; - /* Length of the best match at previous step. Matches not greater than this - * are discarded. This is used in the lazy match evaluation. - */ - - uInt max_chain_length; - /* To speed up deflation, hash chains are never searched beyond this - * length. A higher limit improves compression ratio but degrades the - * speed. - */ - - uInt max_lazy_match; - /* Attempt to find a better match only when the current match is strictly - * smaller than this value. This mechanism is used only for compression - * levels >= 4. - */ -# define max_insert_length max_lazy_match - /* Insert new strings in the hash table only if the match length is not - * greater than this length. This saves time but degrades compression. - * max_insert_length is used only for compression levels <= 3. - */ - - int level; /* compression level (1..9) */ - int strategy; /* favor or force Huffman coding*/ - - uInt good_match; - /* Use a faster search when the previous match is longer than this */ - - int nice_match; /* Stop searching when current match exceeds this */ - - /* used by trees.c: */ - /* Didn't use ct_data typedef below to supress compiler warning */ - struct ct_data_s dyn_ltree[HEAP_SIZE]; /* literal and length tree */ - struct ct_data_s dyn_dtree[2*D_CODES+1]; /* distance tree */ - struct ct_data_s bl_tree[2*BL_CODES+1]; /* Huffman tree for bit lengths */ - - struct tree_desc_s l_desc; /* desc. for literal tree */ - struct tree_desc_s d_desc; /* desc. for distance tree */ - struct tree_desc_s bl_desc; /* desc. for bit length tree */ - - ush bl_count[MAX_BITS+1]; - /* number of codes at each bit length for an optimal tree */ - - int heap[2*L_CODES+1]; /* heap used to build the Huffman trees */ - int heap_len; /* number of elements in the heap */ - int heap_max; /* element of largest frequency */ - /* The sons of heap[n] are heap[2*n] and heap[2*n+1]. heap[0] is not used. - * The same heap array is used to build all trees. - */ - - uch depth[2*L_CODES+1]; - /* Depth of each subtree used as tie breaker for trees of equal frequency - */ - - uchf *l_buf; /* buffer for literals or lengths */ - - uInt lit_bufsize; - /* Size of match buffer for literals/lengths. There are 4 reasons for - * limiting lit_bufsize to 64K: - * - frequencies can be kept in 16 bit counters - * - if compression is not successful for the first block, all input - * data is still in the window so we can still emit a stored block even - * when input comes from standard input. (This can also be done for - * all blocks if lit_bufsize is not greater than 32K.) - * - if compression is not successful for a file smaller than 64K, we can - * even emit a stored file instead of a stored block (saving 5 bytes). - * This is applicable only for zip (not gzip or zlib). - * - creating new Huffman trees less frequently may not provide fast - * adaptation to changes in the input data statistics. (Take for - * example a binary file with poorly compressible code followed by - * a highly compressible string table.) Smaller buffer sizes give - * fast adaptation but have of course the overhead of transmitting - * trees more frequently. - * - I can't count above 4 - */ - - uInt last_lit; /* running index in l_buf */ - - ushf *d_buf; - /* Buffer for distances. To simplify the code, d_buf and l_buf have - * the same number of elements. To use different lengths, an extra flag - * array would be necessary. - */ - - ulg opt_len; /* bit length of current block with optimal trees */ - ulg static_len; /* bit length of current block with static trees */ - uInt matches; /* number of string matches in current block */ - int last_eob_len; /* bit length of EOB code for last block */ - -#ifdef DEBUG - ulg compressed_len; /* total bit length of compressed file mod 2^32 */ - ulg bits_sent; /* bit length of compressed data sent mod 2^32 */ -#endif - - ush bi_buf; - /* Output buffer. bits are inserted starting at the bottom (least - * significant bits). - */ - int bi_valid; - /* Number of valid bits in bi_buf. All bits above the last valid bit - * are always zero. - */ - -} FAR deflate_state; - -/* Output a byte on the stream. - * IN assertion: there is enough room in pending_buf. - */ -#define put_byte(s, c) {s->pending_buf[s->pending++] = (c);} - - -#define MIN_LOOKAHEAD (MAX_MATCH+MIN_MATCH+1) -/* Minimum amount of lookahead, except at the end of the input file. - * See deflate.c for comments about the MIN_MATCH+1. - */ - -#define MAX_DIST(s) ((s)->w_size-MIN_LOOKAHEAD) -/* In order to simplify the code, particularly on 16 bit machines, match - * distances are limited to MAX_DIST instead of WSIZE. - */ - - /* in trees.c */ -void _tr_init OF((deflate_state *s)); -int _tr_tally OF((deflate_state *s, unsigned dist, unsigned lc)); -void _tr_flush_block OF((deflate_state *s, charf *buf, ulg stored_len, - int eof)); -void _tr_align OF((deflate_state *s)); -void _tr_stored_block OF((deflate_state *s, charf *buf, ulg stored_len, - int eof)); - -#define d_code(dist) \ - ((dist) < 256 ? _dist_code[dist] : _dist_code[256+((dist)>>7)]) -/* Mapping from a distance to a distance code. dist is the distance - 1 and - * must not have side effects. _dist_code[256] and _dist_code[257] are never - * used. - */ - -#ifndef DEBUG -/* Inline versions of _tr_tally for speed: */ - -#if defined(GEN_TREES_H) || !defined(STDC) - extern uch _length_code[]; - extern uch _dist_code[]; -#else - extern const uch _length_code[]; - extern const uch _dist_code[]; -#endif - -# define _tr_tally_lit(s, c, flush) \ - { uch cc = (c); \ - s->d_buf[s->last_lit] = 0; \ - s->l_buf[s->last_lit++] = cc; \ - s->dyn_ltree[cc].Freq++; \ - flush = (s->last_lit == s->lit_bufsize-1); \ - } -# define _tr_tally_dist(s, distance, length, flush) \ - { uch len = (length); \ - ush dist = (distance); \ - s->d_buf[s->last_lit] = dist; \ - s->l_buf[s->last_lit++] = len; \ - dist--; \ - s->dyn_ltree[_length_code[len]+LITERALS+1].Freq++; \ - s->dyn_dtree[d_code(dist)].Freq++; \ - flush = (s->last_lit == s->lit_bufsize-1); \ - } -#else -# define _tr_tally_lit(s, c, flush) flush = _tr_tally(s, 0, c) -# define _tr_tally_dist(s, distance, length, flush) \ - flush = _tr_tally(s, distance, length) -#endif - -#endif /* DEFLATE_H */ diff --git a/dependencies/zlib/gzio.c b/dependencies/zlib/gzio.c deleted file mode 100644 index 5e20a4aa..00000000 --- a/dependencies/zlib/gzio.c +++ /dev/null @@ -1,1026 +0,0 @@ -/* gzio.c -- IO on .gz files - * Copyright (C) 1995-2005 Jean-loup Gailly. - * For conditions of distribution and use, see copyright notice in zlib.h - * - * Compile this file with -DNO_GZCOMPRESS to avoid the compression code. - */ - -/* @(#) $Id$ */ - -#include - -#include "zutil.h" - -#ifdef NO_DEFLATE /* for compatibility with old definition */ -# define NO_GZCOMPRESS -#endif - -#ifndef NO_DUMMY_DECL -struct internal_state {int dummy;}; /* for buggy compilers */ -#endif - -#ifndef Z_BUFSIZE -# ifdef MAXSEG_64K -# define Z_BUFSIZE 4096 /* minimize memory usage for 16-bit DOS */ -# else -# define Z_BUFSIZE 16384 -# endif -#endif -#ifndef Z_PRINTF_BUFSIZE -# define Z_PRINTF_BUFSIZE 4096 -#endif - -#ifdef __MVS__ -# pragma map (fdopen , "\174\174FDOPEN") - FILE *fdopen(int, const char *); -#endif - -#ifndef STDC -extern voidp malloc OF((uInt size)); -extern void free OF((voidpf ptr)); -#endif - -#define ALLOC(size) malloc(size) -#define TRYFREE(p) {if (p) free(p);} - -static int const gz_magic[2] = {0x1f, 0x8b}; /* gzip magic header */ - -/* gzip flag byte */ -#define ASCII_FLAG 0x01 /* bit 0 set: file probably ascii text */ -#define HEAD_CRC 0x02 /* bit 1 set: header CRC present */ -#define EXTRA_FIELD 0x04 /* bit 2 set: extra field present */ -#define ORIG_NAME 0x08 /* bit 3 set: original file name present */ -#define COMMENT 0x10 /* bit 4 set: file comment present */ -#define RESERVED 0xE0 /* bits 5..7: reserved */ - -typedef struct gz_stream { - z_stream stream; - int z_err; /* error code for last stream operation */ - int z_eof; /* set if end of input file */ - FILE *file; /* .gz file */ - Byte *inbuf; /* input buffer */ - Byte *outbuf; /* output buffer */ - uLong crc; /* crc32 of uncompressed data */ - char *msg; /* error message */ - char *path; /* path name for debugging only */ - int transparent; /* 1 if input file is not a .gz file */ - char mode; /* 'w' or 'r' */ - z_off_t start; /* start of compressed data in file (header skipped) */ - z_off_t in; /* bytes into deflate or inflate */ - z_off_t out; /* bytes out of deflate or inflate */ - int back; /* one character push-back */ - int last; /* true if push-back is last character */ -} gz_stream; - - -local gzFile gz_open OF((const char *path, const char *mode, int fd)); -local int do_flush OF((gzFile file, int flush)); -local int get_byte OF((gz_stream *s)); -local void check_header OF((gz_stream *s)); -local int destroy OF((gz_stream *s)); -local void putLong OF((FILE *file, uLong x)); -local uLong getLong OF((gz_stream *s)); - -/* =========================================================================== - Opens a gzip (.gz) file for reading or writing. The mode parameter - is as in fopen ("rb" or "wb"). The file is given either by file descriptor - or path name (if fd == -1). - gz_open returns NULL if the file could not be opened or if there was - insufficient memory to allocate the (de)compression state; errno - can be checked to distinguish the two cases (if errno is zero, the - zlib error is Z_MEM_ERROR). -*/ -local gzFile gz_open (path, mode, fd) - const char *path; - const char *mode; - int fd; -{ - int err; - int level = Z_DEFAULT_COMPRESSION; /* compression level */ - int strategy = Z_DEFAULT_STRATEGY; /* compression strategy */ - char *p = (char*)mode; - gz_stream *s; - char fmode[80]; /* copy of mode, without the compression level */ - char *m = fmode; - - if (!path || !mode) return Z_NULL; - - s = (gz_stream *)ALLOC(sizeof(gz_stream)); - if (!s) return Z_NULL; - - s->stream.zalloc = (alloc_func)0; - s->stream.zfree = (free_func)0; - s->stream.opaque = (voidpf)0; - s->stream.next_in = s->inbuf = Z_NULL; - s->stream.next_out = s->outbuf = Z_NULL; - s->stream.avail_in = s->stream.avail_out = 0; - s->file = NULL; - s->z_err = Z_OK; - s->z_eof = 0; - s->in = 0; - s->out = 0; - s->back = EOF; - s->crc = crc32(0L, Z_NULL, 0); - s->msg = NULL; - s->transparent = 0; - - s->path = (char*)ALLOC(strlen(path)+1); - if (s->path == NULL) { - return destroy(s), (gzFile)Z_NULL; - } - strcpy(s->path, path); /* do this early for debugging */ - - s->mode = '\0'; - do { - if (*p == 'r') s->mode = 'r'; - if (*p == 'w' || *p == 'a') s->mode = 'w'; - if (*p >= '0' && *p <= '9') { - level = *p - '0'; - } else if (*p == 'f') { - strategy = Z_FILTERED; - } else if (*p == 'h') { - strategy = Z_HUFFMAN_ONLY; - } else if (*p == 'R') { - strategy = Z_RLE; - } else { - *m++ = *p; /* copy the mode */ - } - } while (*p++ && m != fmode + sizeof(fmode)); - if (s->mode == '\0') return destroy(s), (gzFile)Z_NULL; - - if (s->mode == 'w') { -#ifdef NO_GZCOMPRESS - err = Z_STREAM_ERROR; -#else - err = deflateInit2(&(s->stream), level, - Z_DEFLATED, -MAX_WBITS, DEF_MEM_LEVEL, strategy); - /* windowBits is passed < 0 to suppress zlib header */ - - s->stream.next_out = s->outbuf = (Byte*)ALLOC(Z_BUFSIZE); -#endif - if (err != Z_OK || s->outbuf == Z_NULL) { - return destroy(s), (gzFile)Z_NULL; - } - } else { - s->stream.next_in = s->inbuf = (Byte*)ALLOC(Z_BUFSIZE); - - err = inflateInit2(&(s->stream), -MAX_WBITS); - /* windowBits is passed < 0 to tell that there is no zlib header. - * Note that in this case inflate *requires* an extra "dummy" byte - * after the compressed stream in order to complete decompression and - * return Z_STREAM_END. Here the gzip CRC32 ensures that 4 bytes are - * present after the compressed stream. - */ - if (err != Z_OK || s->inbuf == Z_NULL) { - return destroy(s), (gzFile)Z_NULL; - } - } - s->stream.avail_out = Z_BUFSIZE; - - errno = 0; - s->file = fd < 0 ? F_OPEN(path, fmode) : (FILE*)fdopen(fd, fmode); - - if (s->file == NULL) { - return destroy(s), (gzFile)Z_NULL; - } - if (s->mode == 'w') { - /* Write a very simple .gz header: - */ - fprintf(s->file, "%c%c%c%c%c%c%c%c%c%c", gz_magic[0], gz_magic[1], - Z_DEFLATED, 0 /*flags*/, 0,0,0,0 /*time*/, 0 /*xflags*/, OS_CODE); - s->start = 10L; - /* We use 10L instead of ftell(s->file) to because ftell causes an - * fflush on some systems. This version of the library doesn't use - * start anyway in write mode, so this initialization is not - * necessary. - */ - } else { - check_header(s); /* skip the .gz header */ - s->start = ftell(s->file) - s->stream.avail_in; - } - - return (gzFile)s; -} - -/* =========================================================================== - Opens a gzip (.gz) file for reading or writing. -*/ -gzFile ZEXPORT gzopen (path, mode) - const char *path; - const char *mode; -{ - return gz_open (path, mode, -1); -} - -/* =========================================================================== - Associate a gzFile with the file descriptor fd. fd is not dup'ed here - to mimic the behavio(u)r of fdopen. -*/ -gzFile ZEXPORT gzdopen (fd, mode) - int fd; - const char *mode; -{ - char name[46]; /* allow for up to 128-bit integers */ - - if (fd < 0) return (gzFile)Z_NULL; - sprintf(name, "", fd); /* for debugging */ - - return gz_open (name, mode, fd); -} - -/* =========================================================================== - * Update the compression level and strategy - */ -int ZEXPORT gzsetparams (file, level, strategy) - gzFile file; - int level; - int strategy; -{ - gz_stream *s = (gz_stream*)file; - - if (s == NULL || s->mode != 'w') return Z_STREAM_ERROR; - - /* Make room to allow flushing */ - if (s->stream.avail_out == 0) { - - s->stream.next_out = s->outbuf; - if (fwrite(s->outbuf, 1, Z_BUFSIZE, s->file) != Z_BUFSIZE) { - s->z_err = Z_ERRNO; - } - s->stream.avail_out = Z_BUFSIZE; - } - - return deflateParams (&(s->stream), level, strategy); -} - -/* =========================================================================== - Read a byte from a gz_stream; update next_in and avail_in. Return EOF - for end of file. - IN assertion: the stream s has been sucessfully opened for reading. -*/ -local int get_byte(s) - gz_stream *s; -{ - if (s->z_eof) return EOF; - if (s->stream.avail_in == 0) { - errno = 0; - s->stream.avail_in = (uInt)fread(s->inbuf, 1, Z_BUFSIZE, s->file); - if (s->stream.avail_in == 0) { - s->z_eof = 1; - if (ferror(s->file)) s->z_err = Z_ERRNO; - return EOF; - } - s->stream.next_in = s->inbuf; - } - s->stream.avail_in--; - return *(s->stream.next_in)++; -} - -/* =========================================================================== - Check the gzip header of a gz_stream opened for reading. Set the stream - mode to transparent if the gzip magic header is not present; set s->err - to Z_DATA_ERROR if the magic header is present but the rest of the header - is incorrect. - IN assertion: the stream s has already been created sucessfully; - s->stream.avail_in is zero for the first time, but may be non-zero - for concatenated .gz files. -*/ -local void check_header(s) - gz_stream *s; -{ - int method; /* method byte */ - int flags; /* flags byte */ - uInt len; - int c; - - /* Assure two bytes in the buffer so we can peek ahead -- handle case - where first byte of header is at the end of the buffer after the last - gzip segment */ - len = s->stream.avail_in; - if (len < 2) { - if (len) s->inbuf[0] = s->stream.next_in[0]; - errno = 0; - len = (uInt)fread(s->inbuf + len, 1, Z_BUFSIZE >> len, s->file); - if (len == 0 && ferror(s->file)) s->z_err = Z_ERRNO; - s->stream.avail_in += len; - s->stream.next_in = s->inbuf; - if (s->stream.avail_in < 2) { - s->transparent = s->stream.avail_in; - return; - } - } - - /* Peek ahead to check the gzip magic header */ - if (s->stream.next_in[0] != gz_magic[0] || - s->stream.next_in[1] != gz_magic[1]) { - s->transparent = 1; - return; - } - s->stream.avail_in -= 2; - s->stream.next_in += 2; - - /* Check the rest of the gzip header */ - method = get_byte(s); - flags = get_byte(s); - if (method != Z_DEFLATED || (flags & RESERVED) != 0) { - s->z_err = Z_DATA_ERROR; - return; - } - - /* Discard time, xflags and OS code: */ - for (len = 0; len < 6; len++) (void)get_byte(s); - - if ((flags & EXTRA_FIELD) != 0) { /* skip the extra field */ - len = (uInt)get_byte(s); - len += ((uInt)get_byte(s))<<8; - /* len is garbage if EOF but the loop below will quit anyway */ - while (len-- != 0 && get_byte(s) != EOF) ; - } - if ((flags & ORIG_NAME) != 0) { /* skip the original file name */ - while ((c = get_byte(s)) != 0 && c != EOF) ; - } - if ((flags & COMMENT) != 0) { /* skip the .gz file comment */ - while ((c = get_byte(s)) != 0 && c != EOF) ; - } - if ((flags & HEAD_CRC) != 0) { /* skip the header crc */ - for (len = 0; len < 2; len++) (void)get_byte(s); - } - s->z_err = s->z_eof ? Z_DATA_ERROR : Z_OK; -} - - /* =========================================================================== - * Cleanup then free the given gz_stream. Return a zlib error code. - Try freeing in the reverse order of allocations. - */ -local int destroy (s) - gz_stream *s; -{ - int err = Z_OK; - - if (!s) return Z_STREAM_ERROR; - - TRYFREE(s->msg); - - if (s->stream.state != NULL) { - if (s->mode == 'w') { -#ifdef NO_GZCOMPRESS - err = Z_STREAM_ERROR; -#else - err = deflateEnd(&(s->stream)); -#endif - } else if (s->mode == 'r') { - err = inflateEnd(&(s->stream)); - } - } - if (s->file != NULL && fclose(s->file)) { -#ifdef ESPIPE - if (errno != ESPIPE) /* fclose is broken for pipes in HP/UX */ -#endif - err = Z_ERRNO; - } - if (s->z_err < 0) err = s->z_err; - - TRYFREE(s->inbuf); - TRYFREE(s->outbuf); - TRYFREE(s->path); - TRYFREE(s); - return err; -} - -/* =========================================================================== - Reads the given number of uncompressed bytes from the compressed file. - gzread returns the number of bytes actually read (0 for end of file). -*/ -int ZEXPORT gzread (file, buf, len) - gzFile file; - voidp buf; - unsigned len; -{ - gz_stream *s = (gz_stream*)file; - Bytef *start = (Bytef*)buf; /* starting point for crc computation */ - Byte *next_out; /* == stream.next_out but not forced far (for MSDOS) */ - - if (s == NULL || s->mode != 'r') return Z_STREAM_ERROR; - - if (s->z_err == Z_DATA_ERROR || s->z_err == Z_ERRNO) return -1; - if (s->z_err == Z_STREAM_END) return 0; /* EOF */ - - next_out = (Byte*)buf; - s->stream.next_out = (Bytef*)buf; - s->stream.avail_out = len; - - if (s->stream.avail_out && s->back != EOF) { - *next_out++ = s->back; - s->stream.next_out++; - s->stream.avail_out--; - s->back = EOF; - s->out++; - start++; - if (s->last) { - s->z_err = Z_STREAM_END; - return 1; - } - } - - while (s->stream.avail_out != 0) { - - if (s->transparent) { - /* Copy first the lookahead bytes: */ - uInt n = s->stream.avail_in; - if (n > s->stream.avail_out) n = s->stream.avail_out; - if (n > 0) { - zmemcpy(s->stream.next_out, s->stream.next_in, n); - next_out += n; - s->stream.next_out = next_out; - s->stream.next_in += n; - s->stream.avail_out -= n; - s->stream.avail_in -= n; - } - if (s->stream.avail_out > 0) { - s->stream.avail_out -= - (uInt)fread(next_out, 1, s->stream.avail_out, s->file); - } - len -= s->stream.avail_out; - s->in += len; - s->out += len; - if (len == 0) s->z_eof = 1; - return (int)len; - } - if (s->stream.avail_in == 0 && !s->z_eof) { - - errno = 0; - s->stream.avail_in = (uInt)fread(s->inbuf, 1, Z_BUFSIZE, s->file); - if (s->stream.avail_in == 0) { - s->z_eof = 1; - if (ferror(s->file)) { - s->z_err = Z_ERRNO; - break; - } - } - s->stream.next_in = s->inbuf; - } - s->in += s->stream.avail_in; - s->out += s->stream.avail_out; - s->z_err = inflate(&(s->stream), Z_NO_FLUSH); - s->in -= s->stream.avail_in; - s->out -= s->stream.avail_out; - - if (s->z_err == Z_STREAM_END) { - /* Check CRC and original size */ - s->crc = crc32(s->crc, start, (uInt)(s->stream.next_out - start)); - start = s->stream.next_out; - - if (getLong(s) != s->crc) { - s->z_err = Z_DATA_ERROR; - } else { - (void)getLong(s); - /* The uncompressed length returned by above getlong() may be - * different from s->out in case of concatenated .gz files. - * Check for such files: - */ - check_header(s); - if (s->z_err == Z_OK) { - inflateReset(&(s->stream)); - s->crc = crc32(0L, Z_NULL, 0); - } - } - } - if (s->z_err != Z_OK || s->z_eof) break; - } - s->crc = crc32(s->crc, start, (uInt)(s->stream.next_out - start)); - - if (len == s->stream.avail_out && - (s->z_err == Z_DATA_ERROR || s->z_err == Z_ERRNO)) - return -1; - return (int)(len - s->stream.avail_out); -} - - -/* =========================================================================== - Reads one byte from the compressed file. gzgetc returns this byte - or -1 in case of end of file or error. -*/ -int ZEXPORT gzgetc(file) - gzFile file; -{ - unsigned char c; - - return gzread(file, &c, 1) == 1 ? c : -1; -} - - -/* =========================================================================== - Push one byte back onto the stream. -*/ -int ZEXPORT gzungetc(c, file) - int c; - gzFile file; -{ - gz_stream *s = (gz_stream*)file; - - if (s == NULL || s->mode != 'r' || c == EOF || s->back != EOF) return EOF; - s->back = c; - s->out--; - s->last = (s->z_err == Z_STREAM_END); - if (s->last) s->z_err = Z_OK; - s->z_eof = 0; - return c; -} - - -/* =========================================================================== - Reads bytes from the compressed file until len-1 characters are - read, or a newline character is read and transferred to buf, or an - end-of-file condition is encountered. The string is then terminated - with a null character. - gzgets returns buf, or Z_NULL in case of error. - - The current implementation is not optimized at all. -*/ -char * ZEXPORT gzgets(file, buf, len) - gzFile file; - char *buf; - int len; -{ - char *b = buf; - if (buf == Z_NULL || len <= 0) return Z_NULL; - - while (--len > 0 && gzread(file, buf, 1) == 1 && *buf++ != '\n') ; - *buf = '\0'; - return b == buf && len > 0 ? Z_NULL : b; -} - - -#ifndef NO_GZCOMPRESS -/* =========================================================================== - Writes the given number of uncompressed bytes into the compressed file. - gzwrite returns the number of bytes actually written (0 in case of error). -*/ -int ZEXPORT gzwrite (file, buf, len) - gzFile file; - voidpc buf; - unsigned len; -{ - gz_stream *s = (gz_stream*)file; - - if (s == NULL || s->mode != 'w') return Z_STREAM_ERROR; - - s->stream.next_in = (Bytef*)buf; - s->stream.avail_in = len; - - while (s->stream.avail_in != 0) { - - if (s->stream.avail_out == 0) { - - s->stream.next_out = s->outbuf; - if (fwrite(s->outbuf, 1, Z_BUFSIZE, s->file) != Z_BUFSIZE) { - s->z_err = Z_ERRNO; - break; - } - s->stream.avail_out = Z_BUFSIZE; - } - s->in += s->stream.avail_in; - s->out += s->stream.avail_out; - s->z_err = deflate(&(s->stream), Z_NO_FLUSH); - s->in -= s->stream.avail_in; - s->out -= s->stream.avail_out; - if (s->z_err != Z_OK) break; - } - s->crc = crc32(s->crc, (const Bytef *)buf, len); - - return (int)(len - s->stream.avail_in); -} - - -/* =========================================================================== - Converts, formats, and writes the args to the compressed file under - control of the format string, as in fprintf. gzprintf returns the number of - uncompressed bytes actually written (0 in case of error). -*/ -#ifdef STDC -#include - -int ZEXPORTVA gzprintf (gzFile file, const char *format, /* args */ ...) -{ - char buf[Z_PRINTF_BUFSIZE]; - va_list va; - int len; - - buf[sizeof(buf) - 1] = 0; - va_start(va, format); -#ifdef NO_vsnprintf -# ifdef HAS_vsprintf_void - (void)vsprintf(buf, format, va); - va_end(va); - for (len = 0; len < sizeof(buf); len++) - if (buf[len] == 0) break; -# else - len = vsprintf(buf, format, va); - va_end(va); -# endif -#else -# ifdef HAS_vsnprintf_void - (void)vsnprintf(buf, sizeof(buf), format, va); - va_end(va); - len = strlen(buf); -# else - len = vsnprintf(buf, sizeof(buf), format, va); - va_end(va); -# endif -#endif - if (len <= 0 || len >= (int)sizeof(buf) || buf[sizeof(buf) - 1] != 0) - return 0; - return gzwrite(file, buf, (unsigned)len); -} -#else /* not ANSI C */ - -int ZEXPORTVA gzprintf (file, format, a1, a2, a3, a4, a5, a6, a7, a8, a9, a10, - a11, a12, a13, a14, a15, a16, a17, a18, a19, a20) - gzFile file; - const char *format; - int a1, a2, a3, a4, a5, a6, a7, a8, a9, a10, - a11, a12, a13, a14, a15, a16, a17, a18, a19, a20; -{ - char buf[Z_PRINTF_BUFSIZE]; - int len; - - buf[sizeof(buf) - 1] = 0; -#ifdef NO_snprintf -# ifdef HAS_sprintf_void - sprintf(buf, format, a1, a2, a3, a4, a5, a6, a7, a8, - a9, a10, a11, a12, a13, a14, a15, a16, a17, a18, a19, a20); - for (len = 0; len < sizeof(buf); len++) - if (buf[len] == 0) break; -# else - len = sprintf(buf, format, a1, a2, a3, a4, a5, a6, a7, a8, - a9, a10, a11, a12, a13, a14, a15, a16, a17, a18, a19, a20); -# endif -#else -# ifdef HAS_snprintf_void - snprintf(buf, sizeof(buf), format, a1, a2, a3, a4, a5, a6, a7, a8, - a9, a10, a11, a12, a13, a14, a15, a16, a17, a18, a19, a20); - len = strlen(buf); -# else - len = snprintf(buf, sizeof(buf), format, a1, a2, a3, a4, a5, a6, a7, a8, - a9, a10, a11, a12, a13, a14, a15, a16, a17, a18, a19, a20); -# endif -#endif - if (len <= 0 || len >= sizeof(buf) || buf[sizeof(buf) - 1] != 0) - return 0; - return gzwrite(file, buf, len); -} -#endif - -/* =========================================================================== - Writes c, converted to an unsigned char, into the compressed file. - gzputc returns the value that was written, or -1 in case of error. -*/ -int ZEXPORT gzputc(file, c) - gzFile file; - int c; -{ - unsigned char cc = (unsigned char) c; /* required for big endian systems */ - - return gzwrite(file, &cc, 1) == 1 ? (int)cc : -1; -} - - -/* =========================================================================== - Writes the given null-terminated string to the compressed file, excluding - the terminating null character. - gzputs returns the number of characters written, or -1 in case of error. -*/ -int ZEXPORT gzputs(file, s) - gzFile file; - const char *s; -{ - return gzwrite(file, (char*)s, (unsigned)strlen(s)); -} - - -/* =========================================================================== - Flushes all pending output into the compressed file. The parameter - flush is as in the deflate() function. -*/ -local int do_flush (file, flush) - gzFile file; - int flush; -{ - uInt len; - int done = 0; - gz_stream *s = (gz_stream*)file; - - if (s == NULL || s->mode != 'w') return Z_STREAM_ERROR; - - s->stream.avail_in = 0; /* should be zero already anyway */ - - for (;;) { - len = Z_BUFSIZE - s->stream.avail_out; - - if (len != 0) { - if ((uInt)fwrite(s->outbuf, 1, len, s->file) != len) { - s->z_err = Z_ERRNO; - return Z_ERRNO; - } - s->stream.next_out = s->outbuf; - s->stream.avail_out = Z_BUFSIZE; - } - if (done) break; - s->out += s->stream.avail_out; - s->z_err = deflate(&(s->stream), flush); - s->out -= s->stream.avail_out; - - /* Ignore the second of two consecutive flushes: */ - if (len == 0 && s->z_err == Z_BUF_ERROR) s->z_err = Z_OK; - - /* deflate has finished flushing only when it hasn't used up - * all the available space in the output buffer: - */ - done = (s->stream.avail_out != 0 || s->z_err == Z_STREAM_END); - - if (s->z_err != Z_OK && s->z_err != Z_STREAM_END) break; - } - return s->z_err == Z_STREAM_END ? Z_OK : s->z_err; -} - -int ZEXPORT gzflush (file, flush) - gzFile file; - int flush; -{ - gz_stream *s = (gz_stream*)file; - int err = do_flush (file, flush); - - if (err) return err; - fflush(s->file); - return s->z_err == Z_STREAM_END ? Z_OK : s->z_err; -} -#endif /* NO_GZCOMPRESS */ - -/* =========================================================================== - Sets the starting position for the next gzread or gzwrite on the given - compressed file. The offset represents a number of bytes in the - gzseek returns the resulting offset location as measured in bytes from - the beginning of the uncompressed stream, or -1 in case of error. - SEEK_END is not implemented, returns error. - In this version of the library, gzseek can be extremely slow. -*/ -z_off_t ZEXPORT gzseek (file, offset, whence) - gzFile file; - z_off_t offset; - int whence; -{ - gz_stream *s = (gz_stream*)file; - - if (s == NULL || whence == SEEK_END || - s->z_err == Z_ERRNO || s->z_err == Z_DATA_ERROR) { - return -1L; - } - - if (s->mode == 'w') { -#ifdef NO_GZCOMPRESS - return -1L; -#else - if (whence == SEEK_SET) { - offset -= s->in; - } - if (offset < 0) return -1L; - - /* At this point, offset is the number of zero bytes to write. */ - if (s->inbuf == Z_NULL) { - s->inbuf = (Byte*)ALLOC(Z_BUFSIZE); /* for seeking */ - if (s->inbuf == Z_NULL) return -1L; - zmemzero(s->inbuf, Z_BUFSIZE); - } - while (offset > 0) { - uInt size = Z_BUFSIZE; - if (offset < Z_BUFSIZE) size = (uInt)offset; - - size = gzwrite(file, s->inbuf, size); - if (size == 0) return -1L; - - offset -= size; - } - return s->in; -#endif - } - /* Rest of function is for reading only */ - - /* compute absolute position */ - if (whence == SEEK_CUR) { - offset += s->out; - } - if (offset < 0) return -1L; - - if (s->transparent) { - /* map to fseek */ - s->back = EOF; - s->stream.avail_in = 0; - s->stream.next_in = s->inbuf; - if (fseek(s->file, offset, SEEK_SET) < 0) return -1L; - - s->in = s->out = offset; - return offset; - } - - /* For a negative seek, rewind and use positive seek */ - if (offset >= s->out) { - offset -= s->out; - } else if (gzrewind(file) < 0) { - return -1L; - } - /* offset is now the number of bytes to skip. */ - - if (offset != 0 && s->outbuf == Z_NULL) { - s->outbuf = (Byte*)ALLOC(Z_BUFSIZE); - if (s->outbuf == Z_NULL) return -1L; - } - if (offset && s->back != EOF) { - s->back = EOF; - s->out++; - offset--; - if (s->last) s->z_err = Z_STREAM_END; - } - while (offset > 0) { - int size = Z_BUFSIZE; - if (offset < Z_BUFSIZE) size = (int)offset; - - size = gzread(file, s->outbuf, (uInt)size); - if (size <= 0) return -1L; - offset -= size; - } - return s->out; -} - -/* =========================================================================== - Rewinds input file. -*/ -int ZEXPORT gzrewind (file) - gzFile file; -{ - gz_stream *s = (gz_stream*)file; - - if (s == NULL || s->mode != 'r') return -1; - - s->z_err = Z_OK; - s->z_eof = 0; - s->back = EOF; - s->stream.avail_in = 0; - s->stream.next_in = s->inbuf; - s->crc = crc32(0L, Z_NULL, 0); - if (!s->transparent) (void)inflateReset(&s->stream); - s->in = 0; - s->out = 0; - return fseek(s->file, s->start, SEEK_SET); -} - -/* =========================================================================== - Returns the starting position for the next gzread or gzwrite on the - given compressed file. This position represents a number of bytes in the - uncompressed data stream. -*/ -z_off_t ZEXPORT gztell (file) - gzFile file; -{ - return gzseek(file, 0L, SEEK_CUR); -} - -/* =========================================================================== - Returns 1 when EOF has previously been detected reading the given - input stream, otherwise zero. -*/ -int ZEXPORT gzeof (file) - gzFile file; -{ - gz_stream *s = (gz_stream*)file; - - /* With concatenated compressed files that can have embedded - * crc trailers, z_eof is no longer the only/best indicator of EOF - * on a gz_stream. Handle end-of-stream error explicitly here. - */ - if (s == NULL || s->mode != 'r') return 0; - if (s->z_eof) return 1; - return s->z_err == Z_STREAM_END; -} - -/* =========================================================================== - Returns 1 if reading and doing so transparently, otherwise zero. -*/ -int ZEXPORT gzdirect (file) - gzFile file; -{ - gz_stream *s = (gz_stream*)file; - - if (s == NULL || s->mode != 'r') return 0; - return s->transparent; -} - -/* =========================================================================== - Outputs a long in LSB order to the given file -*/ -local void putLong (file, x) - FILE *file; - uLong x; -{ - int n; - for (n = 0; n < 4; n++) { - fputc((int)(x & 0xff), file); - x >>= 8; - } -} - -/* =========================================================================== - Reads a long in LSB order from the given gz_stream. Sets z_err in case - of error. -*/ -local uLong getLong (s) - gz_stream *s; -{ - uLong x = (uLong)get_byte(s); - int c; - - x += ((uLong)get_byte(s))<<8; - x += ((uLong)get_byte(s))<<16; - c = get_byte(s); - if (c == EOF) s->z_err = Z_DATA_ERROR; - x += ((uLong)c)<<24; - return x; -} - -/* =========================================================================== - Flushes all pending output if necessary, closes the compressed file - and deallocates all the (de)compression state. -*/ -int ZEXPORT gzclose (file) - gzFile file; -{ - gz_stream *s = (gz_stream*)file; - - if (s == NULL) return Z_STREAM_ERROR; - - if (s->mode == 'w') { -#ifdef NO_GZCOMPRESS - return Z_STREAM_ERROR; -#else - if (do_flush (file, Z_FINISH) != Z_OK) - return destroy((gz_stream*)file); - - putLong (s->file, s->crc); - putLong (s->file, (uLong)(s->in & 0xffffffff)); -#endif - } - return destroy((gz_stream*)file); -} - -#ifdef STDC -# define zstrerror(errnum) strerror(errnum) -#else -# define zstrerror(errnum) "" -#endif - -/* =========================================================================== - Returns the error message for the last error which occurred on the - given compressed file. errnum is set to zlib error number. If an - error occurred in the file system and not in the compression library, - errnum is set to Z_ERRNO and the application may consult errno - to get the exact error code. -*/ -const char * ZEXPORT gzerror (file, errnum) - gzFile file; - int *errnum; -{ - char *m; - gz_stream *s = (gz_stream*)file; - - if (s == NULL) { - *errnum = Z_STREAM_ERROR; - return (const char*)ERR_MSG(Z_STREAM_ERROR); - } - *errnum = s->z_err; - if (*errnum == Z_OK) return (const char*)""; - - m = (char*)(*errnum == Z_ERRNO ? zstrerror(errno) : s->stream.msg); - - if (m == NULL || *m == '\0') m = (char*)ERR_MSG(s->z_err); - - TRYFREE(s->msg); - s->msg = (char*)ALLOC(strlen(s->path) + strlen(m) + 3); - if (s->msg == Z_NULL) return (const char*)ERR_MSG(Z_MEM_ERROR); - strcpy(s->msg, s->path); - strcat(s->msg, ": "); - strcat(s->msg, m); - return (const char*)s->msg; -} - -/* =========================================================================== - Clear the error and end-of-file flags, and do the same for the real file. -*/ -void ZEXPORT gzclearerr (file) - gzFile file; -{ - gz_stream *s = (gz_stream*)file; - - if (s == NULL) return; - if (s->z_err != Z_STREAM_END) s->z_err = Z_OK; - s->z_eof = 0; - clearerr(s->file); -} diff --git a/dependencies/zlib/infback.c b/dependencies/zlib/infback.c deleted file mode 100644 index 1e03e1ba..00000000 --- a/dependencies/zlib/infback.c +++ /dev/null @@ -1,623 +0,0 @@ -/* infback.c -- inflate using a call-back interface - * Copyright (C) 1995-2005 Mark Adler - * For conditions of distribution and use, see copyright notice in zlib.h - */ - -/* - This code is largely copied from inflate.c. Normally either infback.o or - inflate.o would be linked into an application--not both. The interface - with inffast.c is retained so that optimized assembler-coded versions of - inflate_fast() can be used with either inflate.c or infback.c. - */ - -#include "zutil.h" -#include "inftrees.h" -#include "inflate.h" -#include "inffast.h" - -/* function prototypes */ -local void fixedtables OF((struct inflate_state FAR *state)); - -/* - strm provides memory allocation functions in zalloc and zfree, or - Z_NULL to use the library memory allocation functions. - - windowBits is in the range 8..15, and window is a user-supplied - window and output buffer that is 2**windowBits bytes. - */ -int ZEXPORT inflateBackInit_(strm, windowBits, window, version, stream_size) -z_streamp strm; -int windowBits; -unsigned char FAR *window; -const char *version; -int stream_size; -{ - struct inflate_state FAR *state; - - if (version == Z_NULL || version[0] != ZLIB_VERSION[0] || - stream_size != (int)(sizeof(z_stream))) - return Z_VERSION_ERROR; - if (strm == Z_NULL || window == Z_NULL || - windowBits < 8 || windowBits > 15) - return Z_STREAM_ERROR; - strm->msg = Z_NULL; /* in case we return an error */ - if (strm->zalloc == (alloc_func)0) { - strm->zalloc = zcalloc; - strm->opaque = (voidpf)0; - } - if (strm->zfree == (free_func)0) strm->zfree = zcfree; - state = (struct inflate_state FAR *)ZALLOC(strm, 1, - sizeof(struct inflate_state)); - if (state == Z_NULL) return Z_MEM_ERROR; - Tracev((stderr, "inflate: allocated\n")); - strm->state = (struct internal_state FAR *)state; - state->dmax = 32768U; - state->wbits = windowBits; - state->wsize = 1U << windowBits; - state->window = window; - state->write = 0; - state->whave = 0; - return Z_OK; -} - -/* - Return state with length and distance decoding tables and index sizes set to - fixed code decoding. Normally this returns fixed tables from inffixed.h. - If BUILDFIXED is defined, then instead this routine builds the tables the - first time it's called, and returns those tables the first time and - thereafter. This reduces the size of the code by about 2K bytes, in - exchange for a little execution time. However, BUILDFIXED should not be - used for threaded applications, since the rewriting of the tables and virgin - may not be thread-safe. - */ -local void fixedtables(state) -struct inflate_state FAR *state; -{ -#ifdef BUILDFIXED - static int virgin = 1; - static code *lenfix, *distfix; - static code fixed[544]; - - /* build fixed huffman tables if first call (may not be thread safe) */ - if (virgin) { - unsigned sym, bits; - static code *next; - - /* literal/length table */ - sym = 0; - while (sym < 144) state->lens[sym++] = 8; - while (sym < 256) state->lens[sym++] = 9; - while (sym < 280) state->lens[sym++] = 7; - while (sym < 288) state->lens[sym++] = 8; - next = fixed; - lenfix = next; - bits = 9; - inflate_table(LENS, state->lens, 288, &(next), &(bits), state->work); - - /* distance table */ - sym = 0; - while (sym < 32) state->lens[sym++] = 5; - distfix = next; - bits = 5; - inflate_table(DISTS, state->lens, 32, &(next), &(bits), state->work); - - /* do this just once */ - virgin = 0; - } -#else /* !BUILDFIXED */ -# include "inffixed.h" -#endif /* BUILDFIXED */ - state->lencode = lenfix; - state->lenbits = 9; - state->distcode = distfix; - state->distbits = 5; -} - -/* Macros for inflateBack(): */ - -/* Load returned state from inflate_fast() */ -#define LOAD() \ - do { \ - put = strm->next_out; \ - left = strm->avail_out; \ - next = strm->next_in; \ - have = strm->avail_in; \ - hold = state->hold; \ - bits = state->bits; \ - } while (0) - -/* Set state from registers for inflate_fast() */ -#define RESTORE() \ - do { \ - strm->next_out = put; \ - strm->avail_out = left; \ - strm->next_in = next; \ - strm->avail_in = have; \ - state->hold = hold; \ - state->bits = bits; \ - } while (0) - -/* Clear the input bit accumulator */ -#define INITBITS() \ - do { \ - hold = 0; \ - bits = 0; \ - } while (0) - -/* Assure that some input is available. If input is requested, but denied, - then return a Z_BUF_ERROR from inflateBack(). */ -#define PULL() \ - do { \ - if (have == 0) { \ - have = in(in_desc, &next); \ - if (have == 0) { \ - next = Z_NULL; \ - ret = Z_BUF_ERROR; \ - goto inf_leave; \ - } \ - } \ - } while (0) - -/* Get a byte of input into the bit accumulator, or return from inflateBack() - with an error if there is no input available. */ -#define PULLBYTE() \ - do { \ - PULL(); \ - have--; \ - hold += (unsigned long)(*next++) << bits; \ - bits += 8; \ - } while (0) - -/* Assure that there are at least n bits in the bit accumulator. If there is - not enough available input to do that, then return from inflateBack() with - an error. */ -#define NEEDBITS(n) \ - do { \ - while (bits < (unsigned)(n)) \ - PULLBYTE(); \ - } while (0) - -/* Return the low n bits of the bit accumulator (n < 16) */ -#define BITS(n) \ - ((unsigned)hold & ((1U << (n)) - 1)) - -/* Remove n bits from the bit accumulator */ -#define DROPBITS(n) \ - do { \ - hold >>= (n); \ - bits -= (unsigned)(n); \ - } while (0) - -/* Remove zero to seven bits as needed to go to a byte boundary */ -#define BYTEBITS() \ - do { \ - hold >>= bits & 7; \ - bits -= bits & 7; \ - } while (0) - -/* Assure that some output space is available, by writing out the window - if it's full. If the write fails, return from inflateBack() with a - Z_BUF_ERROR. */ -#define ROOM() \ - do { \ - if (left == 0) { \ - put = state->window; \ - left = state->wsize; \ - state->whave = left; \ - if (out(out_desc, put, left)) { \ - ret = Z_BUF_ERROR; \ - goto inf_leave; \ - } \ - } \ - } while (0) - -/* - strm provides the memory allocation functions and window buffer on input, - and provides information on the unused input on return. For Z_DATA_ERROR - returns, strm will also provide an error message. - - in() and out() are the call-back input and output functions. When - inflateBack() needs more input, it calls in(). When inflateBack() has - filled the window with output, or when it completes with data in the - window, it calls out() to write out the data. The application must not - change the provided input until in() is called again or inflateBack() - returns. The application must not change the window/output buffer until - inflateBack() returns. - - in() and out() are called with a descriptor parameter provided in the - inflateBack() call. This parameter can be a structure that provides the - information required to do the read or write, as well as accumulated - information on the input and output such as totals and check values. - - in() should return zero on failure. out() should return non-zero on - failure. If either in() or out() fails, than inflateBack() returns a - Z_BUF_ERROR. strm->next_in can be checked for Z_NULL to see whether it - was in() or out() that caused in the error. Otherwise, inflateBack() - returns Z_STREAM_END on success, Z_DATA_ERROR for an deflate format - error, or Z_MEM_ERROR if it could not allocate memory for the state. - inflateBack() can also return Z_STREAM_ERROR if the input parameters - are not correct, i.e. strm is Z_NULL or the state was not initialized. - */ -int ZEXPORT inflateBack(strm, in, in_desc, out, out_desc) -z_streamp strm; -in_func in; -void FAR *in_desc; -out_func out; -void FAR *out_desc; -{ - struct inflate_state FAR *state; - unsigned char FAR *next; /* next input */ - unsigned char FAR *put; /* next output */ - unsigned have, left; /* available input and output */ - unsigned long hold; /* bit buffer */ - unsigned bits; /* bits in bit buffer */ - unsigned copy; /* number of stored or match bytes to copy */ - unsigned char FAR *from; /* where to copy match bytes from */ - code this; /* current decoding table entry */ - code last; /* parent table entry */ - unsigned len; /* length to copy for repeats, bits to drop */ - int ret; /* return code */ - static const unsigned short order[19] = /* permutation of code lengths */ - {16, 17, 18, 0, 8, 7, 9, 6, 10, 5, 11, 4, 12, 3, 13, 2, 14, 1, 15}; - - /* Check that the strm exists and that the state was initialized */ - if (strm == Z_NULL || strm->state == Z_NULL) - return Z_STREAM_ERROR; - state = (struct inflate_state FAR *)strm->state; - - /* Reset the state */ - strm->msg = Z_NULL; - state->mode = TYPE; - state->last = 0; - state->whave = 0; - next = strm->next_in; - have = next != Z_NULL ? strm->avail_in : 0; - hold = 0; - bits = 0; - put = state->window; - left = state->wsize; - - /* Inflate until end of block marked as last */ - for (;;) - switch (state->mode) { - case TYPE: - /* determine and dispatch block type */ - if (state->last) { - BYTEBITS(); - state->mode = DONE; - break; - } - NEEDBITS(3); - state->last = BITS(1); - DROPBITS(1); - switch (BITS(2)) { - case 0: /* stored block */ - Tracev((stderr, "inflate: stored block%s\n", - state->last ? " (last)" : "")); - state->mode = STORED; - break; - case 1: /* fixed block */ - fixedtables(state); - Tracev((stderr, "inflate: fixed codes block%s\n", - state->last ? " (last)" : "")); - state->mode = LEN; /* decode codes */ - break; - case 2: /* dynamic block */ - Tracev((stderr, "inflate: dynamic codes block%s\n", - state->last ? " (last)" : "")); - state->mode = TABLE; - break; - case 3: - strm->msg = (char *)"invalid block type"; - state->mode = BAD; - } - DROPBITS(2); - break; - - case STORED: - /* get and verify stored block length */ - BYTEBITS(); /* go to byte boundary */ - NEEDBITS(32); - if ((hold & 0xffff) != ((hold >> 16) ^ 0xffff)) { - strm->msg = (char *)"invalid stored block lengths"; - state->mode = BAD; - break; - } - state->length = (unsigned)hold & 0xffff; - Tracev((stderr, "inflate: stored length %u\n", - state->length)); - INITBITS(); - - /* copy stored block from input to output */ - while (state->length != 0) { - copy = state->length; - PULL(); - ROOM(); - if (copy > have) copy = have; - if (copy > left) copy = left; - zmemcpy(put, next, copy); - have -= copy; - next += copy; - left -= copy; - put += copy; - state->length -= copy; - } - Tracev((stderr, "inflate: stored end\n")); - state->mode = TYPE; - break; - - case TABLE: - /* get dynamic table entries descriptor */ - NEEDBITS(14); - state->nlen = BITS(5) + 257; - DROPBITS(5); - state->ndist = BITS(5) + 1; - DROPBITS(5); - state->ncode = BITS(4) + 4; - DROPBITS(4); -#ifndef PKZIP_BUG_WORKAROUND - if (state->nlen > 286 || state->ndist > 30) { - strm->msg = (char *)"too many length or distance symbols"; - state->mode = BAD; - break; - } -#endif - Tracev((stderr, "inflate: table sizes ok\n")); - - /* get code length code lengths (not a typo) */ - state->have = 0; - while (state->have < state->ncode) { - NEEDBITS(3); - state->lens[order[state->have++]] = (unsigned short)BITS(3); - DROPBITS(3); - } - while (state->have < 19) - state->lens[order[state->have++]] = 0; - state->next = state->codes; - state->lencode = (code const FAR *)(state->next); - state->lenbits = 7; - ret = inflate_table(CODES, state->lens, 19, &(state->next), - &(state->lenbits), state->work); - if (ret) { - strm->msg = (char *)"invalid code lengths set"; - state->mode = BAD; - break; - } - Tracev((stderr, "inflate: code lengths ok\n")); - - /* get length and distance code code lengths */ - state->have = 0; - while (state->have < state->nlen + state->ndist) { - for (;;) { - this = state->lencode[BITS(state->lenbits)]; - if ((unsigned)(this.bits) <= bits) break; - PULLBYTE(); - } - if (this.val < 16) { - NEEDBITS(this.bits); - DROPBITS(this.bits); - state->lens[state->have++] = this.val; - } - else { - if (this.val == 16) { - NEEDBITS(this.bits + 2); - DROPBITS(this.bits); - if (state->have == 0) { - strm->msg = (char *)"invalid bit length repeat"; - state->mode = BAD; - break; - } - len = (unsigned)(state->lens[state->have - 1]); - copy = 3 + BITS(2); - DROPBITS(2); - } - else if (this.val == 17) { - NEEDBITS(this.bits + 3); - DROPBITS(this.bits); - len = 0; - copy = 3 + BITS(3); - DROPBITS(3); - } - else { - NEEDBITS(this.bits + 7); - DROPBITS(this.bits); - len = 0; - copy = 11 + BITS(7); - DROPBITS(7); - } - if (state->have + copy > state->nlen + state->ndist) { - strm->msg = (char *)"invalid bit length repeat"; - state->mode = BAD; - break; - } - while (copy--) - state->lens[state->have++] = (unsigned short)len; - } - } - - /* handle error breaks in while */ - if (state->mode == BAD) break; - - /* build code tables */ - state->next = state->codes; - state->lencode = (code const FAR *)(state->next); - state->lenbits = 9; - ret = inflate_table(LENS, state->lens, state->nlen, &(state->next), - &(state->lenbits), state->work); - if (ret) { - strm->msg = (char *)"invalid literal/lengths set"; - state->mode = BAD; - break; - } - state->distcode = (code const FAR *)(state->next); - state->distbits = 6; - ret = inflate_table(DISTS, state->lens + state->nlen, state->ndist, - &(state->next), &(state->distbits), state->work); - if (ret) { - strm->msg = (char *)"invalid distances set"; - state->mode = BAD; - break; - } - Tracev((stderr, "inflate: codes ok\n")); - state->mode = LEN; - - case LEN: - /* use inflate_fast() if we have enough input and output */ - if (have >= 6 && left >= 258) { - RESTORE(); - if (state->whave < state->wsize) - state->whave = state->wsize - left; - inflate_fast(strm, state->wsize); - LOAD(); - break; - } - - /* get a literal, length, or end-of-block code */ - for (;;) { - this = state->lencode[BITS(state->lenbits)]; - if ((unsigned)(this.bits) <= bits) break; - PULLBYTE(); - } - if (this.op && (this.op & 0xf0) == 0) { - last = this; - for (;;) { - this = state->lencode[last.val + - (BITS(last.bits + last.op) >> last.bits)]; - if ((unsigned)(last.bits + this.bits) <= bits) break; - PULLBYTE(); - } - DROPBITS(last.bits); - } - DROPBITS(this.bits); - state->length = (unsigned)this.val; - - /* process literal */ - if (this.op == 0) { - Tracevv((stderr, this.val >= 0x20 && this.val < 0x7f ? - "inflate: literal '%c'\n" : - "inflate: literal 0x%02x\n", this.val)); - ROOM(); - *put++ = (unsigned char)(state->length); - left--; - state->mode = LEN; - break; - } - - /* process end of block */ - if (this.op & 32) { - Tracevv((stderr, "inflate: end of block\n")); - state->mode = TYPE; - break; - } - - /* invalid code */ - if (this.op & 64) { - strm->msg = (char *)"invalid literal/length code"; - state->mode = BAD; - break; - } - - /* length code -- get extra bits, if any */ - state->extra = (unsigned)(this.op) & 15; - if (state->extra != 0) { - NEEDBITS(state->extra); - state->length += BITS(state->extra); - DROPBITS(state->extra); - } - Tracevv((stderr, "inflate: length %u\n", state->length)); - - /* get distance code */ - for (;;) { - this = state->distcode[BITS(state->distbits)]; - if ((unsigned)(this.bits) <= bits) break; - PULLBYTE(); - } - if ((this.op & 0xf0) == 0) { - last = this; - for (;;) { - this = state->distcode[last.val + - (BITS(last.bits + last.op) >> last.bits)]; - if ((unsigned)(last.bits + this.bits) <= bits) break; - PULLBYTE(); - } - DROPBITS(last.bits); - } - DROPBITS(this.bits); - if (this.op & 64) { - strm->msg = (char *)"invalid distance code"; - state->mode = BAD; - break; - } - state->offset = (unsigned)this.val; - - /* get distance extra bits, if any */ - state->extra = (unsigned)(this.op) & 15; - if (state->extra != 0) { - NEEDBITS(state->extra); - state->offset += BITS(state->extra); - DROPBITS(state->extra); - } - if (state->offset > state->wsize - (state->whave < state->wsize ? - left : 0)) { - strm->msg = (char *)"invalid distance too far back"; - state->mode = BAD; - break; - } - Tracevv((stderr, "inflate: distance %u\n", state->offset)); - - /* copy match from window to output */ - do { - ROOM(); - copy = state->wsize - state->offset; - if (copy < left) { - from = put + copy; - copy = left - copy; - } - else { - from = put - state->offset; - copy = left; - } - if (copy > state->length) copy = state->length; - state->length -= copy; - left -= copy; - do { - *put++ = *from++; - } while (--copy); - } while (state->length != 0); - break; - - case DONE: - /* inflate stream terminated properly -- write leftover output */ - ret = Z_STREAM_END; - if (left < state->wsize) { - if (out(out_desc, state->window, state->wsize - left)) - ret = Z_BUF_ERROR; - } - goto inf_leave; - - case BAD: - ret = Z_DATA_ERROR; - goto inf_leave; - - default: /* can't happen, but makes compilers happy */ - ret = Z_STREAM_ERROR; - goto inf_leave; - } - - /* Return unused input */ - inf_leave: - strm->next_in = next; - strm->avail_in = have; - return ret; -} - -int ZEXPORT inflateBackEnd(strm) -z_streamp strm; -{ - if (strm == Z_NULL || strm->state == Z_NULL || strm->zfree == (free_func)0) - return Z_STREAM_ERROR; - ZFREE(strm, strm->state); - strm->state = Z_NULL; - Tracev((stderr, "inflate: end\n")); - return Z_OK; -} diff --git a/dependencies/zlib/inffast.c b/dependencies/zlib/inffast.c deleted file mode 100644 index fa31cad9..00000000 --- a/dependencies/zlib/inffast.c +++ /dev/null @@ -1,318 +0,0 @@ -/* inffast.c -- fast decoding - * Copyright (C) 1995-2004 Mark Adler - * For conditions of distribution and use, see copyright notice in zlib.h - */ - -#include "zutil.h" -#include "inftrees.h" -#include "inflate.h" -#include "inffast.h" - -#ifndef ASMINF - -/* Allow machine dependent optimization for post-increment or pre-increment. - Based on testing to date, - Pre-increment preferred for: - - PowerPC G3 (Adler) - - MIPS R5000 (Randers-Pehrson) - Post-increment preferred for: - - none - No measurable difference: - - Pentium III (Anderson) - - M68060 (Nikl) - */ -#ifdef POSTINC -# define OFF 0 -# define PUP(a) *(a)++ -#else -# define OFF 1 -# define PUP(a) *++(a) -#endif - -/* - Decode literal, length, and distance codes and write out the resulting - literal and match bytes until either not enough input or output is - available, an end-of-block is encountered, or a data error is encountered. - When large enough input and output buffers are supplied to inflate(), for - example, a 16K input buffer and a 64K output buffer, more than 95% of the - inflate execution time is spent in this routine. - - Entry assumptions: - - state->mode == LEN - strm->avail_in >= 6 - strm->avail_out >= 258 - start >= strm->avail_out - state->bits < 8 - - On return, state->mode is one of: - - LEN -- ran out of enough output space or enough available input - TYPE -- reached end of block code, inflate() to interpret next block - BAD -- error in block data - - Notes: - - - The maximum input bits used by a length/distance pair is 15 bits for the - length code, 5 bits for the length extra, 15 bits for the distance code, - and 13 bits for the distance extra. This totals 48 bits, or six bytes. - Therefore if strm->avail_in >= 6, then there is enough input to avoid - checking for available input while decoding. - - - The maximum bytes that a single length/distance pair can output is 258 - bytes, which is the maximum length that can be coded. inflate_fast() - requires strm->avail_out >= 258 for each loop to avoid checking for - output space. - */ -void inflate_fast(strm, start) -z_streamp strm; -unsigned start; /* inflate()'s starting value for strm->avail_out */ -{ - struct inflate_state FAR *state; - unsigned char FAR *in; /* local strm->next_in */ - unsigned char FAR *last; /* while in < last, enough input available */ - unsigned char FAR *out; /* local strm->next_out */ - unsigned char FAR *beg; /* inflate()'s initial strm->next_out */ - unsigned char FAR *end; /* while out < end, enough space available */ -#ifdef INFLATE_STRICT - unsigned dmax; /* maximum distance from zlib header */ -#endif - unsigned wsize; /* window size or zero if not using window */ - unsigned whave; /* valid bytes in the window */ - unsigned write; /* window write index */ - unsigned char FAR *window; /* allocated sliding window, if wsize != 0 */ - unsigned long hold; /* local strm->hold */ - unsigned bits; /* local strm->bits */ - code const FAR *lcode; /* local strm->lencode */ - code const FAR *dcode; /* local strm->distcode */ - unsigned lmask; /* mask for first level of length codes */ - unsigned dmask; /* mask for first level of distance codes */ - code this; /* retrieved table entry */ - unsigned op; /* code bits, operation, extra bits, or */ - /* window position, window bytes to copy */ - unsigned len; /* match length, unused bytes */ - unsigned dist; /* match distance */ - unsigned char FAR *from; /* where to copy match from */ - - /* copy state to local variables */ - state = (struct inflate_state FAR *)strm->state; - in = strm->next_in - OFF; - last = in + (strm->avail_in - 5); - out = strm->next_out - OFF; - beg = out - (start - strm->avail_out); - end = out + (strm->avail_out - 257); -#ifdef INFLATE_STRICT - dmax = state->dmax; -#endif - wsize = state->wsize; - whave = state->whave; - write = state->write; - window = state->window; - hold = state->hold; - bits = state->bits; - lcode = state->lencode; - dcode = state->distcode; - lmask = (1U << state->lenbits) - 1; - dmask = (1U << state->distbits) - 1; - - /* decode literals and length/distances until end-of-block or not enough - input data or output space */ - do { - if (bits < 15) { - hold += (unsigned long)(PUP(in)) << bits; - bits += 8; - hold += (unsigned long)(PUP(in)) << bits; - bits += 8; - } - this = lcode[hold & lmask]; - dolen: - op = (unsigned)(this.bits); - hold >>= op; - bits -= op; - op = (unsigned)(this.op); - if (op == 0) { /* literal */ - Tracevv((stderr, this.val >= 0x20 && this.val < 0x7f ? - "inflate: literal '%c'\n" : - "inflate: literal 0x%02x\n", this.val)); - PUP(out) = (unsigned char)(this.val); - } - else if (op & 16) { /* length base */ - len = (unsigned)(this.val); - op &= 15; /* number of extra bits */ - if (op) { - if (bits < op) { - hold += (unsigned long)(PUP(in)) << bits; - bits += 8; - } - len += (unsigned)hold & ((1U << op) - 1); - hold >>= op; - bits -= op; - } - Tracevv((stderr, "inflate: length %u\n", len)); - if (bits < 15) { - hold += (unsigned long)(PUP(in)) << bits; - bits += 8; - hold += (unsigned long)(PUP(in)) << bits; - bits += 8; - } - this = dcode[hold & dmask]; - dodist: - op = (unsigned)(this.bits); - hold >>= op; - bits -= op; - op = (unsigned)(this.op); - if (op & 16) { /* distance base */ - dist = (unsigned)(this.val); - op &= 15; /* number of extra bits */ - if (bits < op) { - hold += (unsigned long)(PUP(in)) << bits; - bits += 8; - if (bits < op) { - hold += (unsigned long)(PUP(in)) << bits; - bits += 8; - } - } - dist += (unsigned)hold & ((1U << op) - 1); -#ifdef INFLATE_STRICT - if (dist > dmax) { - strm->msg = (char *)"invalid distance too far back"; - state->mode = BAD; - break; - } -#endif - hold >>= op; - bits -= op; - Tracevv((stderr, "inflate: distance %u\n", dist)); - op = (unsigned)(out - beg); /* max distance in output */ - if (dist > op) { /* see if copy from window */ - op = dist - op; /* distance back in window */ - if (op > whave) { - strm->msg = (char *)"invalid distance too far back"; - state->mode = BAD; - break; - } - from = window - OFF; - if (write == 0) { /* very common case */ - from += wsize - op; - if (op < len) { /* some from window */ - len -= op; - do { - PUP(out) = PUP(from); - } while (--op); - from = out - dist; /* rest from output */ - } - } - else if (write < op) { /* wrap around window */ - from += wsize + write - op; - op -= write; - if (op < len) { /* some from end of window */ - len -= op; - do { - PUP(out) = PUP(from); - } while (--op); - from = window - OFF; - if (write < len) { /* some from start of window */ - op = write; - len -= op; - do { - PUP(out) = PUP(from); - } while (--op); - from = out - dist; /* rest from output */ - } - } - } - else { /* contiguous in window */ - from += write - op; - if (op < len) { /* some from window */ - len -= op; - do { - PUP(out) = PUP(from); - } while (--op); - from = out - dist; /* rest from output */ - } - } - while (len > 2) { - PUP(out) = PUP(from); - PUP(out) = PUP(from); - PUP(out) = PUP(from); - len -= 3; - } - if (len) { - PUP(out) = PUP(from); - if (len > 1) - PUP(out) = PUP(from); - } - } - else { - from = out - dist; /* copy direct from output */ - do { /* minimum length is three */ - PUP(out) = PUP(from); - PUP(out) = PUP(from); - PUP(out) = PUP(from); - len -= 3; - } while (len > 2); - if (len) { - PUP(out) = PUP(from); - if (len > 1) - PUP(out) = PUP(from); - } - } - } - else if ((op & 64) == 0) { /* 2nd level distance code */ - this = dcode[this.val + (hold & ((1U << op) - 1))]; - goto dodist; - } - else { - strm->msg = (char *)"invalid distance code"; - state->mode = BAD; - break; - } - } - else if ((op & 64) == 0) { /* 2nd level length code */ - this = lcode[this.val + (hold & ((1U << op) - 1))]; - goto dolen; - } - else if (op & 32) { /* end-of-block */ - Tracevv((stderr, "inflate: end of block\n")); - state->mode = TYPE; - break; - } - else { - strm->msg = (char *)"invalid literal/length code"; - state->mode = BAD; - break; - } - } while (in < last && out < end); - - /* return unused bytes (on entry, bits < 8, so in won't go too far back) */ - len = bits >> 3; - in -= len; - bits -= len << 3; - hold &= (1U << bits) - 1; - - /* update state and return */ - strm->next_in = in + OFF; - strm->next_out = out + OFF; - strm->avail_in = (unsigned)(in < last ? 5 + (last - in) : 5 - (in - last)); - strm->avail_out = (unsigned)(out < end ? - 257 + (end - out) : 257 - (out - end)); - state->hold = hold; - state->bits = bits; - return; -} - -/* - inflate_fast() speedups that turned out slower (on a PowerPC G3 750CXe): - - Using bit fields for code structure - - Different op definition to avoid & for extra bits (do & for table bits) - - Three separate decoding do-loops for direct, window, and write == 0 - - Special case for distance > 1 copies to do overlapped load and store copy - - Explicit branch predictions (based on measured branch probabilities) - - Deferring match copy and interspersed it with decoding subsequent codes - - Swapping literal/length else - - Swapping window/direct else - - Larger unrolled copy loops (three is about right) - - Moving len -= 3 statement into middle of loop - */ - -#endif /* !ASMINF */ diff --git a/dependencies/zlib/inffast.h b/dependencies/zlib/inffast.h deleted file mode 100644 index 614fa787..00000000 --- a/dependencies/zlib/inffast.h +++ /dev/null @@ -1,11 +0,0 @@ -/* inffast.h -- header to use inffast.c - * Copyright (C) 1995-2003 Mark Adler - * For conditions of distribution and use, see copyright notice in zlib.h - */ - -/* WARNING: this file should *not* be used by applications. It is - part of the implementation of the compression library and is - subject to change. Applications should only use zlib.h. - */ - -void inflate_fast OF((z_streamp strm, unsigned start)); diff --git a/dependencies/zlib/inffixed.h b/dependencies/zlib/inffixed.h deleted file mode 100644 index 423d5c5b..00000000 --- a/dependencies/zlib/inffixed.h +++ /dev/null @@ -1,94 +0,0 @@ - /* inffixed.h -- table for decoding fixed codes - * Generated automatically by makefixed(). - */ - - /* WARNING: this file should *not* be used by applications. It - is part of the implementation of the compression library and - is subject to change. Applications should only use zlib.h. - */ - - static const code lenfix[512] = { - {96,7,0},{0,8,80},{0,8,16},{20,8,115},{18,7,31},{0,8,112},{0,8,48}, - {0,9,192},{16,7,10},{0,8,96},{0,8,32},{0,9,160},{0,8,0},{0,8,128}, - {0,8,64},{0,9,224},{16,7,6},{0,8,88},{0,8,24},{0,9,144},{19,7,59}, - {0,8,120},{0,8,56},{0,9,208},{17,7,17},{0,8,104},{0,8,40},{0,9,176}, - {0,8,8},{0,8,136},{0,8,72},{0,9,240},{16,7,4},{0,8,84},{0,8,20}, - {21,8,227},{19,7,43},{0,8,116},{0,8,52},{0,9,200},{17,7,13},{0,8,100}, - {0,8,36},{0,9,168},{0,8,4},{0,8,132},{0,8,68},{0,9,232},{16,7,8}, - {0,8,92},{0,8,28},{0,9,152},{20,7,83},{0,8,124},{0,8,60},{0,9,216}, - {18,7,23},{0,8,108},{0,8,44},{0,9,184},{0,8,12},{0,8,140},{0,8,76}, - {0,9,248},{16,7,3},{0,8,82},{0,8,18},{21,8,163},{19,7,35},{0,8,114}, - {0,8,50},{0,9,196},{17,7,11},{0,8,98},{0,8,34},{0,9,164},{0,8,2}, - {0,8,130},{0,8,66},{0,9,228},{16,7,7},{0,8,90},{0,8,26},{0,9,148}, - {20,7,67},{0,8,122},{0,8,58},{0,9,212},{18,7,19},{0,8,106},{0,8,42}, - {0,9,180},{0,8,10},{0,8,138},{0,8,74},{0,9,244},{16,7,5},{0,8,86}, - {0,8,22},{64,8,0},{19,7,51},{0,8,118},{0,8,54},{0,9,204},{17,7,15}, - {0,8,102},{0,8,38},{0,9,172},{0,8,6},{0,8,134},{0,8,70},{0,9,236}, - {16,7,9},{0,8,94},{0,8,30},{0,9,156},{20,7,99},{0,8,126},{0,8,62}, - {0,9,220},{18,7,27},{0,8,110},{0,8,46},{0,9,188},{0,8,14},{0,8,142}, - {0,8,78},{0,9,252},{96,7,0},{0,8,81},{0,8,17},{21,8,131},{18,7,31}, - {0,8,113},{0,8,49},{0,9,194},{16,7,10},{0,8,97},{0,8,33},{0,9,162}, - {0,8,1},{0,8,129},{0,8,65},{0,9,226},{16,7,6},{0,8,89},{0,8,25}, - {0,9,146},{19,7,59},{0,8,121},{0,8,57},{0,9,210},{17,7,17},{0,8,105}, - {0,8,41},{0,9,178},{0,8,9},{0,8,137},{0,8,73},{0,9,242},{16,7,4}, - {0,8,85},{0,8,21},{16,8,258},{19,7,43},{0,8,117},{0,8,53},{0,9,202}, - {17,7,13},{0,8,101},{0,8,37},{0,9,170},{0,8,5},{0,8,133},{0,8,69}, - {0,9,234},{16,7,8},{0,8,93},{0,8,29},{0,9,154},{20,7,83},{0,8,125}, - {0,8,61},{0,9,218},{18,7,23},{0,8,109},{0,8,45},{0,9,186},{0,8,13}, - {0,8,141},{0,8,77},{0,9,250},{16,7,3},{0,8,83},{0,8,19},{21,8,195}, - {19,7,35},{0,8,115},{0,8,51},{0,9,198},{17,7,11},{0,8,99},{0,8,35}, - {0,9,166},{0,8,3},{0,8,131},{0,8,67},{0,9,230},{16,7,7},{0,8,91}, - {0,8,27},{0,9,150},{20,7,67},{0,8,123},{0,8,59},{0,9,214},{18,7,19}, - {0,8,107},{0,8,43},{0,9,182},{0,8,11},{0,8,139},{0,8,75},{0,9,246}, - {16,7,5},{0,8,87},{0,8,23},{64,8,0},{19,7,51},{0,8,119},{0,8,55}, - {0,9,206},{17,7,15},{0,8,103},{0,8,39},{0,9,174},{0,8,7},{0,8,135}, - {0,8,71},{0,9,238},{16,7,9},{0,8,95},{0,8,31},{0,9,158},{20,7,99}, - {0,8,127},{0,8,63},{0,9,222},{18,7,27},{0,8,111},{0,8,47},{0,9,190}, - {0,8,15},{0,8,143},{0,8,79},{0,9,254},{96,7,0},{0,8,80},{0,8,16}, - {20,8,115},{18,7,31},{0,8,112},{0,8,48},{0,9,193},{16,7,10},{0,8,96}, - {0,8,32},{0,9,161},{0,8,0},{0,8,128},{0,8,64},{0,9,225},{16,7,6}, - {0,8,88},{0,8,24},{0,9,145},{19,7,59},{0,8,120},{0,8,56},{0,9,209}, - {17,7,17},{0,8,104},{0,8,40},{0,9,177},{0,8,8},{0,8,136},{0,8,72}, - {0,9,241},{16,7,4},{0,8,84},{0,8,20},{21,8,227},{19,7,43},{0,8,116}, - {0,8,52},{0,9,201},{17,7,13},{0,8,100},{0,8,36},{0,9,169},{0,8,4}, - {0,8,132},{0,8,68},{0,9,233},{16,7,8},{0,8,92},{0,8,28},{0,9,153}, - {20,7,83},{0,8,124},{0,8,60},{0,9,217},{18,7,23},{0,8,108},{0,8,44}, - {0,9,185},{0,8,12},{0,8,140},{0,8,76},{0,9,249},{16,7,3},{0,8,82}, - {0,8,18},{21,8,163},{19,7,35},{0,8,114},{0,8,50},{0,9,197},{17,7,11}, - {0,8,98},{0,8,34},{0,9,165},{0,8,2},{0,8,130},{0,8,66},{0,9,229}, - {16,7,7},{0,8,90},{0,8,26},{0,9,149},{20,7,67},{0,8,122},{0,8,58}, - {0,9,213},{18,7,19},{0,8,106},{0,8,42},{0,9,181},{0,8,10},{0,8,138}, - {0,8,74},{0,9,245},{16,7,5},{0,8,86},{0,8,22},{64,8,0},{19,7,51}, - {0,8,118},{0,8,54},{0,9,205},{17,7,15},{0,8,102},{0,8,38},{0,9,173}, - {0,8,6},{0,8,134},{0,8,70},{0,9,237},{16,7,9},{0,8,94},{0,8,30}, - {0,9,157},{20,7,99},{0,8,126},{0,8,62},{0,9,221},{18,7,27},{0,8,110}, - {0,8,46},{0,9,189},{0,8,14},{0,8,142},{0,8,78},{0,9,253},{96,7,0}, - {0,8,81},{0,8,17},{21,8,131},{18,7,31},{0,8,113},{0,8,49},{0,9,195}, - {16,7,10},{0,8,97},{0,8,33},{0,9,163},{0,8,1},{0,8,129},{0,8,65}, - {0,9,227},{16,7,6},{0,8,89},{0,8,25},{0,9,147},{19,7,59},{0,8,121}, - {0,8,57},{0,9,211},{17,7,17},{0,8,105},{0,8,41},{0,9,179},{0,8,9}, - {0,8,137},{0,8,73},{0,9,243},{16,7,4},{0,8,85},{0,8,21},{16,8,258}, - {19,7,43},{0,8,117},{0,8,53},{0,9,203},{17,7,13},{0,8,101},{0,8,37}, - {0,9,171},{0,8,5},{0,8,133},{0,8,69},{0,9,235},{16,7,8},{0,8,93}, - {0,8,29},{0,9,155},{20,7,83},{0,8,125},{0,8,61},{0,9,219},{18,7,23}, - {0,8,109},{0,8,45},{0,9,187},{0,8,13},{0,8,141},{0,8,77},{0,9,251}, - {16,7,3},{0,8,83},{0,8,19},{21,8,195},{19,7,35},{0,8,115},{0,8,51}, - {0,9,199},{17,7,11},{0,8,99},{0,8,35},{0,9,167},{0,8,3},{0,8,131}, - {0,8,67},{0,9,231},{16,7,7},{0,8,91},{0,8,27},{0,9,151},{20,7,67}, - {0,8,123},{0,8,59},{0,9,215},{18,7,19},{0,8,107},{0,8,43},{0,9,183}, - {0,8,11},{0,8,139},{0,8,75},{0,9,247},{16,7,5},{0,8,87},{0,8,23}, - {64,8,0},{19,7,51},{0,8,119},{0,8,55},{0,9,207},{17,7,15},{0,8,103}, - {0,8,39},{0,9,175},{0,8,7},{0,8,135},{0,8,71},{0,9,239},{16,7,9}, - {0,8,95},{0,8,31},{0,9,159},{20,7,99},{0,8,127},{0,8,63},{0,9,223}, - {18,7,27},{0,8,111},{0,8,47},{0,9,191},{0,8,15},{0,8,143},{0,8,79}, - {0,9,255} - }; - - static const code distfix[32] = { - {16,5,1},{23,5,257},{19,5,17},{27,5,4097},{17,5,5},{25,5,1025}, - {21,5,65},{29,5,16385},{16,5,3},{24,5,513},{20,5,33},{28,5,8193}, - {18,5,9},{26,5,2049},{22,5,129},{64,5,0},{16,5,2},{23,5,385}, - {19,5,25},{27,5,6145},{17,5,7},{25,5,1537},{21,5,97},{29,5,24577}, - {16,5,4},{24,5,769},{20,5,49},{28,5,12289},{18,5,13},{26,5,3073}, - {22,5,193},{64,5,0} - }; diff --git a/dependencies/zlib/inflate.c b/dependencies/zlib/inflate.c deleted file mode 100644 index 33ea9029..00000000 --- a/dependencies/zlib/inflate.c +++ /dev/null @@ -1,1368 +0,0 @@ -/* inflate.c -- zlib decompression - * Copyright (C) 1995-2005 Mark Adler - * For conditions of distribution and use, see copyright notice in zlib.h - */ - -/* - * Change history: - * - * 1.2.beta0 24 Nov 2002 - * - First version -- complete rewrite of inflate to simplify code, avoid - * creation of window when not needed, minimize use of window when it is - * needed, make inffast.c even faster, implement gzip decoding, and to - * improve code readability and style over the previous zlib inflate code - * - * 1.2.beta1 25 Nov 2002 - * - Use pointers for available input and output checking in inffast.c - * - Remove input and output counters in inffast.c - * - Change inffast.c entry and loop from avail_in >= 7 to >= 6 - * - Remove unnecessary second byte pull from length extra in inffast.c - * - Unroll direct copy to three copies per loop in inffast.c - * - * 1.2.beta2 4 Dec 2002 - * - Change external routine names to reduce potential conflicts - * - Correct filename to inffixed.h for fixed tables in inflate.c - * - Make hbuf[] unsigned char to match parameter type in inflate.c - * - Change strm->next_out[-state->offset] to *(strm->next_out - state->offset) - * to avoid negation problem on Alphas (64 bit) in inflate.c - * - * 1.2.beta3 22 Dec 2002 - * - Add comments on state->bits assertion in inffast.c - * - Add comments on op field in inftrees.h - * - Fix bug in reuse of allocated window after inflateReset() - * - Remove bit fields--back to byte structure for speed - * - Remove distance extra == 0 check in inflate_fast()--only helps for lengths - * - Change post-increments to pre-increments in inflate_fast(), PPC biased? - * - Add compile time option, POSTINC, to use post-increments instead (Intel?) - * - Make MATCH copy in inflate() much faster for when inflate_fast() not used - * - Use local copies of stream next and avail values, as well as local bit - * buffer and bit count in inflate()--for speed when inflate_fast() not used - * - * 1.2.beta4 1 Jan 2003 - * - Split ptr - 257 statements in inflate_table() to avoid compiler warnings - * - Move a comment on output buffer sizes from inffast.c to inflate.c - * - Add comments in inffast.c to introduce the inflate_fast() routine - * - Rearrange window copies in inflate_fast() for speed and simplification - * - Unroll last copy for window match in inflate_fast() - * - Use local copies of window variables in inflate_fast() for speed - * - Pull out common write == 0 case for speed in inflate_fast() - * - Make op and len in inflate_fast() unsigned for consistency - * - Add FAR to lcode and dcode declarations in inflate_fast() - * - Simplified bad distance check in inflate_fast() - * - Added inflateBackInit(), inflateBack(), and inflateBackEnd() in new - * source file infback.c to provide a call-back interface to inflate for - * programs like gzip and unzip -- uses window as output buffer to avoid - * window copying - * - * 1.2.beta5 1 Jan 2003 - * - Improved inflateBack() interface to allow the caller to provide initial - * input in strm. - * - Fixed stored blocks bug in inflateBack() - * - * 1.2.beta6 4 Jan 2003 - * - Added comments in inffast.c on effectiveness of POSTINC - * - Typecasting all around to reduce compiler warnings - * - Changed loops from while (1) or do {} while (1) to for (;;), again to - * make compilers happy - * - Changed type of window in inflateBackInit() to unsigned char * - * - * 1.2.beta7 27 Jan 2003 - * - Changed many types to unsigned or unsigned short to avoid warnings - * - Added inflateCopy() function - * - * 1.2.0 9 Mar 2003 - * - Changed inflateBack() interface to provide separate opaque descriptors - * for the in() and out() functions - * - Changed inflateBack() argument and in_func typedef to swap the length - * and buffer address return values for the input function - * - Check next_in and next_out for Z_NULL on entry to inflate() - * - * The history for versions after 1.2.0 are in ChangeLog in zlib distribution. - */ - -#include "zutil.h" -#include "inftrees.h" -#include "inflate.h" -#include "inffast.h" - -#ifdef MAKEFIXED -# ifndef BUILDFIXED -# define BUILDFIXED -# endif -#endif - -/* function prototypes */ -local void fixedtables OF((struct inflate_state FAR *state)); -local int updatewindow OF((z_streamp strm, unsigned out)); -#ifdef BUILDFIXED - void makefixed OF((void)); -#endif -local unsigned syncsearch OF((unsigned FAR *have, unsigned char FAR *buf, - unsigned len)); - -int ZEXPORT inflateReset(strm) -z_streamp strm; -{ - struct inflate_state FAR *state; - - if (strm == Z_NULL || strm->state == Z_NULL) return Z_STREAM_ERROR; - state = (struct inflate_state FAR *)strm->state; - strm->total_in = strm->total_out = state->total = 0; - strm->msg = Z_NULL; - strm->adler = 1; /* to support ill-conceived Java test suite */ - state->mode = HEAD; - state->last = 0; - state->havedict = 0; - state->dmax = 32768U; - state->head = Z_NULL; - state->wsize = 0; - state->whave = 0; - state->write = 0; - state->hold = 0; - state->bits = 0; - state->lencode = state->distcode = state->next = state->codes; - Tracev((stderr, "inflate: reset\n")); - return Z_OK; -} - -int ZEXPORT inflatePrime(strm, bits, value) -z_streamp strm; -int bits; -int value; -{ - struct inflate_state FAR *state; - - if (strm == Z_NULL || strm->state == Z_NULL) return Z_STREAM_ERROR; - state = (struct inflate_state FAR *)strm->state; - if (bits > 16 || state->bits + bits > 32) return Z_STREAM_ERROR; - value &= (1L << bits) - 1; - state->hold += value << state->bits; - state->bits += bits; - return Z_OK; -} - -int ZEXPORT inflateInit2_(strm, windowBits, version, stream_size) -z_streamp strm; -int windowBits; -const char *version; -int stream_size; -{ - struct inflate_state FAR *state; - - if (version == Z_NULL || version[0] != ZLIB_VERSION[0] || - stream_size != (int)(sizeof(z_stream))) - return Z_VERSION_ERROR; - if (strm == Z_NULL) return Z_STREAM_ERROR; - strm->msg = Z_NULL; /* in case we return an error */ - if (strm->zalloc == (alloc_func)0) { - strm->zalloc = zcalloc; - strm->opaque = (voidpf)0; - } - if (strm->zfree == (free_func)0) strm->zfree = zcfree; - state = (struct inflate_state FAR *) - ZALLOC(strm, 1, sizeof(struct inflate_state)); - if (state == Z_NULL) return Z_MEM_ERROR; - Tracev((stderr, "inflate: allocated\n")); - strm->state = (struct internal_state FAR *)state; - if (windowBits < 0) { - state->wrap = 0; - windowBits = -windowBits; - } - else { - state->wrap = (windowBits >> 4) + 1; -#ifdef GUNZIP - if (windowBits < 48) windowBits &= 15; -#endif - } - if (windowBits < 8 || windowBits > 15) { - ZFREE(strm, state); - strm->state = Z_NULL; - return Z_STREAM_ERROR; - } - state->wbits = (unsigned)windowBits; - state->window = Z_NULL; - return inflateReset(strm); -} - -int ZEXPORT inflateInit_(strm, version, stream_size) -z_streamp strm; -const char *version; -int stream_size; -{ - return inflateInit2_(strm, DEF_WBITS, version, stream_size); -} - -/* - Return state with length and distance decoding tables and index sizes set to - fixed code decoding. Normally this returns fixed tables from inffixed.h. - If BUILDFIXED is defined, then instead this routine builds the tables the - first time it's called, and returns those tables the first time and - thereafter. This reduces the size of the code by about 2K bytes, in - exchange for a little execution time. However, BUILDFIXED should not be - used for threaded applications, since the rewriting of the tables and virgin - may not be thread-safe. - */ -local void fixedtables(state) -struct inflate_state FAR *state; -{ -#ifdef BUILDFIXED - static int virgin = 1; - static code *lenfix, *distfix; - static code fixed[544]; - - /* build fixed huffman tables if first call (may not be thread safe) */ - if (virgin) { - unsigned sym, bits; - static code *next; - - /* literal/length table */ - sym = 0; - while (sym < 144) state->lens[sym++] = 8; - while (sym < 256) state->lens[sym++] = 9; - while (sym < 280) state->lens[sym++] = 7; - while (sym < 288) state->lens[sym++] = 8; - next = fixed; - lenfix = next; - bits = 9; - inflate_table(LENS, state->lens, 288, &(next), &(bits), state->work); - - /* distance table */ - sym = 0; - while (sym < 32) state->lens[sym++] = 5; - distfix = next; - bits = 5; - inflate_table(DISTS, state->lens, 32, &(next), &(bits), state->work); - - /* do this just once */ - virgin = 0; - } -#else /* !BUILDFIXED */ -# include "inffixed.h" -#endif /* BUILDFIXED */ - state->lencode = lenfix; - state->lenbits = 9; - state->distcode = distfix; - state->distbits = 5; -} - -#ifdef MAKEFIXED -#include - -/* - Write out the inffixed.h that is #include'd above. Defining MAKEFIXED also - defines BUILDFIXED, so the tables are built on the fly. makefixed() writes - those tables to stdout, which would be piped to inffixed.h. A small program - can simply call makefixed to do this: - - void makefixed(void); - - int main(void) - { - makefixed(); - return 0; - } - - Then that can be linked with zlib built with MAKEFIXED defined and run: - - a.out > inffixed.h - */ -void makefixed() -{ - unsigned low, size; - struct inflate_state state; - - fixedtables(&state); - puts(" /* inffixed.h -- table for decoding fixed codes"); - puts(" * Generated automatically by makefixed()."); - puts(" */"); - puts(""); - puts(" /* WARNING: this file should *not* be used by applications."); - puts(" It is part of the implementation of this library and is"); - puts(" subject to change. Applications should only use zlib.h."); - puts(" */"); - puts(""); - size = 1U << 9; - printf(" static const code lenfix[%u] = {", size); - low = 0; - for (;;) { - if ((low % 7) == 0) printf("\n "); - printf("{%u,%u,%d}", state.lencode[low].op, state.lencode[low].bits, - state.lencode[low].val); - if (++low == size) break; - putchar(','); - } - puts("\n };"); - size = 1U << 5; - printf("\n static const code distfix[%u] = {", size); - low = 0; - for (;;) { - if ((low % 6) == 0) printf("\n "); - printf("{%u,%u,%d}", state.distcode[low].op, state.distcode[low].bits, - state.distcode[low].val); - if (++low == size) break; - putchar(','); - } - puts("\n };"); -} -#endif /* MAKEFIXED */ - -/* - Update the window with the last wsize (normally 32K) bytes written before - returning. If window does not exist yet, create it. This is only called - when a window is already in use, or when output has been written during this - inflate call, but the end of the deflate stream has not been reached yet. - It is also called to create a window for dictionary data when a dictionary - is loaded. - - Providing output buffers larger than 32K to inflate() should provide a speed - advantage, since only the last 32K of output is copied to the sliding window - upon return from inflate(), and since all distances after the first 32K of - output will fall in the output data, making match copies simpler and faster. - The advantage may be dependent on the size of the processor's data caches. - */ -local int updatewindow(strm, out) -z_streamp strm; -unsigned out; -{ - struct inflate_state FAR *state; - unsigned copy, dist; - - state = (struct inflate_state FAR *)strm->state; - - /* if it hasn't been done already, allocate space for the window */ - if (state->window == Z_NULL) { - state->window = (unsigned char FAR *) - ZALLOC(strm, 1U << state->wbits, - sizeof(unsigned char)); - if (state->window == Z_NULL) return 1; - } - - /* if window not in use yet, initialize */ - if (state->wsize == 0) { - state->wsize = 1U << state->wbits; - state->write = 0; - state->whave = 0; - } - - /* copy state->wsize or less output bytes into the circular window */ - copy = out - strm->avail_out; - if (copy >= state->wsize) { - zmemcpy(state->window, strm->next_out - state->wsize, state->wsize); - state->write = 0; - state->whave = state->wsize; - } - else { - dist = state->wsize - state->write; - if (dist > copy) dist = copy; - zmemcpy(state->window + state->write, strm->next_out - copy, dist); - copy -= dist; - if (copy) { - zmemcpy(state->window, strm->next_out - copy, copy); - state->write = copy; - state->whave = state->wsize; - } - else { - state->write += dist; - if (state->write == state->wsize) state->write = 0; - if (state->whave < state->wsize) state->whave += dist; - } - } - return 0; -} - -/* Macros for inflate(): */ - -/* check function to use adler32() for zlib or crc32() for gzip */ -#ifdef GUNZIP -# define UPDATE(check, buf, len) \ - (state->flags ? crc32(check, buf, len) : adler32(check, buf, len)) -#else -# define UPDATE(check, buf, len) adler32(check, buf, len) -#endif - -/* check macros for header crc */ -#ifdef GUNZIP -# define CRC2(check, word) \ - do { \ - hbuf[0] = (unsigned char)(word); \ - hbuf[1] = (unsigned char)((word) >> 8); \ - check = crc32(check, hbuf, 2); \ - } while (0) - -# define CRC4(check, word) \ - do { \ - hbuf[0] = (unsigned char)(word); \ - hbuf[1] = (unsigned char)((word) >> 8); \ - hbuf[2] = (unsigned char)((word) >> 16); \ - hbuf[3] = (unsigned char)((word) >> 24); \ - check = crc32(check, hbuf, 4); \ - } while (0) -#endif - -/* Load registers with state in inflate() for speed */ -#define LOAD() \ - do { \ - put = strm->next_out; \ - left = strm->avail_out; \ - next = strm->next_in; \ - have = strm->avail_in; \ - hold = state->hold; \ - bits = state->bits; \ - } while (0) - -/* Restore state from registers in inflate() */ -#define RESTORE() \ - do { \ - strm->next_out = put; \ - strm->avail_out = left; \ - strm->next_in = next; \ - strm->avail_in = have; \ - state->hold = hold; \ - state->bits = bits; \ - } while (0) - -/* Clear the input bit accumulator */ -#define INITBITS() \ - do { \ - hold = 0; \ - bits = 0; \ - } while (0) - -/* Get a byte of input into the bit accumulator, or return from inflate() - if there is no input available. */ -#define PULLBYTE() \ - do { \ - if (have == 0) goto inf_leave; \ - have--; \ - hold += (unsigned long)(*next++) << bits; \ - bits += 8; \ - } while (0) - -/* Assure that there are at least n bits in the bit accumulator. If there is - not enough available input to do that, then return from inflate(). */ -#define NEEDBITS(n) \ - do { \ - while (bits < (unsigned)(n)) \ - PULLBYTE(); \ - } while (0) - -/* Return the low n bits of the bit accumulator (n < 16) */ -#define BITS(n) \ - ((unsigned)hold & ((1U << (n)) - 1)) - -/* Remove n bits from the bit accumulator */ -#define DROPBITS(n) \ - do { \ - hold >>= (n); \ - bits -= (unsigned)(n); \ - } while (0) - -/* Remove zero to seven bits as needed to go to a byte boundary */ -#define BYTEBITS() \ - do { \ - hold >>= bits & 7; \ - bits -= bits & 7; \ - } while (0) - -/* Reverse the bytes in a 32-bit value */ -#define REVERSE(q) \ - ((((q) >> 24) & 0xff) + (((q) >> 8) & 0xff00) + \ - (((q) & 0xff00) << 8) + (((q) & 0xff) << 24)) - -/* - inflate() uses a state machine to process as much input data and generate as - much output data as possible before returning. The state machine is - structured roughly as follows: - - for (;;) switch (state) { - ... - case STATEn: - if (not enough input data or output space to make progress) - return; - ... make progress ... - state = STATEm; - break; - ... - } - - so when inflate() is called again, the same case is attempted again, and - if the appropriate resources are provided, the machine proceeds to the - next state. The NEEDBITS() macro is usually the way the state evaluates - whether it can proceed or should return. NEEDBITS() does the return if - the requested bits are not available. The typical use of the BITS macros - is: - - NEEDBITS(n); - ... do something with BITS(n) ... - DROPBITS(n); - - where NEEDBITS(n) either returns from inflate() if there isn't enough - input left to load n bits into the accumulator, or it continues. BITS(n) - gives the low n bits in the accumulator. When done, DROPBITS(n) drops - the low n bits off the accumulator. INITBITS() clears the accumulator - and sets the number of available bits to zero. BYTEBITS() discards just - enough bits to put the accumulator on a byte boundary. After BYTEBITS() - and a NEEDBITS(8), then BITS(8) would return the next byte in the stream. - - NEEDBITS(n) uses PULLBYTE() to get an available byte of input, or to return - if there is no input available. The decoding of variable length codes uses - PULLBYTE() directly in order to pull just enough bytes to decode the next - code, and no more. - - Some states loop until they get enough input, making sure that enough - state information is maintained to continue the loop where it left off - if NEEDBITS() returns in the loop. For example, want, need, and keep - would all have to actually be part of the saved state in case NEEDBITS() - returns: - - case STATEw: - while (want < need) { - NEEDBITS(n); - keep[want++] = BITS(n); - DROPBITS(n); - } - state = STATEx; - case STATEx: - - As shown above, if the next state is also the next case, then the break - is omitted. - - A state may also return if there is not enough output space available to - complete that state. Those states are copying stored data, writing a - literal byte, and copying a matching string. - - When returning, a "goto inf_leave" is used to update the total counters, - update the check value, and determine whether any progress has been made - during that inflate() call in order to return the proper return code. - Progress is defined as a change in either strm->avail_in or strm->avail_out. - When there is a window, goto inf_leave will update the window with the last - output written. If a goto inf_leave occurs in the middle of decompression - and there is no window currently, goto inf_leave will create one and copy - output to the window for the next call of inflate(). - - In this implementation, the flush parameter of inflate() only affects the - return code (per zlib.h). inflate() always writes as much as possible to - strm->next_out, given the space available and the provided input--the effect - documented in zlib.h of Z_SYNC_FLUSH. Furthermore, inflate() always defers - the allocation of and copying into a sliding window until necessary, which - provides the effect documented in zlib.h for Z_FINISH when the entire input - stream available. So the only thing the flush parameter actually does is: - when flush is set to Z_FINISH, inflate() cannot return Z_OK. Instead it - will return Z_BUF_ERROR if it has not reached the end of the stream. - */ - -int ZEXPORT inflate(strm, flush) -z_streamp strm; -int flush; -{ - struct inflate_state FAR *state; - unsigned char FAR *next; /* next input */ - unsigned char FAR *put; /* next output */ - unsigned have, left; /* available input and output */ - unsigned long hold; /* bit buffer */ - unsigned bits; /* bits in bit buffer */ - unsigned in, out; /* save starting available input and output */ - unsigned copy; /* number of stored or match bytes to copy */ - unsigned char FAR *from; /* where to copy match bytes from */ - code this; /* current decoding table entry */ - code last; /* parent table entry */ - unsigned len; /* length to copy for repeats, bits to drop */ - int ret; /* return code */ -#ifdef GUNZIP - unsigned char hbuf[4]; /* buffer for gzip header crc calculation */ -#endif - static const unsigned short order[19] = /* permutation of code lengths */ - {16, 17, 18, 0, 8, 7, 9, 6, 10, 5, 11, 4, 12, 3, 13, 2, 14, 1, 15}; - - if (strm == Z_NULL || strm->state == Z_NULL || strm->next_out == Z_NULL || - (strm->next_in == Z_NULL && strm->avail_in != 0)) - return Z_STREAM_ERROR; - - state = (struct inflate_state FAR *)strm->state; - if (state->mode == TYPE) state->mode = TYPEDO; /* skip check */ - LOAD(); - in = have; - out = left; - ret = Z_OK; - for (;;) - switch (state->mode) { - case HEAD: - if (state->wrap == 0) { - state->mode = TYPEDO; - break; - } - NEEDBITS(16); -#ifdef GUNZIP - if ((state->wrap & 2) && hold == 0x8b1f) { /* gzip header */ - state->check = crc32(0L, Z_NULL, 0); - CRC2(state->check, hold); - INITBITS(); - state->mode = FLAGS; - break; - } - state->flags = 0; /* expect zlib header */ - if (state->head != Z_NULL) - state->head->done = -1; - if (!(state->wrap & 1) || /* check if zlib header allowed */ -#else - if ( -#endif - ((BITS(8) << 8) + (hold >> 8)) % 31) { - strm->msg = (char *)"incorrect header check"; - state->mode = BAD; - break; - } - if (BITS(4) != Z_DEFLATED) { - strm->msg = (char *)"unknown compression method"; - state->mode = BAD; - break; - } - DROPBITS(4); - len = BITS(4) + 8; - if (len > state->wbits) { - strm->msg = (char *)"invalid window size"; - state->mode = BAD; - break; - } - state->dmax = 1U << len; - Tracev((stderr, "inflate: zlib header ok\n")); - strm->adler = state->check = adler32(0L, Z_NULL, 0); - state->mode = hold & 0x200 ? DICTID : TYPE; - INITBITS(); - break; -#ifdef GUNZIP - case FLAGS: - NEEDBITS(16); - state->flags = (int)(hold); - if ((state->flags & 0xff) != Z_DEFLATED) { - strm->msg = (char *)"unknown compression method"; - state->mode = BAD; - break; - } - if (state->flags & 0xe000) { - strm->msg = (char *)"unknown header flags set"; - state->mode = BAD; - break; - } - if (state->head != Z_NULL) - state->head->text = (int)((hold >> 8) & 1); - if (state->flags & 0x0200) CRC2(state->check, hold); - INITBITS(); - state->mode = TIME; - case TIME: - NEEDBITS(32); - if (state->head != Z_NULL) - state->head->time = hold; - if (state->flags & 0x0200) CRC4(state->check, hold); - INITBITS(); - state->mode = OS; - case OS: - NEEDBITS(16); - if (state->head != Z_NULL) { - state->head->xflags = (int)(hold & 0xff); - state->head->os = (int)(hold >> 8); - } - if (state->flags & 0x0200) CRC2(state->check, hold); - INITBITS(); - state->mode = EXLEN; - case EXLEN: - if (state->flags & 0x0400) { - NEEDBITS(16); - state->length = (unsigned)(hold); - if (state->head != Z_NULL) - state->head->extra_len = (unsigned)hold; - if (state->flags & 0x0200) CRC2(state->check, hold); - INITBITS(); - } - else if (state->head != Z_NULL) - state->head->extra = Z_NULL; - state->mode = EXTRA; - case EXTRA: - if (state->flags & 0x0400) { - copy = state->length; - if (copy > have) copy = have; - if (copy) { - if (state->head != Z_NULL && - state->head->extra != Z_NULL) { - len = state->head->extra_len - state->length; - zmemcpy(state->head->extra + len, next, - len + copy > state->head->extra_max ? - state->head->extra_max - len : copy); - } - if (state->flags & 0x0200) - state->check = crc32(state->check, next, copy); - have -= copy; - next += copy; - state->length -= copy; - } - if (state->length) goto inf_leave; - } - state->length = 0; - state->mode = NAME; - case NAME: - if (state->flags & 0x0800) { - if (have == 0) goto inf_leave; - copy = 0; - do { - len = (unsigned)(next[copy++]); - if (state->head != Z_NULL && - state->head->name != Z_NULL && - state->length < state->head->name_max) - state->head->name[state->length++] = len; - } while (len && copy < have); - if (state->flags & 0x0200) - state->check = crc32(state->check, next, copy); - have -= copy; - next += copy; - if (len) goto inf_leave; - } - else if (state->head != Z_NULL) - state->head->name = Z_NULL; - state->length = 0; - state->mode = COMMENT; - case COMMENT: - if (state->flags & 0x1000) { - if (have == 0) goto inf_leave; - copy = 0; - do { - len = (unsigned)(next[copy++]); - if (state->head != Z_NULL && - state->head->comment != Z_NULL && - state->length < state->head->comm_max) - state->head->comment[state->length++] = len; - } while (len && copy < have); - if (state->flags & 0x0200) - state->check = crc32(state->check, next, copy); - have -= copy; - next += copy; - if (len) goto inf_leave; - } - else if (state->head != Z_NULL) - state->head->comment = Z_NULL; - state->mode = HCRC; - case HCRC: - if (state->flags & 0x0200) { - NEEDBITS(16); - if (hold != (state->check & 0xffff)) { - strm->msg = (char *)"header crc mismatch"; - state->mode = BAD; - break; - } - INITBITS(); - } - if (state->head != Z_NULL) { - state->head->hcrc = (int)((state->flags >> 9) & 1); - state->head->done = 1; - } - strm->adler = state->check = crc32(0L, Z_NULL, 0); - state->mode = TYPE; - break; -#endif - case DICTID: - NEEDBITS(32); - strm->adler = state->check = REVERSE(hold); - INITBITS(); - state->mode = DICT; - case DICT: - if (state->havedict == 0) { - RESTORE(); - return Z_NEED_DICT; - } - strm->adler = state->check = adler32(0L, Z_NULL, 0); - state->mode = TYPE; - case TYPE: - if (flush == Z_BLOCK) goto inf_leave; - case TYPEDO: - if (state->last) { - BYTEBITS(); - state->mode = CHECK; - break; - } - NEEDBITS(3); - state->last = BITS(1); - DROPBITS(1); - switch (BITS(2)) { - case 0: /* stored block */ - Tracev((stderr, "inflate: stored block%s\n", - state->last ? " (last)" : "")); - state->mode = STORED; - break; - case 1: /* fixed block */ - fixedtables(state); - Tracev((stderr, "inflate: fixed codes block%s\n", - state->last ? " (last)" : "")); - state->mode = LEN; /* decode codes */ - break; - case 2: /* dynamic block */ - Tracev((stderr, "inflate: dynamic codes block%s\n", - state->last ? " (last)" : "")); - state->mode = TABLE; - break; - case 3: - strm->msg = (char *)"invalid block type"; - state->mode = BAD; - } - DROPBITS(2); - break; - case STORED: - BYTEBITS(); /* go to byte boundary */ - NEEDBITS(32); - if ((hold & 0xffff) != ((hold >> 16) ^ 0xffff)) { - strm->msg = (char *)"invalid stored block lengths"; - state->mode = BAD; - break; - } - state->length = (unsigned)hold & 0xffff; - Tracev((stderr, "inflate: stored length %u\n", - state->length)); - INITBITS(); - state->mode = COPY; - case COPY: - copy = state->length; - if (copy) { - if (copy > have) copy = have; - if (copy > left) copy = left; - if (copy == 0) goto inf_leave; - zmemcpy(put, next, copy); - have -= copy; - next += copy; - left -= copy; - put += copy; - state->length -= copy; - break; - } - Tracev((stderr, "inflate: stored end\n")); - state->mode = TYPE; - break; - case TABLE: - NEEDBITS(14); - state->nlen = BITS(5) + 257; - DROPBITS(5); - state->ndist = BITS(5) + 1; - DROPBITS(5); - state->ncode = BITS(4) + 4; - DROPBITS(4); -#ifndef PKZIP_BUG_WORKAROUND - if (state->nlen > 286 || state->ndist > 30) { - strm->msg = (char *)"too many length or distance symbols"; - state->mode = BAD; - break; - } -#endif - Tracev((stderr, "inflate: table sizes ok\n")); - state->have = 0; - state->mode = LENLENS; - case LENLENS: - while (state->have < state->ncode) { - NEEDBITS(3); - state->lens[order[state->have++]] = (unsigned short)BITS(3); - DROPBITS(3); - } - while (state->have < 19) - state->lens[order[state->have++]] = 0; - state->next = state->codes; - state->lencode = (code const FAR *)(state->next); - state->lenbits = 7; - ret = inflate_table(CODES, state->lens, 19, &(state->next), - &(state->lenbits), state->work); - if (ret) { - strm->msg = (char *)"invalid code lengths set"; - state->mode = BAD; - break; - } - Tracev((stderr, "inflate: code lengths ok\n")); - state->have = 0; - state->mode = CODELENS; - case CODELENS: - while (state->have < state->nlen + state->ndist) { - for (;;) { - this = state->lencode[BITS(state->lenbits)]; - if ((unsigned)(this.bits) <= bits) break; - PULLBYTE(); - } - if (this.val < 16) { - NEEDBITS(this.bits); - DROPBITS(this.bits); - state->lens[state->have++] = this.val; - } - else { - if (this.val == 16) { - NEEDBITS(this.bits + 2); - DROPBITS(this.bits); - if (state->have == 0) { - strm->msg = (char *)"invalid bit length repeat"; - state->mode = BAD; - break; - } - len = state->lens[state->have - 1]; - copy = 3 + BITS(2); - DROPBITS(2); - } - else if (this.val == 17) { - NEEDBITS(this.bits + 3); - DROPBITS(this.bits); - len = 0; - copy = 3 + BITS(3); - DROPBITS(3); - } - else { - NEEDBITS(this.bits + 7); - DROPBITS(this.bits); - len = 0; - copy = 11 + BITS(7); - DROPBITS(7); - } - if (state->have + copy > state->nlen + state->ndist) { - strm->msg = (char *)"invalid bit length repeat"; - state->mode = BAD; - break; - } - while (copy--) - state->lens[state->have++] = (unsigned short)len; - } - } - - /* handle error breaks in while */ - if (state->mode == BAD) break; - - /* build code tables */ - state->next = state->codes; - state->lencode = (code const FAR *)(state->next); - state->lenbits = 9; - ret = inflate_table(LENS, state->lens, state->nlen, &(state->next), - &(state->lenbits), state->work); - if (ret) { - strm->msg = (char *)"invalid literal/lengths set"; - state->mode = BAD; - break; - } - state->distcode = (code const FAR *)(state->next); - state->distbits = 6; - ret = inflate_table(DISTS, state->lens + state->nlen, state->ndist, - &(state->next), &(state->distbits), state->work); - if (ret) { - strm->msg = (char *)"invalid distances set"; - state->mode = BAD; - break; - } - Tracev((stderr, "inflate: codes ok\n")); - state->mode = LEN; - case LEN: - if (have >= 6 && left >= 258) { - RESTORE(); - inflate_fast(strm, out); - LOAD(); - break; - } - for (;;) { - this = state->lencode[BITS(state->lenbits)]; - if ((unsigned)(this.bits) <= bits) break; - PULLBYTE(); - } - if (this.op && (this.op & 0xf0) == 0) { - last = this; - for (;;) { - this = state->lencode[last.val + - (BITS(last.bits + last.op) >> last.bits)]; - if ((unsigned)(last.bits + this.bits) <= bits) break; - PULLBYTE(); - } - DROPBITS(last.bits); - } - DROPBITS(this.bits); - state->length = (unsigned)this.val; - if ((int)(this.op) == 0) { - Tracevv((stderr, this.val >= 0x20 && this.val < 0x7f ? - "inflate: literal '%c'\n" : - "inflate: literal 0x%02x\n", this.val)); - state->mode = LIT; - break; - } - if (this.op & 32) { - Tracevv((stderr, "inflate: end of block\n")); - state->mode = TYPE; - break; - } - if (this.op & 64) { - strm->msg = (char *)"invalid literal/length code"; - state->mode = BAD; - break; - } - state->extra = (unsigned)(this.op) & 15; - state->mode = LENEXT; - case LENEXT: - if (state->extra) { - NEEDBITS(state->extra); - state->length += BITS(state->extra); - DROPBITS(state->extra); - } - Tracevv((stderr, "inflate: length %u\n", state->length)); - state->mode = DIST; - case DIST: - for (;;) { - this = state->distcode[BITS(state->distbits)]; - if ((unsigned)(this.bits) <= bits) break; - PULLBYTE(); - } - if ((this.op & 0xf0) == 0) { - last = this; - for (;;) { - this = state->distcode[last.val + - (BITS(last.bits + last.op) >> last.bits)]; - if ((unsigned)(last.bits + this.bits) <= bits) break; - PULLBYTE(); - } - DROPBITS(last.bits); - } - DROPBITS(this.bits); - if (this.op & 64) { - strm->msg = (char *)"invalid distance code"; - state->mode = BAD; - break; - } - state->offset = (unsigned)this.val; - state->extra = (unsigned)(this.op) & 15; - state->mode = DISTEXT; - case DISTEXT: - if (state->extra) { - NEEDBITS(state->extra); - state->offset += BITS(state->extra); - DROPBITS(state->extra); - } -#ifdef INFLATE_STRICT - if (state->offset > state->dmax) { - strm->msg = (char *)"invalid distance too far back"; - state->mode = BAD; - break; - } -#endif - if (state->offset > state->whave + out - left) { - strm->msg = (char *)"invalid distance too far back"; - state->mode = BAD; - break; - } - Tracevv((stderr, "inflate: distance %u\n", state->offset)); - state->mode = MATCH; - case MATCH: - if (left == 0) goto inf_leave; - copy = out - left; - if (state->offset > copy) { /* copy from window */ - copy = state->offset - copy; - if (copy > state->write) { - copy -= state->write; - from = state->window + (state->wsize - copy); - } - else - from = state->window + (state->write - copy); - if (copy > state->length) copy = state->length; - } - else { /* copy from output */ - from = put - state->offset; - copy = state->length; - } - if (copy > left) copy = left; - left -= copy; - state->length -= copy; - do { - *put++ = *from++; - } while (--copy); - if (state->length == 0) state->mode = LEN; - break; - case LIT: - if (left == 0) goto inf_leave; - *put++ = (unsigned char)(state->length); - left--; - state->mode = LEN; - break; - case CHECK: - if (state->wrap) { - NEEDBITS(32); - out -= left; - strm->total_out += out; - state->total += out; - if (out) - strm->adler = state->check = - UPDATE(state->check, put - out, out); - out = left; - if (( -#ifdef GUNZIP - state->flags ? hold : -#endif - REVERSE(hold)) != state->check) { - strm->msg = (char *)"incorrect data check"; - state->mode = BAD; - break; - } - INITBITS(); - Tracev((stderr, "inflate: check matches trailer\n")); - } -#ifdef GUNZIP - state->mode = LENGTH; - case LENGTH: - if (state->wrap && state->flags) { - NEEDBITS(32); - if (hold != (state->total & 0xffffffffUL)) { - strm->msg = (char *)"incorrect length check"; - state->mode = BAD; - break; - } - INITBITS(); - Tracev((stderr, "inflate: length matches trailer\n")); - } -#endif - state->mode = DONE; - case DONE: - ret = Z_STREAM_END; - goto inf_leave; - case BAD: - ret = Z_DATA_ERROR; - goto inf_leave; - case MEM: - return Z_MEM_ERROR; - case SYNC: - default: - return Z_STREAM_ERROR; - } - - /* - Return from inflate(), updating the total counts and the check value. - If there was no progress during the inflate() call, return a buffer - error. Call updatewindow() to create and/or update the window state. - Note: a memory error from inflate() is non-recoverable. - */ - inf_leave: - RESTORE(); - if (state->wsize || (state->mode < CHECK && out != strm->avail_out)) - if (updatewindow(strm, out)) { - state->mode = MEM; - return Z_MEM_ERROR; - } - in -= strm->avail_in; - out -= strm->avail_out; - strm->total_in += in; - strm->total_out += out; - state->total += out; - if (state->wrap && out) - strm->adler = state->check = - UPDATE(state->check, strm->next_out - out, out); - strm->data_type = state->bits + (state->last ? 64 : 0) + - (state->mode == TYPE ? 128 : 0); - if (((in == 0 && out == 0) || flush == Z_FINISH) && ret == Z_OK) - ret = Z_BUF_ERROR; - return ret; -} - -int ZEXPORT inflateEnd(strm) -z_streamp strm; -{ - struct inflate_state FAR *state; - if (strm == Z_NULL || strm->state == Z_NULL || strm->zfree == (free_func)0) - return Z_STREAM_ERROR; - state = (struct inflate_state FAR *)strm->state; - if (state->window != Z_NULL) ZFREE(strm, state->window); - ZFREE(strm, strm->state); - strm->state = Z_NULL; - Tracev((stderr, "inflate: end\n")); - return Z_OK; -} - -int ZEXPORT inflateSetDictionary(strm, dictionary, dictLength) -z_streamp strm; -const Bytef *dictionary; -uInt dictLength; -{ - struct inflate_state FAR *state; - unsigned long id; - - /* check state */ - if (strm == Z_NULL || strm->state == Z_NULL) return Z_STREAM_ERROR; - state = (struct inflate_state FAR *)strm->state; - if (state->wrap != 0 && state->mode != DICT) - return Z_STREAM_ERROR; - - /* check for correct dictionary id */ - if (state->mode == DICT) { - id = adler32(0L, Z_NULL, 0); - id = adler32(id, dictionary, dictLength); - if (id != state->check) - return Z_DATA_ERROR; - } - - /* copy dictionary to window */ - if (updatewindow(strm, strm->avail_out)) { - state->mode = MEM; - return Z_MEM_ERROR; - } - if (dictLength > state->wsize) { - zmemcpy(state->window, dictionary + dictLength - state->wsize, - state->wsize); - state->whave = state->wsize; - } - else { - zmemcpy(state->window + state->wsize - dictLength, dictionary, - dictLength); - state->whave = dictLength; - } - state->havedict = 1; - Tracev((stderr, "inflate: dictionary set\n")); - return Z_OK; -} - -int ZEXPORT inflateGetHeader(strm, head) -z_streamp strm; -gz_headerp head; -{ - struct inflate_state FAR *state; - - /* check state */ - if (strm == Z_NULL || strm->state == Z_NULL) return Z_STREAM_ERROR; - state = (struct inflate_state FAR *)strm->state; - if ((state->wrap & 2) == 0) return Z_STREAM_ERROR; - - /* save header structure */ - state->head = head; - head->done = 0; - return Z_OK; -} - -/* - Search buf[0..len-1] for the pattern: 0, 0, 0xff, 0xff. Return when found - or when out of input. When called, *have is the number of pattern bytes - found in order so far, in 0..3. On return *have is updated to the new - state. If on return *have equals four, then the pattern was found and the - return value is how many bytes were read including the last byte of the - pattern. If *have is less than four, then the pattern has not been found - yet and the return value is len. In the latter case, syncsearch() can be - called again with more data and the *have state. *have is initialized to - zero for the first call. - */ -local unsigned syncsearch(have, buf, len) -unsigned FAR *have; -unsigned char FAR *buf; -unsigned len; -{ - unsigned got; - unsigned next; - - got = *have; - next = 0; - while (next < len && got < 4) { - if ((int)(buf[next]) == (got < 2 ? 0 : 0xff)) - got++; - else if (buf[next]) - got = 0; - else - got = 4 - got; - next++; - } - *have = got; - return next; -} - -int ZEXPORT inflateSync(strm) -z_streamp strm; -{ - unsigned len; /* number of bytes to look at or looked at */ - unsigned long in, out; /* temporary to save total_in and total_out */ - unsigned char buf[4]; /* to restore bit buffer to byte string */ - struct inflate_state FAR *state; - - /* check parameters */ - if (strm == Z_NULL || strm->state == Z_NULL) return Z_STREAM_ERROR; - state = (struct inflate_state FAR *)strm->state; - if (strm->avail_in == 0 && state->bits < 8) return Z_BUF_ERROR; - - /* if first time, start search in bit buffer */ - if (state->mode != SYNC) { - state->mode = SYNC; - state->hold <<= state->bits & 7; - state->bits -= state->bits & 7; - len = 0; - while (state->bits >= 8) { - buf[len++] = (unsigned char)(state->hold); - state->hold >>= 8; - state->bits -= 8; - } - state->have = 0; - syncsearch(&(state->have), buf, len); - } - - /* search available input */ - len = syncsearch(&(state->have), strm->next_in, strm->avail_in); - strm->avail_in -= len; - strm->next_in += len; - strm->total_in += len; - - /* return no joy or set up to restart inflate() on a new block */ - if (state->have != 4) return Z_DATA_ERROR; - in = strm->total_in; out = strm->total_out; - inflateReset(strm); - strm->total_in = in; strm->total_out = out; - state->mode = TYPE; - return Z_OK; -} - -/* - Returns true if inflate is currently at the end of a block generated by - Z_SYNC_FLUSH or Z_FULL_FLUSH. This function is used by one PPP - implementation to provide an additional safety check. PPP uses - Z_SYNC_FLUSH but removes the length bytes of the resulting empty stored - block. When decompressing, PPP checks that at the end of input packet, - inflate is waiting for these length bytes. - */ -int ZEXPORT inflateSyncPoint(strm) -z_streamp strm; -{ - struct inflate_state FAR *state; - - if (strm == Z_NULL || strm->state == Z_NULL) return Z_STREAM_ERROR; - state = (struct inflate_state FAR *)strm->state; - return state->mode == STORED && state->bits == 0; -} - -int ZEXPORT inflateCopy(dest, source) -z_streamp dest; -z_streamp source; -{ - struct inflate_state FAR *state; - struct inflate_state FAR *copy; - unsigned char FAR *window; - unsigned wsize; - - /* check input */ - if (dest == Z_NULL || source == Z_NULL || source->state == Z_NULL || - source->zalloc == (alloc_func)0 || source->zfree == (free_func)0) - return Z_STREAM_ERROR; - state = (struct inflate_state FAR *)source->state; - - /* allocate space */ - copy = (struct inflate_state FAR *) - ZALLOC(source, 1, sizeof(struct inflate_state)); - if (copy == Z_NULL) return Z_MEM_ERROR; - window = Z_NULL; - if (state->window != Z_NULL) { - window = (unsigned char FAR *) - ZALLOC(source, 1U << state->wbits, sizeof(unsigned char)); - if (window == Z_NULL) { - ZFREE(source, copy); - return Z_MEM_ERROR; - } - } - - /* copy state */ - zmemcpy(dest, source, sizeof(z_stream)); - zmemcpy(copy, state, sizeof(struct inflate_state)); - if (state->lencode >= state->codes && - state->lencode <= state->codes + ENOUGH - 1) { - copy->lencode = copy->codes + (state->lencode - state->codes); - copy->distcode = copy->codes + (state->distcode - state->codes); - } - copy->next = copy->codes + (state->next - state->codes); - if (window != Z_NULL) { - wsize = 1U << state->wbits; - zmemcpy(window, state->window, wsize); - } - copy->window = window; - dest->state = (struct internal_state FAR *)copy; - return Z_OK; -} diff --git a/dependencies/zlib/inflate.h b/dependencies/zlib/inflate.h deleted file mode 100644 index fbbc8714..00000000 --- a/dependencies/zlib/inflate.h +++ /dev/null @@ -1,115 +0,0 @@ -/* inflate.h -- internal inflate state definition - * Copyright (C) 1995-2004 Mark Adler - * For conditions of distribution and use, see copyright notice in zlib.h - */ - -/* WARNING: this file should *not* be used by applications. It is - part of the implementation of the compression library and is - subject to change. Applications should only use zlib.h. - */ - -/* define NO_GZIP when compiling if you want to disable gzip header and - trailer decoding by inflate(). NO_GZIP would be used to avoid linking in - the crc code when it is not needed. For shared libraries, gzip decoding - should be left enabled. */ -#ifndef NO_GZIP -# define GUNZIP -#endif - -/* Possible inflate modes between inflate() calls */ -typedef enum { - HEAD, /* i: waiting for magic header */ - FLAGS, /* i: waiting for method and flags (gzip) */ - TIME, /* i: waiting for modification time (gzip) */ - OS, /* i: waiting for extra flags and operating system (gzip) */ - EXLEN, /* i: waiting for extra length (gzip) */ - EXTRA, /* i: waiting for extra bytes (gzip) */ - NAME, /* i: waiting for end of file name (gzip) */ - COMMENT, /* i: waiting for end of comment (gzip) */ - HCRC, /* i: waiting for header crc (gzip) */ - DICTID, /* i: waiting for dictionary check value */ - DICT, /* waiting for inflateSetDictionary() call */ - TYPE, /* i: waiting for type bits, including last-flag bit */ - TYPEDO, /* i: same, but skip check to exit inflate on new block */ - STORED, /* i: waiting for stored size (length and complement) */ - COPY, /* i/o: waiting for input or output to copy stored block */ - TABLE, /* i: waiting for dynamic block table lengths */ - LENLENS, /* i: waiting for code length code lengths */ - CODELENS, /* i: waiting for length/lit and distance code lengths */ - LEN, /* i: waiting for length/lit code */ - LENEXT, /* i: waiting for length extra bits */ - DIST, /* i: waiting for distance code */ - DISTEXT, /* i: waiting for distance extra bits */ - MATCH, /* o: waiting for output space to copy string */ - LIT, /* o: waiting for output space to write literal */ - CHECK, /* i: waiting for 32-bit check value */ - LENGTH, /* i: waiting for 32-bit length (gzip) */ - DONE, /* finished check, done -- remain here until reset */ - BAD, /* got a data error -- remain here until reset */ - MEM, /* got an inflate() memory error -- remain here until reset */ - SYNC /* looking for synchronization bytes to restart inflate() */ -} inflate_mode; - -/* - State transitions between above modes - - - (most modes can go to the BAD or MEM mode -- not shown for clarity) - - Process header: - HEAD -> (gzip) or (zlib) - (gzip) -> FLAGS -> TIME -> OS -> EXLEN -> EXTRA -> NAME - NAME -> COMMENT -> HCRC -> TYPE - (zlib) -> DICTID or TYPE - DICTID -> DICT -> TYPE - Read deflate blocks: - TYPE -> STORED or TABLE or LEN or CHECK - STORED -> COPY -> TYPE - TABLE -> LENLENS -> CODELENS -> LEN - Read deflate codes: - LEN -> LENEXT or LIT or TYPE - LENEXT -> DIST -> DISTEXT -> MATCH -> LEN - LIT -> LEN - Process trailer: - CHECK -> LENGTH -> DONE - */ - -/* state maintained between inflate() calls. Approximately 7K bytes. */ -struct inflate_state { - inflate_mode mode; /* current inflate mode */ - int last; /* true if processing last block */ - int wrap; /* bit 0 true for zlib, bit 1 true for gzip */ - int havedict; /* true if dictionary provided */ - int flags; /* gzip header method and flags (0 if zlib) */ - unsigned dmax; /* zlib header max distance (INFLATE_STRICT) */ - unsigned long check; /* protected copy of check value */ - unsigned long total; /* protected copy of output count */ - gz_headerp head; /* where to save gzip header information */ - /* sliding window */ - unsigned wbits; /* log base 2 of requested window size */ - unsigned wsize; /* window size or zero if not using window */ - unsigned whave; /* valid bytes in the window */ - unsigned write; /* window write index */ - unsigned char FAR *window; /* allocated sliding window, if needed */ - /* bit accumulator */ - unsigned long hold; /* input bit accumulator */ - unsigned bits; /* number of bits in "in" */ - /* for string and stored block copying */ - unsigned length; /* literal or length of data to copy */ - unsigned offset; /* distance back to copy string from */ - /* for table and code decoding */ - unsigned extra; /* extra bits needed */ - /* fixed and dynamic code tables */ - code const FAR *lencode; /* starting table for length/literal codes */ - code const FAR *distcode; /* starting table for distance codes */ - unsigned lenbits; /* index bits for lencode */ - unsigned distbits; /* index bits for distcode */ - /* dynamic table building */ - unsigned ncode; /* number of code length code lengths */ - unsigned nlen; /* number of length code lengths */ - unsigned ndist; /* number of distance code lengths */ - unsigned have; /* number of code lengths in lens[] */ - code FAR *next; /* next available space in codes[] */ - unsigned short lens[320]; /* temporary storage for code lengths */ - unsigned short work[288]; /* work area for code table building */ - code codes[ENOUGH]; /* space for code tables */ -}; diff --git a/dependencies/zlib/inftrees.c b/dependencies/zlib/inftrees.c deleted file mode 100644 index 38ded81c..00000000 --- a/dependencies/zlib/inftrees.c +++ /dev/null @@ -1,329 +0,0 @@ -/* inftrees.c -- generate Huffman trees for efficient decoding - * Copyright (C) 1995-2005 Mark Adler - * For conditions of distribution and use, see copyright notice in zlib.h - */ - -#include "zutil.h" -#include "inftrees.h" - -#define MAXBITS 15 - -const char inflate_copyright[] = - " inflate 1.2.3 Copyright 1995-2005 Mark Adler "; -/* - If you use the zlib library in a product, an acknowledgment is welcome - in the documentation of your product. If for some reason you cannot - include such an acknowledgment, I would appreciate that you keep this - copyright string in the executable of your product. - */ - -/* - Build a set of tables to decode the provided canonical Huffman code. - The code lengths are lens[0..codes-1]. The result starts at *table, - whose indices are 0..2^bits-1. work is a writable array of at least - lens shorts, which is used as a work area. type is the type of code - to be generated, CODES, LENS, or DISTS. On return, zero is success, - -1 is an invalid code, and +1 means that ENOUGH isn't enough. table - on return points to the next available entry's address. bits is the - requested root table index bits, and on return it is the actual root - table index bits. It will differ if the request is greater than the - longest code or if it is less than the shortest code. - */ -int inflate_table(type, lens, codes, table, bits, work) -codetype type; -unsigned short FAR *lens; -unsigned codes; -code FAR * FAR *table; -unsigned FAR *bits; -unsigned short FAR *work; -{ - unsigned len; /* a code's length in bits */ - unsigned sym; /* index of code symbols */ - unsigned min, max; /* minimum and maximum code lengths */ - unsigned root; /* number of index bits for root table */ - unsigned curr; /* number of index bits for current table */ - unsigned drop; /* code bits to drop for sub-table */ - int left; /* number of prefix codes available */ - unsigned used; /* code entries in table used */ - unsigned huff; /* Huffman code */ - unsigned incr; /* for incrementing code, index */ - unsigned fill; /* index for replicating entries */ - unsigned low; /* low bits for current root entry */ - unsigned mask; /* mask for low root bits */ - code this; /* table entry for duplication */ - code FAR *next; /* next available space in table */ - const unsigned short FAR *base; /* base value table to use */ - const unsigned short FAR *extra; /* extra bits table to use */ - int end; /* use base and extra for symbol > end */ - unsigned short count[MAXBITS+1]; /* number of codes of each length */ - unsigned short offs[MAXBITS+1]; /* offsets in table for each length */ - static const unsigned short lbase[31] = { /* Length codes 257..285 base */ - 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 15, 17, 19, 23, 27, 31, - 35, 43, 51, 59, 67, 83, 99, 115, 131, 163, 195, 227, 258, 0, 0}; - static const unsigned short lext[31] = { /* Length codes 257..285 extra */ - 16, 16, 16, 16, 16, 16, 16, 16, 17, 17, 17, 17, 18, 18, 18, 18, - 19, 19, 19, 19, 20, 20, 20, 20, 21, 21, 21, 21, 16, 201, 196}; - static const unsigned short dbase[32] = { /* Distance codes 0..29 base */ - 1, 2, 3, 4, 5, 7, 9, 13, 17, 25, 33, 49, 65, 97, 129, 193, - 257, 385, 513, 769, 1025, 1537, 2049, 3073, 4097, 6145, - 8193, 12289, 16385, 24577, 0, 0}; - static const unsigned short dext[32] = { /* Distance codes 0..29 extra */ - 16, 16, 16, 16, 17, 17, 18, 18, 19, 19, 20, 20, 21, 21, 22, 22, - 23, 23, 24, 24, 25, 25, 26, 26, 27, 27, - 28, 28, 29, 29, 64, 64}; - - /* - Process a set of code lengths to create a canonical Huffman code. The - code lengths are lens[0..codes-1]. Each length corresponds to the - symbols 0..codes-1. The Huffman code is generated by first sorting the - symbols by length from short to long, and retaining the symbol order - for codes with equal lengths. Then the code starts with all zero bits - for the first code of the shortest length, and the codes are integer - increments for the same length, and zeros are appended as the length - increases. For the deflate format, these bits are stored backwards - from their more natural integer increment ordering, and so when the - decoding tables are built in the large loop below, the integer codes - are incremented backwards. - - This routine assumes, but does not check, that all of the entries in - lens[] are in the range 0..MAXBITS. The caller must assure this. - 1..MAXBITS is interpreted as that code length. zero means that that - symbol does not occur in this code. - - The codes are sorted by computing a count of codes for each length, - creating from that a table of starting indices for each length in the - sorted table, and then entering the symbols in order in the sorted - table. The sorted table is work[], with that space being provided by - the caller. - - The length counts are used for other purposes as well, i.e. finding - the minimum and maximum length codes, determining if there are any - codes at all, checking for a valid set of lengths, and looking ahead - at length counts to determine sub-table sizes when building the - decoding tables. - */ - - /* accumulate lengths for codes (assumes lens[] all in 0..MAXBITS) */ - for (len = 0; len <= MAXBITS; len++) - count[len] = 0; - for (sym = 0; sym < codes; sym++) - count[lens[sym]]++; - - /* bound code lengths, force root to be within code lengths */ - root = *bits; - for (max = MAXBITS; max >= 1; max--) - if (count[max] != 0) break; - if (root > max) root = max; - if (max == 0) { /* no symbols to code at all */ - this.op = (unsigned char)64; /* invalid code marker */ - this.bits = (unsigned char)1; - this.val = (unsigned short)0; - *(*table)++ = this; /* make a table to force an error */ - *(*table)++ = this; - *bits = 1; - return 0; /* no symbols, but wait for decoding to report error */ - } - for (min = 1; min <= MAXBITS; min++) - if (count[min] != 0) break; - if (root < min) root = min; - - /* check for an over-subscribed or incomplete set of lengths */ - left = 1; - for (len = 1; len <= MAXBITS; len++) { - left <<= 1; - left -= count[len]; - if (left < 0) return -1; /* over-subscribed */ - } - if (left > 0 && (type == CODES || max != 1)) - return -1; /* incomplete set */ - - /* generate offsets into symbol table for each length for sorting */ - offs[1] = 0; - for (len = 1; len < MAXBITS; len++) - offs[len + 1] = offs[len] + count[len]; - - /* sort symbols by length, by symbol order within each length */ - for (sym = 0; sym < codes; sym++) - if (lens[sym] != 0) work[offs[lens[sym]]++] = (unsigned short)sym; - - /* - Create and fill in decoding tables. In this loop, the table being - filled is at next and has curr index bits. The code being used is huff - with length len. That code is converted to an index by dropping drop - bits off of the bottom. For codes where len is less than drop + curr, - those top drop + curr - len bits are incremented through all values to - fill the table with replicated entries. - - root is the number of index bits for the root table. When len exceeds - root, sub-tables are created pointed to by the root entry with an index - of the low root bits of huff. This is saved in low to check for when a - new sub-table should be started. drop is zero when the root table is - being filled, and drop is root when sub-tables are being filled. - - When a new sub-table is needed, it is necessary to look ahead in the - code lengths to determine what size sub-table is needed. The length - counts are used for this, and so count[] is decremented as codes are - entered in the tables. - - used keeps track of how many table entries have been allocated from the - provided *table space. It is checked when a LENS table is being made - against the space in *table, ENOUGH, minus the maximum space needed by - the worst case distance code, MAXD. This should never happen, but the - sufficiency of ENOUGH has not been proven exhaustively, hence the check. - This assumes that when type == LENS, bits == 9. - - sym increments through all symbols, and the loop terminates when - all codes of length max, i.e. all codes, have been processed. This - routine permits incomplete codes, so another loop after this one fills - in the rest of the decoding tables with invalid code markers. - */ - - /* set up for code type */ - switch (type) { - case CODES: - base = extra = work; /* dummy value--not used */ - end = 19; - break; - case LENS: - base = lbase; - base -= 257; - extra = lext; - extra -= 257; - end = 256; - break; - default: /* DISTS */ - base = dbase; - extra = dext; - end = -1; - } - - /* initialize state for loop */ - huff = 0; /* starting code */ - sym = 0; /* starting code symbol */ - len = min; /* starting code length */ - next = *table; /* current table to fill in */ - curr = root; /* current table index bits */ - drop = 0; /* current bits to drop from code for index */ - low = (unsigned)(-1); /* trigger new sub-table when len > root */ - used = 1U << root; /* use root table entries */ - mask = used - 1; /* mask for comparing low */ - - /* check available table space */ - if (type == LENS && used >= ENOUGH - MAXD) - return 1; - - /* process all codes and make table entries */ - for (;;) { - /* create table entry */ - this.bits = (unsigned char)(len - drop); - if ((int)(work[sym]) < end) { - this.op = (unsigned char)0; - this.val = work[sym]; - } - else if ((int)(work[sym]) > end) { - this.op = (unsigned char)(extra[work[sym]]); - this.val = base[work[sym]]; - } - else { - this.op = (unsigned char)(32 + 64); /* end of block */ - this.val = 0; - } - - /* replicate for those indices with low len bits equal to huff */ - incr = 1U << (len - drop); - fill = 1U << curr; - min = fill; /* save offset to next table */ - do { - fill -= incr; - next[(huff >> drop) + fill] = this; - } while (fill != 0); - - /* backwards increment the len-bit code huff */ - incr = 1U << (len - 1); - while (huff & incr) - incr >>= 1; - if (incr != 0) { - huff &= incr - 1; - huff += incr; - } - else - huff = 0; - - /* go to next symbol, update count, len */ - sym++; - if (--(count[len]) == 0) { - if (len == max) break; - len = lens[work[sym]]; - } - - /* create new sub-table if needed */ - if (len > root && (huff & mask) != low) { - /* if first time, transition to sub-tables */ - if (drop == 0) - drop = root; - - /* increment past last table */ - next += min; /* here min is 1 << curr */ - - /* determine length of next table */ - curr = len - drop; - left = (int)(1 << curr); - while (curr + drop < max) { - left -= count[curr + drop]; - if (left <= 0) break; - curr++; - left <<= 1; - } - - /* check for enough space */ - used += 1U << curr; - if (type == LENS && used >= ENOUGH - MAXD) - return 1; - - /* point entry in root table to sub-table */ - low = huff & mask; - (*table)[low].op = (unsigned char)curr; - (*table)[low].bits = (unsigned char)root; - (*table)[low].val = (unsigned short)(next - *table); - } - } - - /* - Fill in rest of table for incomplete codes. This loop is similar to the - loop above in incrementing huff for table indices. It is assumed that - len is equal to curr + drop, so there is no loop needed to increment - through high index bits. When the current sub-table is filled, the loop - drops back to the root table to fill in any remaining entries there. - */ - this.op = (unsigned char)64; /* invalid code marker */ - this.bits = (unsigned char)(len - drop); - this.val = (unsigned short)0; - while (huff != 0) { - /* when done with sub-table, drop back to root table */ - if (drop != 0 && (huff & mask) != low) { - drop = 0; - len = root; - next = *table; - this.bits = (unsigned char)len; - } - - /* put invalid code marker in table */ - next[huff >> drop] = this; - - /* backwards increment the len-bit code huff */ - incr = 1U << (len - 1); - while (huff & incr) - incr >>= 1; - if (incr != 0) { - huff &= incr - 1; - huff += incr; - } - else - huff = 0; - } - - /* set return parameters */ - *table += used; - *bits = root; - return 0; -} diff --git a/dependencies/zlib/inftrees.h b/dependencies/zlib/inftrees.h deleted file mode 100644 index dc0fd567..00000000 --- a/dependencies/zlib/inftrees.h +++ /dev/null @@ -1,55 +0,0 @@ -/* inftrees.h -- header to use inftrees.c - * Copyright (C) 1995-2005 Mark Adler - * For conditions of distribution and use, see copyright notice in zlib.h - */ - -/* WARNING: this file should *not* be used by applications. It is - part of the implementation of the compression library and is - subject to change. Applications should only use zlib.h. - */ - -/* Structure for decoding tables. Each entry provides either the - information needed to do the operation requested by the code that - indexed that table entry, or it provides a pointer to another - table that indexes more bits of the code. op indicates whether - the entry is a pointer to another table, a literal, a length or - distance, an end-of-block, or an invalid code. For a table - pointer, the low four bits of op is the number of index bits of - that table. For a length or distance, the low four bits of op - is the number of extra bits to get after the code. bits is - the number of bits in this code or part of the code to drop off - of the bit buffer. val is the actual byte to output in the case - of a literal, the base length or distance, or the offset from - the current table to the next table. Each entry is four bytes. */ -typedef struct { - unsigned char op; /* operation, extra bits, table bits */ - unsigned char bits; /* bits in this part of the code */ - unsigned short val; /* offset in table or code value */ -} code; - -/* op values as set by inflate_table(): - 00000000 - literal - 0000tttt - table link, tttt != 0 is the number of table index bits - 0001eeee - length or distance, eeee is the number of extra bits - 01100000 - end of block - 01000000 - invalid code - */ - -/* Maximum size of dynamic tree. The maximum found in a long but non- - exhaustive search was 1444 code structures (852 for length/literals - and 592 for distances, the latter actually the result of an - exhaustive search). The true maximum is not known, but the value - below is more than safe. */ -#define ENOUGH 2048 -#define MAXD 592 - -/* Type of code to build for inftable() */ -typedef enum { - CODES, - LENS, - DISTS -} codetype; - -extern int inflate_table OF((codetype type, unsigned short FAR *lens, - unsigned codes, code FAR * FAR *table, - unsigned FAR *bits, unsigned short FAR *work)); diff --git a/dependencies/zlib/trees.c b/dependencies/zlib/trees.c deleted file mode 100644 index 7a048028..00000000 --- a/dependencies/zlib/trees.c +++ /dev/null @@ -1,1219 +0,0 @@ -/* trees.c -- output deflated data using Huffman coding - * Copyright (C) 1995-2005 Jean-loup Gailly - * For conditions of distribution and use, see copyright notice in zlib.h - */ - -/* - * ALGORITHM - * - * The "deflation" process uses several Huffman trees. The more - * common source values are represented by shorter bit sequences. - * - * Each code tree is stored in a compressed form which is itself - * a Huffman encoding of the lengths of all the code strings (in - * ascending order by source values). The actual code strings are - * reconstructed from the lengths in the inflate process, as described - * in the deflate specification. - * - * REFERENCES - * - * Deutsch, L.P.,"'Deflate' Compressed Data Format Specification". - * Available in ftp.uu.net:/pub/archiving/zip/doc/deflate-1.1.doc - * - * Storer, James A. - * Data Compression: Methods and Theory, pp. 49-50. - * Computer Science Press, 1988. ISBN 0-7167-8156-5. - * - * Sedgewick, R. - * Algorithms, p290. - * Addison-Wesley, 1983. ISBN 0-201-06672-6. - */ - -/* @(#) $Id$ */ - -/* #define GEN_TREES_H */ - -#include "deflate.h" - -#ifdef DEBUG -# include -#endif - -/* =========================================================================== - * Constants - */ - -#define MAX_BL_BITS 7 -/* Bit length codes must not exceed MAX_BL_BITS bits */ - -#define END_BLOCK 256 -/* end of block literal code */ - -#define REP_3_6 16 -/* repeat previous bit length 3-6 times (2 bits of repeat count) */ - -#define REPZ_3_10 17 -/* repeat a zero length 3-10 times (3 bits of repeat count) */ - -#define REPZ_11_138 18 -/* repeat a zero length 11-138 times (7 bits of repeat count) */ - -local const int extra_lbits[LENGTH_CODES] /* extra bits for each length code */ - = {0,0,0,0,0,0,0,0,1,1,1,1,2,2,2,2,3,3,3,3,4,4,4,4,5,5,5,5,0}; - -local const int extra_dbits[D_CODES] /* extra bits for each distance code */ - = {0,0,0,0,1,1,2,2,3,3,4,4,5,5,6,6,7,7,8,8,9,9,10,10,11,11,12,12,13,13}; - -local const int extra_blbits[BL_CODES]/* extra bits for each bit length code */ - = {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,2,3,7}; - -local const uch bl_order[BL_CODES] - = {16,17,18,0,8,7,9,6,10,5,11,4,12,3,13,2,14,1,15}; -/* The lengths of the bit length codes are sent in order of decreasing - * probability, to avoid transmitting the lengths for unused bit length codes. - */ - -#define Buf_size (8 * 2*sizeof(char)) -/* Number of bits used within bi_buf. (bi_buf might be implemented on - * more than 16 bits on some systems.) - */ - -/* =========================================================================== - * Local data. These are initialized only once. - */ - -#define DIST_CODE_LEN 512 /* see definition of array dist_code below */ - -#if defined(GEN_TREES_H) || !defined(STDC) -/* non ANSI compilers may not accept trees.h */ - -local ct_data static_ltree[L_CODES+2]; -/* The static literal tree. Since the bit lengths are imposed, there is no - * need for the L_CODES extra codes used during heap construction. However - * The codes 286 and 287 are needed to build a canonical tree (see _tr_init - * below). - */ - -local ct_data static_dtree[D_CODES]; -/* The static distance tree. (Actually a trivial tree since all codes use - * 5 bits.) - */ - -uch _dist_code[DIST_CODE_LEN]; -/* Distance codes. The first 256 values correspond to the distances - * 3 .. 258, the last 256 values correspond to the top 8 bits of - * the 15 bit distances. - */ - -uch _length_code[MAX_MATCH-MIN_MATCH+1]; -/* length code for each normalized match length (0 == MIN_MATCH) */ - -local int base_length[LENGTH_CODES]; -/* First normalized length for each code (0 = MIN_MATCH) */ - -local int base_dist[D_CODES]; -/* First normalized distance for each code (0 = distance of 1) */ - -#else -# include "trees.h" -#endif /* GEN_TREES_H */ - -struct static_tree_desc_s { - const ct_data *static_tree; /* static tree or NULL */ - const intf *extra_bits; /* extra bits for each code or NULL */ - int extra_base; /* base index for extra_bits */ - int elems; /* max number of elements in the tree */ - int max_length; /* max bit length for the codes */ -}; - -local static_tree_desc static_l_desc = -{static_ltree, extra_lbits, LITERALS+1, L_CODES, MAX_BITS}; - -local static_tree_desc static_d_desc = -{static_dtree, extra_dbits, 0, D_CODES, MAX_BITS}; - -local static_tree_desc static_bl_desc = -{(const ct_data *)0, extra_blbits, 0, BL_CODES, MAX_BL_BITS}; - -/* =========================================================================== - * Local (static) routines in this file. - */ - -local void tr_static_init OF((void)); -local void init_block OF((deflate_state *s)); -local void pqdownheap OF((deflate_state *s, ct_data *tree, int k)); -local void gen_bitlen OF((deflate_state *s, tree_desc *desc)); -local void gen_codes OF((ct_data *tree, int max_code, ushf *bl_count)); -local void build_tree OF((deflate_state *s, tree_desc *desc)); -local void scan_tree OF((deflate_state *s, ct_data *tree, int max_code)); -local void send_tree OF((deflate_state *s, ct_data *tree, int max_code)); -local int build_bl_tree OF((deflate_state *s)); -local void send_all_trees OF((deflate_state *s, int lcodes, int dcodes, - int blcodes)); -local void compress_block OF((deflate_state *s, ct_data *ltree, - ct_data *dtree)); -local void set_data_type OF((deflate_state *s)); -local unsigned bi_reverse OF((unsigned value, int length)); -local void bi_windup OF((deflate_state *s)); -local void bi_flush OF((deflate_state *s)); -local void copy_block OF((deflate_state *s, charf *buf, unsigned len, - int header)); - -#ifdef GEN_TREES_H -local void gen_trees_header OF((void)); -#endif - -#ifndef DEBUG -# define send_code(s, c, tree) send_bits(s, tree[c].Code, tree[c].Len) - /* Send a code of the given tree. c and tree must not have side effects */ - -#else /* DEBUG */ -# define send_code(s, c, tree) \ - { if (z_verbose>2) fprintf(stderr,"\ncd %3d ",(c)); \ - send_bits(s, tree[c].Code, tree[c].Len); } -#endif - -/* =========================================================================== - * Output a short LSB first on the stream. - * IN assertion: there is enough room in pendingBuf. - */ -#define put_short(s, w) { \ - put_byte(s, (uch)((w) & 0xff)); \ - put_byte(s, (uch)((ush)(w) >> 8)); \ -} - -/* =========================================================================== - * Send a value on a given number of bits. - * IN assertion: length <= 16 and value fits in length bits. - */ -#ifdef DEBUG -local void send_bits OF((deflate_state *s, int value, int length)); - -local void send_bits(s, value, length) - deflate_state *s; - int value; /* value to send */ - int length; /* number of bits */ -{ - Tracevv((stderr," l %2d v %4x ", length, value)); - Assert(length > 0 && length <= 15, "invalid length"); - s->bits_sent += (ulg)length; - - /* If not enough room in bi_buf, use (valid) bits from bi_buf and - * (16 - bi_valid) bits from value, leaving (width - (16-bi_valid)) - * unused bits in value. - */ - if (s->bi_valid > (int)Buf_size - length) { - s->bi_buf |= (value << s->bi_valid); - put_short(s, s->bi_buf); - s->bi_buf = (ush)value >> (Buf_size - s->bi_valid); - s->bi_valid += length - Buf_size; - } else { - s->bi_buf |= value << s->bi_valid; - s->bi_valid += length; - } -} -#else /* !DEBUG */ - -#define send_bits(s, value, length) \ -{ int len = length;\ - if (s->bi_valid > (int)Buf_size - len) {\ - int val = value;\ - s->bi_buf |= (val << s->bi_valid);\ - put_short(s, s->bi_buf);\ - s->bi_buf = (ush)val >> (Buf_size - s->bi_valid);\ - s->bi_valid += len - Buf_size;\ - } else {\ - s->bi_buf |= (value) << s->bi_valid;\ - s->bi_valid += len;\ - }\ -} -#endif /* DEBUG */ - - -/* the arguments must not have side effects */ - -/* =========================================================================== - * Initialize the various 'constant' tables. - */ -local void tr_static_init() -{ -#if defined(GEN_TREES_H) || !defined(STDC) - static int static_init_done = 0; - int n; /* iterates over tree elements */ - int bits; /* bit counter */ - int length; /* length value */ - int code; /* code value */ - int dist; /* distance index */ - ush bl_count[MAX_BITS+1]; - /* number of codes at each bit length for an optimal tree */ - - if (static_init_done) return; - - /* For some embedded targets, global variables are not initialized: */ - static_l_desc.static_tree = static_ltree; - static_l_desc.extra_bits = extra_lbits; - static_d_desc.static_tree = static_dtree; - static_d_desc.extra_bits = extra_dbits; - static_bl_desc.extra_bits = extra_blbits; - - /* Initialize the mapping length (0..255) -> length code (0..28) */ - length = 0; - for (code = 0; code < LENGTH_CODES-1; code++) { - base_length[code] = length; - for (n = 0; n < (1< dist code (0..29) */ - dist = 0; - for (code = 0 ; code < 16; code++) { - base_dist[code] = dist; - for (n = 0; n < (1<>= 7; /* from now on, all distances are divided by 128 */ - for ( ; code < D_CODES; code++) { - base_dist[code] = dist << 7; - for (n = 0; n < (1<<(extra_dbits[code]-7)); n++) { - _dist_code[256 + dist++] = (uch)code; - } - } - Assert (dist == 256, "tr_static_init: 256+dist != 512"); - - /* Construct the codes of the static literal tree */ - for (bits = 0; bits <= MAX_BITS; bits++) bl_count[bits] = 0; - n = 0; - while (n <= 143) static_ltree[n++].Len = 8, bl_count[8]++; - while (n <= 255) static_ltree[n++].Len = 9, bl_count[9]++; - while (n <= 279) static_ltree[n++].Len = 7, bl_count[7]++; - while (n <= 287) static_ltree[n++].Len = 8, bl_count[8]++; - /* Codes 286 and 287 do not exist, but we must include them in the - * tree construction to get a canonical Huffman tree (longest code - * all ones) - */ - gen_codes((ct_data *)static_ltree, L_CODES+1, bl_count); - - /* The static distance tree is trivial: */ - for (n = 0; n < D_CODES; n++) { - static_dtree[n].Len = 5; - static_dtree[n].Code = bi_reverse((unsigned)n, 5); - } - static_init_done = 1; - -# ifdef GEN_TREES_H - gen_trees_header(); -# endif -#endif /* defined(GEN_TREES_H) || !defined(STDC) */ -} - -/* =========================================================================== - * Genererate the file trees.h describing the static trees. - */ -#ifdef GEN_TREES_H -# ifndef DEBUG -# include -# endif - -# define SEPARATOR(i, last, width) \ - ((i) == (last)? "\n};\n\n" : \ - ((i) % (width) == (width)-1 ? ",\n" : ", ")) - -void gen_trees_header() -{ - FILE *header = fopen("trees.h", "w"); - int i; - - Assert (header != NULL, "Can't open trees.h"); - fprintf(header, - "/* header created automatically with -DGEN_TREES_H */\n\n"); - - fprintf(header, "local const ct_data static_ltree[L_CODES+2] = {\n"); - for (i = 0; i < L_CODES+2; i++) { - fprintf(header, "{{%3u},{%3u}}%s", static_ltree[i].Code, - static_ltree[i].Len, SEPARATOR(i, L_CODES+1, 5)); - } - - fprintf(header, "local const ct_data static_dtree[D_CODES] = {\n"); - for (i = 0; i < D_CODES; i++) { - fprintf(header, "{{%2u},{%2u}}%s", static_dtree[i].Code, - static_dtree[i].Len, SEPARATOR(i, D_CODES-1, 5)); - } - - fprintf(header, "const uch _dist_code[DIST_CODE_LEN] = {\n"); - for (i = 0; i < DIST_CODE_LEN; i++) { - fprintf(header, "%2u%s", _dist_code[i], - SEPARATOR(i, DIST_CODE_LEN-1, 20)); - } - - fprintf(header, "const uch _length_code[MAX_MATCH-MIN_MATCH+1]= {\n"); - for (i = 0; i < MAX_MATCH-MIN_MATCH+1; i++) { - fprintf(header, "%2u%s", _length_code[i], - SEPARATOR(i, MAX_MATCH-MIN_MATCH, 20)); - } - - fprintf(header, "local const int base_length[LENGTH_CODES] = {\n"); - for (i = 0; i < LENGTH_CODES; i++) { - fprintf(header, "%1u%s", base_length[i], - SEPARATOR(i, LENGTH_CODES-1, 20)); - } - - fprintf(header, "local const int base_dist[D_CODES] = {\n"); - for (i = 0; i < D_CODES; i++) { - fprintf(header, "%5u%s", base_dist[i], - SEPARATOR(i, D_CODES-1, 10)); - } - - fclose(header); -} -#endif /* GEN_TREES_H */ - -/* =========================================================================== - * Initialize the tree data structures for a new zlib stream. - */ -void _tr_init(s) - deflate_state *s; -{ - tr_static_init(); - - s->l_desc.dyn_tree = s->dyn_ltree; - s->l_desc.stat_desc = &static_l_desc; - - s->d_desc.dyn_tree = s->dyn_dtree; - s->d_desc.stat_desc = &static_d_desc; - - s->bl_desc.dyn_tree = s->bl_tree; - s->bl_desc.stat_desc = &static_bl_desc; - - s->bi_buf = 0; - s->bi_valid = 0; - s->last_eob_len = 8; /* enough lookahead for inflate */ -#ifdef DEBUG - s->compressed_len = 0L; - s->bits_sent = 0L; -#endif - - /* Initialize the first block of the first file: */ - init_block(s); -} - -/* =========================================================================== - * Initialize a new block. - */ -local void init_block(s) - deflate_state *s; -{ - int n; /* iterates over tree elements */ - - /* Initialize the trees. */ - for (n = 0; n < L_CODES; n++) s->dyn_ltree[n].Freq = 0; - for (n = 0; n < D_CODES; n++) s->dyn_dtree[n].Freq = 0; - for (n = 0; n < BL_CODES; n++) s->bl_tree[n].Freq = 0; - - s->dyn_ltree[END_BLOCK].Freq = 1; - s->opt_len = s->static_len = 0L; - s->last_lit = s->matches = 0; -} - -#define SMALLEST 1 -/* Index within the heap array of least frequent node in the Huffman tree */ - - -/* =========================================================================== - * Remove the smallest element from the heap and recreate the heap with - * one less element. Updates heap and heap_len. - */ -#define pqremove(s, tree, top) \ -{\ - top = s->heap[SMALLEST]; \ - s->heap[SMALLEST] = s->heap[s->heap_len--]; \ - pqdownheap(s, tree, SMALLEST); \ -} - -/* =========================================================================== - * Compares to subtrees, using the tree depth as tie breaker when - * the subtrees have equal frequency. This minimizes the worst case length. - */ -#define smaller(tree, n, m, depth) \ - (tree[n].Freq < tree[m].Freq || \ - (tree[n].Freq == tree[m].Freq && depth[n] <= depth[m])) - -/* =========================================================================== - * Restore the heap property by moving down the tree starting at node k, - * exchanging a node with the smallest of its two sons if necessary, stopping - * when the heap property is re-established (each father smaller than its - * two sons). - */ -local void pqdownheap(s, tree, k) - deflate_state *s; - ct_data *tree; /* the tree to restore */ - int k; /* node to move down */ -{ - int v = s->heap[k]; - int j = k << 1; /* left son of k */ - while (j <= s->heap_len) { - /* Set j to the smallest of the two sons: */ - if (j < s->heap_len && - smaller(tree, s->heap[j+1], s->heap[j], s->depth)) { - j++; - } - /* Exit if v is smaller than both sons */ - if (smaller(tree, v, s->heap[j], s->depth)) break; - - /* Exchange v with the smallest son */ - s->heap[k] = s->heap[j]; k = j; - - /* And continue down the tree, setting j to the left son of k */ - j <<= 1; - } - s->heap[k] = v; -} - -/* =========================================================================== - * Compute the optimal bit lengths for a tree and update the total bit length - * for the current block. - * IN assertion: the fields freq and dad are set, heap[heap_max] and - * above are the tree nodes sorted by increasing frequency. - * OUT assertions: the field len is set to the optimal bit length, the - * array bl_count contains the frequencies for each bit length. - * The length opt_len is updated; static_len is also updated if stree is - * not null. - */ -local void gen_bitlen(s, desc) - deflate_state *s; - tree_desc *desc; /* the tree descriptor */ -{ - ct_data *tree = desc->dyn_tree; - int max_code = desc->max_code; - const ct_data *stree = desc->stat_desc->static_tree; - const intf *extra = desc->stat_desc->extra_bits; - int base = desc->stat_desc->extra_base; - int max_length = desc->stat_desc->max_length; - int h; /* heap index */ - int n, m; /* iterate over the tree elements */ - int bits; /* bit length */ - int xbits; /* extra bits */ - ush f; /* frequency */ - int overflow = 0; /* number of elements with bit length too large */ - - for (bits = 0; bits <= MAX_BITS; bits++) s->bl_count[bits] = 0; - - /* In a first pass, compute the optimal bit lengths (which may - * overflow in the case of the bit length tree). - */ - tree[s->heap[s->heap_max]].Len = 0; /* root of the heap */ - - for (h = s->heap_max+1; h < HEAP_SIZE; h++) { - n = s->heap[h]; - bits = tree[tree[n].Dad].Len + 1; - if (bits > max_length) bits = max_length, overflow++; - tree[n].Len = (ush)bits; - /* We overwrite tree[n].Dad which is no longer needed */ - - if (n > max_code) continue; /* not a leaf node */ - - s->bl_count[bits]++; - xbits = 0; - if (n >= base) xbits = extra[n-base]; - f = tree[n].Freq; - s->opt_len += (ulg)f * (bits + xbits); - if (stree) s->static_len += (ulg)f * (stree[n].Len + xbits); - } - if (overflow == 0) return; - - Trace((stderr,"\nbit length overflow\n")); - /* This happens for example on obj2 and pic of the Calgary corpus */ - - /* Find the first bit length which could increase: */ - do { - bits = max_length-1; - while (s->bl_count[bits] == 0) bits--; - s->bl_count[bits]--; /* move one leaf down the tree */ - s->bl_count[bits+1] += 2; /* move one overflow item as its brother */ - s->bl_count[max_length]--; - /* The brother of the overflow item also moves one step up, - * but this does not affect bl_count[max_length] - */ - overflow -= 2; - } while (overflow > 0); - - /* Now recompute all bit lengths, scanning in increasing frequency. - * h is still equal to HEAP_SIZE. (It is simpler to reconstruct all - * lengths instead of fixing only the wrong ones. This idea is taken - * from 'ar' written by Haruhiko Okumura.) - */ - for (bits = max_length; bits != 0; bits--) { - n = s->bl_count[bits]; - while (n != 0) { - m = s->heap[--h]; - if (m > max_code) continue; - if ((unsigned) tree[m].Len != (unsigned) bits) { - Trace((stderr,"code %d bits %d->%d\n", m, tree[m].Len, bits)); - s->opt_len += ((long)bits - (long)tree[m].Len) - *(long)tree[m].Freq; - tree[m].Len = (ush)bits; - } - n--; - } - } -} - -/* =========================================================================== - * Generate the codes for a given tree and bit counts (which need not be - * optimal). - * IN assertion: the array bl_count contains the bit length statistics for - * the given tree and the field len is set for all tree elements. - * OUT assertion: the field code is set for all tree elements of non - * zero code length. - */ -local void gen_codes (tree, max_code, bl_count) - ct_data *tree; /* the tree to decorate */ - int max_code; /* largest code with non zero frequency */ - ushf *bl_count; /* number of codes at each bit length */ -{ - ush next_code[MAX_BITS+1]; /* next code value for each bit length */ - ush code = 0; /* running code value */ - int bits; /* bit index */ - int n; /* code index */ - - /* The distribution counts are first used to generate the code values - * without bit reversal. - */ - for (bits = 1; bits <= MAX_BITS; bits++) { - next_code[bits] = code = (code + bl_count[bits-1]) << 1; - } - /* Check that the bit counts in bl_count are consistent. The last code - * must be all ones. - */ - Assert (code + bl_count[MAX_BITS]-1 == (1<dyn_tree; - const ct_data *stree = desc->stat_desc->static_tree; - int elems = desc->stat_desc->elems; - int n, m; /* iterate over heap elements */ - int max_code = -1; /* largest code with non zero frequency */ - int node; /* new node being created */ - - /* Construct the initial heap, with least frequent element in - * heap[SMALLEST]. The sons of heap[n] are heap[2*n] and heap[2*n+1]. - * heap[0] is not used. - */ - s->heap_len = 0, s->heap_max = HEAP_SIZE; - - for (n = 0; n < elems; n++) { - if (tree[n].Freq != 0) { - s->heap[++(s->heap_len)] = max_code = n; - s->depth[n] = 0; - } else { - tree[n].Len = 0; - } - } - - /* The pkzip format requires that at least one distance code exists, - * and that at least one bit should be sent even if there is only one - * possible code. So to avoid special checks later on we force at least - * two codes of non zero frequency. - */ - while (s->heap_len < 2) { - node = s->heap[++(s->heap_len)] = (max_code < 2 ? ++max_code : 0); - tree[node].Freq = 1; - s->depth[node] = 0; - s->opt_len--; if (stree) s->static_len -= stree[node].Len; - /* node is 0 or 1 so it does not have extra bits */ - } - desc->max_code = max_code; - - /* The elements heap[heap_len/2+1 .. heap_len] are leaves of the tree, - * establish sub-heaps of increasing lengths: - */ - for (n = s->heap_len/2; n >= 1; n--) pqdownheap(s, tree, n); - - /* Construct the Huffman tree by repeatedly combining the least two - * frequent nodes. - */ - node = elems; /* next internal node of the tree */ - do { - pqremove(s, tree, n); /* n = node of least frequency */ - m = s->heap[SMALLEST]; /* m = node of next least frequency */ - - s->heap[--(s->heap_max)] = n; /* keep the nodes sorted by frequency */ - s->heap[--(s->heap_max)] = m; - - /* Create a new node father of n and m */ - tree[node].Freq = tree[n].Freq + tree[m].Freq; - s->depth[node] = (uch)((s->depth[n] >= s->depth[m] ? - s->depth[n] : s->depth[m]) + 1); - tree[n].Dad = tree[m].Dad = (ush)node; -#ifdef DUMP_BL_TREE - if (tree == s->bl_tree) { - fprintf(stderr,"\nnode %d(%d), sons %d(%d) %d(%d)", - node, tree[node].Freq, n, tree[n].Freq, m, tree[m].Freq); - } -#endif - /* and insert the new node in the heap */ - s->heap[SMALLEST] = node++; - pqdownheap(s, tree, SMALLEST); - - } while (s->heap_len >= 2); - - s->heap[--(s->heap_max)] = s->heap[SMALLEST]; - - /* At this point, the fields freq and dad are set. We can now - * generate the bit lengths. - */ - gen_bitlen(s, (tree_desc *)desc); - - /* The field len is now set, we can generate the bit codes */ - gen_codes ((ct_data *)tree, max_code, s->bl_count); -} - -/* =========================================================================== - * Scan a literal or distance tree to determine the frequencies of the codes - * in the bit length tree. - */ -local void scan_tree (s, tree, max_code) - deflate_state *s; - ct_data *tree; /* the tree to be scanned */ - int max_code; /* and its largest code of non zero frequency */ -{ - int n; /* iterates over all tree elements */ - int prevlen = -1; /* last emitted length */ - int curlen; /* length of current code */ - int nextlen = tree[0].Len; /* length of next code */ - int count = 0; /* repeat count of the current code */ - int max_count = 7; /* max repeat count */ - int min_count = 4; /* min repeat count */ - - if (nextlen == 0) max_count = 138, min_count = 3; - tree[max_code+1].Len = (ush)0xffff; /* guard */ - - for (n = 0; n <= max_code; n++) { - curlen = nextlen; nextlen = tree[n+1].Len; - if (++count < max_count && curlen == nextlen) { - continue; - } else if (count < min_count) { - s->bl_tree[curlen].Freq += count; - } else if (curlen != 0) { - if (curlen != prevlen) s->bl_tree[curlen].Freq++; - s->bl_tree[REP_3_6].Freq++; - } else if (count <= 10) { - s->bl_tree[REPZ_3_10].Freq++; - } else { - s->bl_tree[REPZ_11_138].Freq++; - } - count = 0; prevlen = curlen; - if (nextlen == 0) { - max_count = 138, min_count = 3; - } else if (curlen == nextlen) { - max_count = 6, min_count = 3; - } else { - max_count = 7, min_count = 4; - } - } -} - -/* =========================================================================== - * Send a literal or distance tree in compressed form, using the codes in - * bl_tree. - */ -local void send_tree (s, tree, max_code) - deflate_state *s; - ct_data *tree; /* the tree to be scanned */ - int max_code; /* and its largest code of non zero frequency */ -{ - int n; /* iterates over all tree elements */ - int prevlen = -1; /* last emitted length */ - int curlen; /* length of current code */ - int nextlen = tree[0].Len; /* length of next code */ - int count = 0; /* repeat count of the current code */ - int max_count = 7; /* max repeat count */ - int min_count = 4; /* min repeat count */ - - /* tree[max_code+1].Len = -1; */ /* guard already set */ - if (nextlen == 0) max_count = 138, min_count = 3; - - for (n = 0; n <= max_code; n++) { - curlen = nextlen; nextlen = tree[n+1].Len; - if (++count < max_count && curlen == nextlen) { - continue; - } else if (count < min_count) { - do { send_code(s, curlen, s->bl_tree); } while (--count != 0); - - } else if (curlen != 0) { - if (curlen != prevlen) { - send_code(s, curlen, s->bl_tree); count--; - } - Assert(count >= 3 && count <= 6, " 3_6?"); - send_code(s, REP_3_6, s->bl_tree); send_bits(s, count-3, 2); - - } else if (count <= 10) { - send_code(s, REPZ_3_10, s->bl_tree); send_bits(s, count-3, 3); - - } else { - send_code(s, REPZ_11_138, s->bl_tree); send_bits(s, count-11, 7); - } - count = 0; prevlen = curlen; - if (nextlen == 0) { - max_count = 138, min_count = 3; - } else if (curlen == nextlen) { - max_count = 6, min_count = 3; - } else { - max_count = 7, min_count = 4; - } - } -} - -/* =========================================================================== - * Construct the Huffman tree for the bit lengths and return the index in - * bl_order of the last bit length code to send. - */ -local int build_bl_tree(s) - deflate_state *s; -{ - int max_blindex; /* index of last bit length code of non zero freq */ - - /* Determine the bit length frequencies for literal and distance trees */ - scan_tree(s, (ct_data *)s->dyn_ltree, s->l_desc.max_code); - scan_tree(s, (ct_data *)s->dyn_dtree, s->d_desc.max_code); - - /* Build the bit length tree: */ - build_tree(s, (tree_desc *)(&(s->bl_desc))); - /* opt_len now includes the length of the tree representations, except - * the lengths of the bit lengths codes and the 5+5+4 bits for the counts. - */ - - /* Determine the number of bit length codes to send. The pkzip format - * requires that at least 4 bit length codes be sent. (appnote.txt says - * 3 but the actual value used is 4.) - */ - for (max_blindex = BL_CODES-1; max_blindex >= 3; max_blindex--) { - if (s->bl_tree[bl_order[max_blindex]].Len != 0) break; - } - /* Update opt_len to include the bit length tree and counts */ - s->opt_len += 3*(max_blindex+1) + 5+5+4; - Tracev((stderr, "\ndyn trees: dyn %ld, stat %ld", - s->opt_len, s->static_len)); - - return max_blindex; -} - -/* =========================================================================== - * Send the header for a block using dynamic Huffman trees: the counts, the - * lengths of the bit length codes, the literal tree and the distance tree. - * IN assertion: lcodes >= 257, dcodes >= 1, blcodes >= 4. - */ -local void send_all_trees(s, lcodes, dcodes, blcodes) - deflate_state *s; - int lcodes, dcodes, blcodes; /* number of codes for each tree */ -{ - int rank; /* index in bl_order */ - - Assert (lcodes >= 257 && dcodes >= 1 && blcodes >= 4, "not enough codes"); - Assert (lcodes <= L_CODES && dcodes <= D_CODES && blcodes <= BL_CODES, - "too many codes"); - Tracev((stderr, "\nbl counts: ")); - send_bits(s, lcodes-257, 5); /* not +255 as stated in appnote.txt */ - send_bits(s, dcodes-1, 5); - send_bits(s, blcodes-4, 4); /* not -3 as stated in appnote.txt */ - for (rank = 0; rank < blcodes; rank++) { - Tracev((stderr, "\nbl code %2d ", bl_order[rank])); - send_bits(s, s->bl_tree[bl_order[rank]].Len, 3); - } - Tracev((stderr, "\nbl tree: sent %ld", s->bits_sent)); - - send_tree(s, (ct_data *)s->dyn_ltree, lcodes-1); /* literal tree */ - Tracev((stderr, "\nlit tree: sent %ld", s->bits_sent)); - - send_tree(s, (ct_data *)s->dyn_dtree, dcodes-1); /* distance tree */ - Tracev((stderr, "\ndist tree: sent %ld", s->bits_sent)); -} - -/* =========================================================================== - * Send a stored block - */ -void _tr_stored_block(s, buf, stored_len, eof) - deflate_state *s; - charf *buf; /* input block */ - ulg stored_len; /* length of input block */ - int eof; /* true if this is the last block for a file */ -{ - send_bits(s, (STORED_BLOCK<<1)+eof, 3); /* send block type */ -#ifdef DEBUG - s->compressed_len = (s->compressed_len + 3 + 7) & (ulg)~7L; - s->compressed_len += (stored_len + 4) << 3; -#endif - copy_block(s, buf, (unsigned)stored_len, 1); /* with header */ -} - -/* =========================================================================== - * Send one empty static block to give enough lookahead for inflate. - * This takes 10 bits, of which 7 may remain in the bit buffer. - * The current inflate code requires 9 bits of lookahead. If the - * last two codes for the previous block (real code plus EOB) were coded - * on 5 bits or less, inflate may have only 5+3 bits of lookahead to decode - * the last real code. In this case we send two empty static blocks instead - * of one. (There are no problems if the previous block is stored or fixed.) - * To simplify the code, we assume the worst case of last real code encoded - * on one bit only. - */ -void _tr_align(s) - deflate_state *s; -{ - send_bits(s, STATIC_TREES<<1, 3); - send_code(s, END_BLOCK, static_ltree); -#ifdef DEBUG - s->compressed_len += 10L; /* 3 for block type, 7 for EOB */ -#endif - bi_flush(s); - /* Of the 10 bits for the empty block, we have already sent - * (10 - bi_valid) bits. The lookahead for the last real code (before - * the EOB of the previous block) was thus at least one plus the length - * of the EOB plus what we have just sent of the empty static block. - */ - if (1 + s->last_eob_len + 10 - s->bi_valid < 9) { - send_bits(s, STATIC_TREES<<1, 3); - send_code(s, END_BLOCK, static_ltree); -#ifdef DEBUG - s->compressed_len += 10L; -#endif - bi_flush(s); - } - s->last_eob_len = 7; -} - -/* =========================================================================== - * Determine the best encoding for the current block: dynamic trees, static - * trees or store, and output the encoded block to the zip file. - */ -void _tr_flush_block(s, buf, stored_len, eof) - deflate_state *s; - charf *buf; /* input block, or NULL if too old */ - ulg stored_len; /* length of input block */ - int eof; /* true if this is the last block for a file */ -{ - ulg opt_lenb, static_lenb; /* opt_len and static_len in bytes */ - int max_blindex = 0; /* index of last bit length code of non zero freq */ - - /* Build the Huffman trees unless a stored block is forced */ - if (s->level > 0) { - - /* Check if the file is binary or text */ - if (stored_len > 0 && s->strm->data_type == Z_UNKNOWN) - set_data_type(s); - - /* Construct the literal and distance trees */ - build_tree(s, (tree_desc *)(&(s->l_desc))); - Tracev((stderr, "\nlit data: dyn %ld, stat %ld", s->opt_len, - s->static_len)); - - build_tree(s, (tree_desc *)(&(s->d_desc))); - Tracev((stderr, "\ndist data: dyn %ld, stat %ld", s->opt_len, - s->static_len)); - /* At this point, opt_len and static_len are the total bit lengths of - * the compressed block data, excluding the tree representations. - */ - - /* Build the bit length tree for the above two trees, and get the index - * in bl_order of the last bit length code to send. - */ - max_blindex = build_bl_tree(s); - - /* Determine the best encoding. Compute the block lengths in bytes. */ - opt_lenb = (s->opt_len+3+7)>>3; - static_lenb = (s->static_len+3+7)>>3; - - Tracev((stderr, "\nopt %lu(%lu) stat %lu(%lu) stored %lu lit %u ", - opt_lenb, s->opt_len, static_lenb, s->static_len, stored_len, - s->last_lit)); - - if (static_lenb <= opt_lenb) opt_lenb = static_lenb; - - } else { - Assert(buf != (char*)0, "lost buf"); - opt_lenb = static_lenb = stored_len + 5; /* force a stored block */ - } - -#ifdef FORCE_STORED - if (buf != (char*)0) { /* force stored block */ -#else - if (stored_len+4 <= opt_lenb && buf != (char*)0) { - /* 4: two words for the lengths */ -#endif - /* The test buf != NULL is only necessary if LIT_BUFSIZE > WSIZE. - * Otherwise we can't have processed more than WSIZE input bytes since - * the last block flush, because compression would have been - * successful. If LIT_BUFSIZE <= WSIZE, it is never too late to - * transform a block into a stored block. - */ - _tr_stored_block(s, buf, stored_len, eof); - -#ifdef FORCE_STATIC - } else if (static_lenb >= 0) { /* force static trees */ -#else - } else if (s->strategy == Z_FIXED || static_lenb == opt_lenb) { -#endif - send_bits(s, (STATIC_TREES<<1)+eof, 3); - compress_block(s, (ct_data *)static_ltree, (ct_data *)static_dtree); -#ifdef DEBUG - s->compressed_len += 3 + s->static_len; -#endif - } else { - send_bits(s, (DYN_TREES<<1)+eof, 3); - send_all_trees(s, s->l_desc.max_code+1, s->d_desc.max_code+1, - max_blindex+1); - compress_block(s, (ct_data *)s->dyn_ltree, (ct_data *)s->dyn_dtree); -#ifdef DEBUG - s->compressed_len += 3 + s->opt_len; -#endif - } - Assert (s->compressed_len == s->bits_sent, "bad compressed size"); - /* The above check is made mod 2^32, for files larger than 512 MB - * and uLong implemented on 32 bits. - */ - init_block(s); - - if (eof) { - bi_windup(s); -#ifdef DEBUG - s->compressed_len += 7; /* align on byte boundary */ -#endif - } - Tracev((stderr,"\ncomprlen %lu(%lu) ", s->compressed_len>>3, - s->compressed_len-7*eof)); -} - -/* =========================================================================== - * Save the match info and tally the frequency counts. Return true if - * the current block must be flushed. - */ -int _tr_tally (s, dist, lc) - deflate_state *s; - unsigned dist; /* distance of matched string */ - unsigned lc; /* match length-MIN_MATCH or unmatched char (if dist==0) */ -{ - s->d_buf[s->last_lit] = (ush)dist; - s->l_buf[s->last_lit++] = (uch)lc; - if (dist == 0) { - /* lc is the unmatched char */ - s->dyn_ltree[lc].Freq++; - } else { - s->matches++; - /* Here, lc is the match length - MIN_MATCH */ - dist--; /* dist = match distance - 1 */ - Assert((ush)dist < (ush)MAX_DIST(s) && - (ush)lc <= (ush)(MAX_MATCH-MIN_MATCH) && - (ush)d_code(dist) < (ush)D_CODES, "_tr_tally: bad match"); - - s->dyn_ltree[_length_code[lc]+LITERALS+1].Freq++; - s->dyn_dtree[d_code(dist)].Freq++; - } - -#ifdef TRUNCATE_BLOCK - /* Try to guess if it is profitable to stop the current block here */ - if ((s->last_lit & 0x1fff) == 0 && s->level > 2) { - /* Compute an upper bound for the compressed length */ - ulg out_length = (ulg)s->last_lit*8L; - ulg in_length = (ulg)((long)s->strstart - s->block_start); - int dcode; - for (dcode = 0; dcode < D_CODES; dcode++) { - out_length += (ulg)s->dyn_dtree[dcode].Freq * - (5L+extra_dbits[dcode]); - } - out_length >>= 3; - Tracev((stderr,"\nlast_lit %u, in %ld, out ~%ld(%ld%%) ", - s->last_lit, in_length, out_length, - 100L - out_length*100L/in_length)); - if (s->matches < s->last_lit/2 && out_length < in_length/2) return 1; - } -#endif - return (s->last_lit == s->lit_bufsize-1); - /* We avoid equality with lit_bufsize because of wraparound at 64K - * on 16 bit machines and because stored blocks are restricted to - * 64K-1 bytes. - */ -} - -/* =========================================================================== - * Send the block data compressed using the given Huffman trees - */ -local void compress_block(s, ltree, dtree) - deflate_state *s; - ct_data *ltree; /* literal tree */ - ct_data *dtree; /* distance tree */ -{ - unsigned dist; /* distance of matched string */ - int lc; /* match length or unmatched char (if dist == 0) */ - unsigned lx = 0; /* running index in l_buf */ - unsigned code; /* the code to send */ - int extra; /* number of extra bits to send */ - - if (s->last_lit != 0) do { - dist = s->d_buf[lx]; - lc = s->l_buf[lx++]; - if (dist == 0) { - send_code(s, lc, ltree); /* send a literal byte */ - Tracecv(isgraph(lc), (stderr," '%c' ", lc)); - } else { - /* Here, lc is the match length - MIN_MATCH */ - code = _length_code[lc]; - send_code(s, code+LITERALS+1, ltree); /* send the length code */ - extra = extra_lbits[code]; - if (extra != 0) { - lc -= base_length[code]; - send_bits(s, lc, extra); /* send the extra length bits */ - } - dist--; /* dist is now the match distance - 1 */ - code = d_code(dist); - Assert (code < D_CODES, "bad d_code"); - - send_code(s, code, dtree); /* send the distance code */ - extra = extra_dbits[code]; - if (extra != 0) { - dist -= base_dist[code]; - send_bits(s, dist, extra); /* send the extra distance bits */ - } - } /* literal or match pair ? */ - - /* Check that the overlay between pending_buf and d_buf+l_buf is ok: */ - Assert((uInt)(s->pending) < s->lit_bufsize + 2*lx, - "pendingBuf overflow"); - - } while (lx < s->last_lit); - - send_code(s, END_BLOCK, ltree); - s->last_eob_len = ltree[END_BLOCK].Len; -} - -/* =========================================================================== - * Set the data type to BINARY or TEXT, using a crude approximation: - * set it to Z_TEXT if all symbols are either printable characters (33 to 255) - * or white spaces (9 to 13, or 32); or set it to Z_BINARY otherwise. - * IN assertion: the fields Freq of dyn_ltree are set. - */ -local void set_data_type(s) - deflate_state *s; -{ - int n; - - for (n = 0; n < 9; n++) - if (s->dyn_ltree[n].Freq != 0) - break; - if (n == 9) - for (n = 14; n < 32; n++) - if (s->dyn_ltree[n].Freq != 0) - break; - s->strm->data_type = (n == 32) ? Z_TEXT : Z_BINARY; -} - -/* =========================================================================== - * Reverse the first len bits of a code, using straightforward code (a faster - * method would use a table) - * IN assertion: 1 <= len <= 15 - */ -local unsigned bi_reverse(code, len) - unsigned code; /* the value to invert */ - int len; /* its bit length */ -{ - register unsigned res = 0; - do { - res |= code & 1; - code >>= 1, res <<= 1; - } while (--len > 0); - return res >> 1; -} - -/* =========================================================================== - * Flush the bit buffer, keeping at most 7 bits in it. - */ -local void bi_flush(s) - deflate_state *s; -{ - if (s->bi_valid == 16) { - put_short(s, s->bi_buf); - s->bi_buf = 0; - s->bi_valid = 0; - } else if (s->bi_valid >= 8) { - put_byte(s, (Byte)s->bi_buf); - s->bi_buf >>= 8; - s->bi_valid -= 8; - } -} - -/* =========================================================================== - * Flush the bit buffer and align the output on a byte boundary - */ -local void bi_windup(s) - deflate_state *s; -{ - if (s->bi_valid > 8) { - put_short(s, s->bi_buf); - } else if (s->bi_valid > 0) { - put_byte(s, (Byte)s->bi_buf); - } - s->bi_buf = 0; - s->bi_valid = 0; -#ifdef DEBUG - s->bits_sent = (s->bits_sent+7) & ~7; -#endif -} - -/* =========================================================================== - * Copy a stored block, storing first the length and its - * one's complement if requested. - */ -local void copy_block(s, buf, len, header) - deflate_state *s; - charf *buf; /* the input data */ - unsigned len; /* its length */ - int header; /* true if block header must be written */ -{ - bi_windup(s); /* align on byte boundary */ - s->last_eob_len = 8; /* enough lookahead for inflate */ - - if (header) { - put_short(s, (ush)len); - put_short(s, (ush)~len); -#ifdef DEBUG - s->bits_sent += 2*16; -#endif - } -#ifdef DEBUG - s->bits_sent += (ulg)len<<3; -#endif - while (len--) { - put_byte(s, *buf++); - } -} diff --git a/dependencies/zlib/trees.h b/dependencies/zlib/trees.h deleted file mode 100644 index 1ca868b8..00000000 --- a/dependencies/zlib/trees.h +++ /dev/null @@ -1,128 +0,0 @@ -/* header created automatically with -DGEN_TREES_H */ - -local const ct_data static_ltree[L_CODES+2] = { -{{ 12},{ 8}}, {{140},{ 8}}, {{ 76},{ 8}}, {{204},{ 8}}, {{ 44},{ 8}}, -{{172},{ 8}}, {{108},{ 8}}, {{236},{ 8}}, {{ 28},{ 8}}, {{156},{ 8}}, -{{ 92},{ 8}}, {{220},{ 8}}, {{ 60},{ 8}}, {{188},{ 8}}, {{124},{ 8}}, -{{252},{ 8}}, {{ 2},{ 8}}, {{130},{ 8}}, {{ 66},{ 8}}, {{194},{ 8}}, -{{ 34},{ 8}}, {{162},{ 8}}, {{ 98},{ 8}}, {{226},{ 8}}, {{ 18},{ 8}}, -{{146},{ 8}}, {{ 82},{ 8}}, {{210},{ 8}}, {{ 50},{ 8}}, {{178},{ 8}}, -{{114},{ 8}}, {{242},{ 8}}, {{ 10},{ 8}}, {{138},{ 8}}, {{ 74},{ 8}}, -{{202},{ 8}}, {{ 42},{ 8}}, {{170},{ 8}}, {{106},{ 8}}, {{234},{ 8}}, -{{ 26},{ 8}}, {{154},{ 8}}, {{ 90},{ 8}}, {{218},{ 8}}, {{ 58},{ 8}}, -{{186},{ 8}}, {{122},{ 8}}, {{250},{ 8}}, {{ 6},{ 8}}, {{134},{ 8}}, -{{ 70},{ 8}}, {{198},{ 8}}, {{ 38},{ 8}}, {{166},{ 8}}, {{102},{ 8}}, -{{230},{ 8}}, {{ 22},{ 8}}, {{150},{ 8}}, {{ 86},{ 8}}, {{214},{ 8}}, -{{ 54},{ 8}}, {{182},{ 8}}, {{118},{ 8}}, {{246},{ 8}}, {{ 14},{ 8}}, -{{142},{ 8}}, {{ 78},{ 8}}, {{206},{ 8}}, {{ 46},{ 8}}, {{174},{ 8}}, -{{110},{ 8}}, {{238},{ 8}}, {{ 30},{ 8}}, {{158},{ 8}}, {{ 94},{ 8}}, -{{222},{ 8}}, {{ 62},{ 8}}, {{190},{ 8}}, {{126},{ 8}}, {{254},{ 8}}, -{{ 1},{ 8}}, {{129},{ 8}}, {{ 65},{ 8}}, {{193},{ 8}}, {{ 33},{ 8}}, -{{161},{ 8}}, {{ 97},{ 8}}, {{225},{ 8}}, {{ 17},{ 8}}, {{145},{ 8}}, -{{ 81},{ 8}}, {{209},{ 8}}, {{ 49},{ 8}}, {{177},{ 8}}, {{113},{ 8}}, -{{241},{ 8}}, {{ 9},{ 8}}, {{137},{ 8}}, {{ 73},{ 8}}, {{201},{ 8}}, -{{ 41},{ 8}}, {{169},{ 8}}, {{105},{ 8}}, {{233},{ 8}}, {{ 25},{ 8}}, -{{153},{ 8}}, {{ 89},{ 8}}, {{217},{ 8}}, {{ 57},{ 8}}, {{185},{ 8}}, -{{121},{ 8}}, {{249},{ 8}}, {{ 5},{ 8}}, {{133},{ 8}}, {{ 69},{ 8}}, -{{197},{ 8}}, {{ 37},{ 8}}, {{165},{ 8}}, {{101},{ 8}}, {{229},{ 8}}, -{{ 21},{ 8}}, {{149},{ 8}}, {{ 85},{ 8}}, {{213},{ 8}}, {{ 53},{ 8}}, -{{181},{ 8}}, {{117},{ 8}}, {{245},{ 8}}, {{ 13},{ 8}}, {{141},{ 8}}, -{{ 77},{ 8}}, {{205},{ 8}}, {{ 45},{ 8}}, {{173},{ 8}}, {{109},{ 8}}, -{{237},{ 8}}, {{ 29},{ 8}}, {{157},{ 8}}, {{ 93},{ 8}}, {{221},{ 8}}, -{{ 61},{ 8}}, {{189},{ 8}}, {{125},{ 8}}, {{253},{ 8}}, {{ 19},{ 9}}, -{{275},{ 9}}, {{147},{ 9}}, {{403},{ 9}}, {{ 83},{ 9}}, {{339},{ 9}}, -{{211},{ 9}}, {{467},{ 9}}, {{ 51},{ 9}}, {{307},{ 9}}, {{179},{ 9}}, -{{435},{ 9}}, {{115},{ 9}}, {{371},{ 9}}, {{243},{ 9}}, {{499},{ 9}}, -{{ 11},{ 9}}, {{267},{ 9}}, {{139},{ 9}}, {{395},{ 9}}, {{ 75},{ 9}}, -{{331},{ 9}}, {{203},{ 9}}, {{459},{ 9}}, {{ 43},{ 9}}, {{299},{ 9}}, -{{171},{ 9}}, {{427},{ 9}}, {{107},{ 9}}, {{363},{ 9}}, {{235},{ 9}}, -{{491},{ 9}}, {{ 27},{ 9}}, {{283},{ 9}}, {{155},{ 9}}, {{411},{ 9}}, -{{ 91},{ 9}}, {{347},{ 9}}, {{219},{ 9}}, {{475},{ 9}}, {{ 59},{ 9}}, -{{315},{ 9}}, {{187},{ 9}}, {{443},{ 9}}, {{123},{ 9}}, {{379},{ 9}}, -{{251},{ 9}}, {{507},{ 9}}, {{ 7},{ 9}}, {{263},{ 9}}, {{135},{ 9}}, -{{391},{ 9}}, {{ 71},{ 9}}, {{327},{ 9}}, {{199},{ 9}}, {{455},{ 9}}, -{{ 39},{ 9}}, {{295},{ 9}}, {{167},{ 9}}, {{423},{ 9}}, {{103},{ 9}}, -{{359},{ 9}}, {{231},{ 9}}, {{487},{ 9}}, {{ 23},{ 9}}, {{279},{ 9}}, -{{151},{ 9}}, {{407},{ 9}}, {{ 87},{ 9}}, {{343},{ 9}}, {{215},{ 9}}, -{{471},{ 9}}, {{ 55},{ 9}}, {{311},{ 9}}, {{183},{ 9}}, {{439},{ 9}}, -{{119},{ 9}}, {{375},{ 9}}, {{247},{ 9}}, {{503},{ 9}}, {{ 15},{ 9}}, -{{271},{ 9}}, {{143},{ 9}}, {{399},{ 9}}, {{ 79},{ 9}}, {{335},{ 9}}, -{{207},{ 9}}, {{463},{ 9}}, {{ 47},{ 9}}, {{303},{ 9}}, {{175},{ 9}}, -{{431},{ 9}}, {{111},{ 9}}, {{367},{ 9}}, {{239},{ 9}}, {{495},{ 9}}, -{{ 31},{ 9}}, {{287},{ 9}}, {{159},{ 9}}, {{415},{ 9}}, {{ 95},{ 9}}, -{{351},{ 9}}, {{223},{ 9}}, {{479},{ 9}}, {{ 63},{ 9}}, {{319},{ 9}}, -{{191},{ 9}}, {{447},{ 9}}, {{127},{ 9}}, {{383},{ 9}}, {{255},{ 9}}, -{{511},{ 9}}, {{ 0},{ 7}}, {{ 64},{ 7}}, {{ 32},{ 7}}, {{ 96},{ 7}}, -{{ 16},{ 7}}, {{ 80},{ 7}}, {{ 48},{ 7}}, {{112},{ 7}}, {{ 8},{ 7}}, -{{ 72},{ 7}}, {{ 40},{ 7}}, {{104},{ 7}}, {{ 24},{ 7}}, {{ 88},{ 7}}, -{{ 56},{ 7}}, {{120},{ 7}}, {{ 4},{ 7}}, {{ 68},{ 7}}, {{ 36},{ 7}}, -{{100},{ 7}}, {{ 20},{ 7}}, {{ 84},{ 7}}, {{ 52},{ 7}}, {{116},{ 7}}, -{{ 3},{ 8}}, {{131},{ 8}}, {{ 67},{ 8}}, {{195},{ 8}}, {{ 35},{ 8}}, -{{163},{ 8}}, {{ 99},{ 8}}, {{227},{ 8}} -}; - -local const ct_data static_dtree[D_CODES] = { -{{ 0},{ 5}}, {{16},{ 5}}, {{ 8},{ 5}}, {{24},{ 5}}, {{ 4},{ 5}}, -{{20},{ 5}}, {{12},{ 5}}, {{28},{ 5}}, {{ 2},{ 5}}, {{18},{ 5}}, -{{10},{ 5}}, {{26},{ 5}}, {{ 6},{ 5}}, {{22},{ 5}}, {{14},{ 5}}, -{{30},{ 5}}, {{ 1},{ 5}}, {{17},{ 5}}, {{ 9},{ 5}}, {{25},{ 5}}, -{{ 5},{ 5}}, {{21},{ 5}}, {{13},{ 5}}, {{29},{ 5}}, {{ 3},{ 5}}, -{{19},{ 5}}, {{11},{ 5}}, {{27},{ 5}}, {{ 7},{ 5}}, {{23},{ 5}} -}; - -const uch _dist_code[DIST_CODE_LEN] = { - 0, 1, 2, 3, 4, 4, 5, 5, 6, 6, 6, 6, 7, 7, 7, 7, 8, 8, 8, 8, - 8, 8, 8, 8, 9, 9, 9, 9, 9, 9, 9, 9, 10, 10, 10, 10, 10, 10, 10, 10, -10, 10, 10, 10, 10, 10, 10, 10, 11, 11, 11, 11, 11, 11, 11, 11, 11, 11, 11, 11, -11, 11, 11, 11, 12, 12, 12, 12, 12, 12, 12, 12, 12, 12, 12, 12, 12, 12, 12, 12, -12, 12, 12, 12, 12, 12, 12, 12, 12, 12, 12, 12, 12, 12, 12, 12, 13, 13, 13, 13, -13, 13, 13, 13, 13, 13, 13, 13, 13, 13, 13, 13, 13, 13, 13, 13, 13, 13, 13, 13, -13, 13, 13, 13, 13, 13, 13, 13, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, -14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, -14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, -14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 15, 15, 15, 15, 15, 15, 15, 15, -15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, -15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, -15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 0, 0, 16, 17, -18, 18, 19, 19, 20, 20, 20, 20, 21, 21, 21, 21, 22, 22, 22, 22, 22, 22, 22, 22, -23, 23, 23, 23, 23, 23, 23, 23, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, -24, 24, 24, 24, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, -26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, -26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 27, 27, 27, 27, 27, 27, 27, 27, -27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, -27, 27, 27, 27, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, -28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, -28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, -28, 28, 28, 28, 28, 28, 28, 28, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, -29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, -29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, -29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29 -}; - -const uch _length_code[MAX_MATCH-MIN_MATCH+1]= { - 0, 1, 2, 3, 4, 5, 6, 7, 8, 8, 9, 9, 10, 10, 11, 11, 12, 12, 12, 12, -13, 13, 13, 13, 14, 14, 14, 14, 15, 15, 15, 15, 16, 16, 16, 16, 16, 16, 16, 16, -17, 17, 17, 17, 17, 17, 17, 17, 18, 18, 18, 18, 18, 18, 18, 18, 19, 19, 19, 19, -19, 19, 19, 19, 20, 20, 20, 20, 20, 20, 20, 20, 20, 20, 20, 20, 20, 20, 20, 20, -21, 21, 21, 21, 21, 21, 21, 21, 21, 21, 21, 21, 21, 21, 21, 21, 22, 22, 22, 22, -22, 22, 22, 22, 22, 22, 22, 22, 22, 22, 22, 22, 23, 23, 23, 23, 23, 23, 23, 23, -23, 23, 23, 23, 23, 23, 23, 23, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, -24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, -25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, -25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 26, 26, 26, 26, 26, 26, 26, 26, -26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, -26, 26, 26, 26, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, -27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 28 -}; - -local const int base_length[LENGTH_CODES] = { -0, 1, 2, 3, 4, 5, 6, 7, 8, 10, 12, 14, 16, 20, 24, 28, 32, 40, 48, 56, -64, 80, 96, 112, 128, 160, 192, 224, 0 -}; - -local const int base_dist[D_CODES] = { - 0, 1, 2, 3, 4, 6, 8, 12, 16, 24, - 32, 48, 64, 96, 128, 192, 256, 384, 512, 768, - 1024, 1536, 2048, 3072, 4096, 6144, 8192, 12288, 16384, 24576 -}; - diff --git a/dependencies/zlib/uncompr.c b/dependencies/zlib/uncompr.c deleted file mode 100644 index ad6db0a6..00000000 --- a/dependencies/zlib/uncompr.c +++ /dev/null @@ -1,61 +0,0 @@ -/* uncompr.c -- decompress a memory buffer - * Copyright (C) 1995-2003 Jean-loup Gailly. - * For conditions of distribution and use, see copyright notice in zlib.h - */ - -/* @(#) $Id$ */ - -#define ZLIB_INTERNAL -#include "zlib.h" - -/* =========================================================================== - Decompresses the source buffer into the destination buffer. sourceLen is - the byte length of the source buffer. Upon entry, destLen is the total - size of the destination buffer, which must be large enough to hold the - entire uncompressed data. (The size of the uncompressed data must have - been saved previously by the compressor and transmitted to the decompressor - by some mechanism outside the scope of this compression library.) - Upon exit, destLen is the actual size of the compressed buffer. - This function can be used to decompress a whole file at once if the - input file is mmap'ed. - - uncompress returns Z_OK if success, Z_MEM_ERROR if there was not - enough memory, Z_BUF_ERROR if there was not enough room in the output - buffer, or Z_DATA_ERROR if the input data was corrupted. -*/ -int ZEXPORT uncompress (dest, destLen, source, sourceLen) - Bytef *dest; - uLongf *destLen; - const Bytef *source; - uLong sourceLen; -{ - z_stream stream; - int err; - - stream.next_in = (Bytef*)source; - stream.avail_in = (uInt)sourceLen; - /* Check for source > 64K on 16-bit machine: */ - if ((uLong)stream.avail_in != sourceLen) return Z_BUF_ERROR; - - stream.next_out = dest; - stream.avail_out = (uInt)*destLen; - if ((uLong)stream.avail_out != *destLen) return Z_BUF_ERROR; - - stream.zalloc = (alloc_func)0; - stream.zfree = (free_func)0; - - err = inflateInit(&stream); - if (err != Z_OK) return err; - - err = inflate(&stream, Z_FINISH); - if (err != Z_STREAM_END) { - inflateEnd(&stream); - if (err == Z_NEED_DICT || (err == Z_BUF_ERROR && stream.avail_in == 0)) - return Z_DATA_ERROR; - return err; - } - *destLen = stream.total_out; - - err = inflateEnd(&stream); - return err; -} diff --git a/dependencies/zlib/zconf.h b/dependencies/zlib/zconf.h deleted file mode 100644 index e3b0c962..00000000 --- a/dependencies/zlib/zconf.h +++ /dev/null @@ -1,332 +0,0 @@ -/* zconf.h -- configuration of the zlib compression library - * Copyright (C) 1995-2005 Jean-loup Gailly. - * For conditions of distribution and use, see copyright notice in zlib.h - */ - -/* @(#) $Id$ */ - -#ifndef ZCONF_H -#define ZCONF_H - -/* - * If you *really* need a unique prefix for all types and library functions, - * compile with -DZ_PREFIX. The "standard" zlib should be compiled without it. - */ -#ifdef Z_PREFIX -# define deflateInit_ z_deflateInit_ -# define deflate z_deflate -# define deflateEnd z_deflateEnd -# define inflateInit_ z_inflateInit_ -# define inflate z_inflate -# define inflateEnd z_inflateEnd -# define deflateInit2_ z_deflateInit2_ -# define deflateSetDictionary z_deflateSetDictionary -# define deflateCopy z_deflateCopy -# define deflateReset z_deflateReset -# define deflateParams z_deflateParams -# define deflateBound z_deflateBound -# define deflatePrime z_deflatePrime -# define inflateInit2_ z_inflateInit2_ -# define inflateSetDictionary z_inflateSetDictionary -# define inflateSync z_inflateSync -# define inflateSyncPoint z_inflateSyncPoint -# define inflateCopy z_inflateCopy -# define inflateReset z_inflateReset -# define inflateBack z_inflateBack -# define inflateBackEnd z_inflateBackEnd -# define compress z_compress -# define compress2 z_compress2 -# define compressBound z_compressBound -# define uncompress z_uncompress -# define adler32 z_adler32 -# define crc32 z_crc32 -# define get_crc_table z_get_crc_table -# define zError z_zError - -# define alloc_func z_alloc_func -# define free_func z_free_func -# define in_func z_in_func -# define out_func z_out_func -# define Byte z_Byte -# define uInt z_uInt -# define uLong z_uLong -# define Bytef z_Bytef -# define charf z_charf -# define intf z_intf -# define uIntf z_uIntf -# define uLongf z_uLongf -# define voidpf z_voidpf -# define voidp z_voidp -#endif - -#if defined(__MSDOS__) && !defined(MSDOS) -# define MSDOS -#endif -#if (defined(OS_2) || defined(__OS2__)) && !defined(OS2) -# define OS2 -#endif -#if defined(_WINDOWS) && !defined(WINDOWS) -# define WINDOWS -#endif -#if defined(_WIN32) || defined(_WIN32_WCE) || defined(__WIN32__) -# ifndef WIN32 -# define WIN32 -# endif -#endif -#if (defined(MSDOS) || defined(OS2) || defined(WINDOWS)) && !defined(WIN32) -# if !defined(__GNUC__) && !defined(__FLAT__) && !defined(__386__) -# ifndef SYS16BIT -# define SYS16BIT -# endif -# endif -#endif - -/* - * Compile with -DMAXSEG_64K if the alloc function cannot allocate more - * than 64k bytes at a time (needed on systems with 16-bit int). - */ -#ifdef SYS16BIT -# define MAXSEG_64K -#endif -#ifdef MSDOS -# define UNALIGNED_OK -#endif - -#ifdef __STDC_VERSION__ -# ifndef STDC -# define STDC -# endif -# if __STDC_VERSION__ >= 199901L -# ifndef STDC99 -# define STDC99 -# endif -# endif -#endif -#if !defined(STDC) && (defined(__STDC__) || defined(__cplusplus)) -# define STDC -#endif -#if !defined(STDC) && (defined(__GNUC__) || defined(__BORLANDC__)) -# define STDC -#endif -#if !defined(STDC) && (defined(MSDOS) || defined(WINDOWS) || defined(WIN32)) -# define STDC -#endif -#if !defined(STDC) && (defined(OS2) || defined(__HOS_AIX__)) -# define STDC -#endif - -#if defined(__OS400__) && !defined(STDC) /* iSeries (formerly AS/400). */ -# define STDC -#endif - -#ifndef STDC -# ifndef const /* cannot use !defined(STDC) && !defined(const) on Mac */ -# define const /* note: need a more gentle solution here */ -# endif -#endif - -/* Some Mac compilers merge all .h files incorrectly: */ -#if defined(__MWERKS__)||defined(applec)||defined(THINK_C)||defined(__SC__) -# define NO_DUMMY_DECL -#endif - -/* Maximum value for memLevel in deflateInit2 */ -#ifndef MAX_MEM_LEVEL -# ifdef MAXSEG_64K -# define MAX_MEM_LEVEL 8 -# else -# define MAX_MEM_LEVEL 9 -# endif -#endif - -/* Maximum value for windowBits in deflateInit2 and inflateInit2. - * WARNING: reducing MAX_WBITS makes minigzip unable to extract .gz files - * created by gzip. (Files created by minigzip can still be extracted by - * gzip.) - */ -#ifndef MAX_WBITS -# define MAX_WBITS 15 /* 32K LZ77 window */ -#endif - -/* The memory requirements for deflate are (in bytes): - (1 << (windowBits+2)) + (1 << (memLevel+9)) - that is: 128K for windowBits=15 + 128K for memLevel = 8 (default values) - plus a few kilobytes for small objects. For example, if you want to reduce - the default memory requirements from 256K to 128K, compile with - make CFLAGS="-O -DMAX_WBITS=14 -DMAX_MEM_LEVEL=7" - Of course this will generally degrade compression (there's no free lunch). - - The memory requirements for inflate are (in bytes) 1 << windowBits - that is, 32K for windowBits=15 (default value) plus a few kilobytes - for small objects. -*/ - - /* Type declarations */ - -#ifndef OF /* function prototypes */ -# ifdef STDC -# define OF(args) args -# else -# define OF(args) () -# endif -#endif - -/* The following definitions for FAR are needed only for MSDOS mixed - * model programming (small or medium model with some far allocations). - * This was tested only with MSC; for other MSDOS compilers you may have - * to define NO_MEMCPY in zutil.h. If you don't need the mixed model, - * just define FAR to be empty. - */ -#ifdef SYS16BIT -# if defined(M_I86SM) || defined(M_I86MM) - /* MSC small or medium model */ -# define SMALL_MEDIUM -# ifdef _MSC_VER -# define FAR _far -# else -# define FAR far -# endif -# endif -# if (defined(__SMALL__) || defined(__MEDIUM__)) - /* Turbo C small or medium model */ -# define SMALL_MEDIUM -# ifdef __BORLANDC__ -# define FAR _far -# else -# define FAR far -# endif -# endif -#endif - -#if defined(WINDOWS) || defined(WIN32) - /* If building or using zlib as a DLL, define ZLIB_DLL. - * This is not mandatory, but it offers a little performance increase. - */ -# ifdef ZLIB_DLL -# if defined(WIN32) && (!defined(__BORLANDC__) || (__BORLANDC__ >= 0x500)) -# ifdef ZLIB_INTERNAL -# define ZEXTERN extern __declspec(dllexport) -# else -# define ZEXTERN extern __declspec(dllimport) -# endif -# endif -# endif /* ZLIB_DLL */ - /* If building or using zlib with the WINAPI/WINAPIV calling convention, - * define ZLIB_WINAPI. - * Caution: the standard ZLIB1.DLL is NOT compiled using ZLIB_WINAPI. - */ -# ifdef ZLIB_WINAPI -# ifdef FAR -# undef FAR -# endif -# include - /* No need for _export, use ZLIB.DEF instead. */ - /* For complete Windows compatibility, use WINAPI, not __stdcall. */ -# define ZEXPORT WINAPI -# ifdef WIN32 -# define ZEXPORTVA WINAPIV -# else -# define ZEXPORTVA FAR CDECL -# endif -# endif -#endif - -#if defined (__BEOS__) -# ifdef ZLIB_DLL -# ifdef ZLIB_INTERNAL -# define ZEXPORT __declspec(dllexport) -# define ZEXPORTVA __declspec(dllexport) -# else -# define ZEXPORT __declspec(dllimport) -# define ZEXPORTVA __declspec(dllimport) -# endif -# endif -#endif - -#ifndef ZEXTERN -# define ZEXTERN extern -#endif -#ifndef ZEXPORT -# define ZEXPORT -#endif -#ifndef ZEXPORTVA -# define ZEXPORTVA -#endif - -#ifndef FAR -# define FAR -#endif - -#if !defined(__MACTYPES__) -typedef unsigned char Byte; /* 8 bits */ -#endif -typedef unsigned int uInt; /* 16 bits or more */ -typedef unsigned long uLong; /* 32 bits or more */ - -#ifdef SMALL_MEDIUM - /* Borland C/C++ and some old MSC versions ignore FAR inside typedef */ -# define Bytef Byte FAR -#else - typedef Byte FAR Bytef; -#endif -typedef char FAR charf; -typedef int FAR intf; -typedef uInt FAR uIntf; -typedef uLong FAR uLongf; - -#ifdef STDC - typedef void const *voidpc; - typedef void FAR *voidpf; - typedef void *voidp; -#else - typedef Byte const *voidpc; - typedef Byte FAR *voidpf; - typedef Byte *voidp; -#endif - -#if 0 /* HAVE_UNISTD_H -- this line is updated by ./configure */ -# include /* for off_t */ -# include /* for SEEK_* and off_t */ -# ifdef VMS -# include /* for off_t */ -# endif -# define z_off_t off_t -#endif -#ifndef SEEK_SET -# define SEEK_SET 0 /* Seek from beginning of file. */ -# define SEEK_CUR 1 /* Seek from current position. */ -# define SEEK_END 2 /* Set file pointer to EOF plus "offset" */ -#endif -#ifndef z_off_t -# define z_off_t long -#endif - -#if defined(__OS400__) -# define NO_vsnprintf -#endif - -#if defined(__MVS__) -# define NO_vsnprintf -# ifdef FAR -# undef FAR -# endif -#endif - -/* MVS linker does not support external names larger than 8 bytes */ -#if defined(__MVS__) -# pragma map(deflateInit_,"DEIN") -# pragma map(deflateInit2_,"DEIN2") -# pragma map(deflateEnd,"DEEND") -# pragma map(deflateBound,"DEBND") -# pragma map(inflateInit_,"ININ") -# pragma map(inflateInit2_,"ININ2") -# pragma map(inflateEnd,"INEND") -# pragma map(inflateSync,"INSY") -# pragma map(inflateSetDictionary,"INSEDI") -# pragma map(compressBound,"CMBND") -# pragma map(inflate_table,"INTABL") -# pragma map(inflate_fast,"INFA") -# pragma map(inflate_copyright,"INCOPY") -#endif - -#endif /* ZCONF_H */ diff --git a/dependencies/zlib/zconf.in.h b/dependencies/zlib/zconf.in.h deleted file mode 100644 index e3b0c962..00000000 --- a/dependencies/zlib/zconf.in.h +++ /dev/null @@ -1,332 +0,0 @@ -/* zconf.h -- configuration of the zlib compression library - * Copyright (C) 1995-2005 Jean-loup Gailly. - * For conditions of distribution and use, see copyright notice in zlib.h - */ - -/* @(#) $Id$ */ - -#ifndef ZCONF_H -#define ZCONF_H - -/* - * If you *really* need a unique prefix for all types and library functions, - * compile with -DZ_PREFIX. The "standard" zlib should be compiled without it. - */ -#ifdef Z_PREFIX -# define deflateInit_ z_deflateInit_ -# define deflate z_deflate -# define deflateEnd z_deflateEnd -# define inflateInit_ z_inflateInit_ -# define inflate z_inflate -# define inflateEnd z_inflateEnd -# define deflateInit2_ z_deflateInit2_ -# define deflateSetDictionary z_deflateSetDictionary -# define deflateCopy z_deflateCopy -# define deflateReset z_deflateReset -# define deflateParams z_deflateParams -# define deflateBound z_deflateBound -# define deflatePrime z_deflatePrime -# define inflateInit2_ z_inflateInit2_ -# define inflateSetDictionary z_inflateSetDictionary -# define inflateSync z_inflateSync -# define inflateSyncPoint z_inflateSyncPoint -# define inflateCopy z_inflateCopy -# define inflateReset z_inflateReset -# define inflateBack z_inflateBack -# define inflateBackEnd z_inflateBackEnd -# define compress z_compress -# define compress2 z_compress2 -# define compressBound z_compressBound -# define uncompress z_uncompress -# define adler32 z_adler32 -# define crc32 z_crc32 -# define get_crc_table z_get_crc_table -# define zError z_zError - -# define alloc_func z_alloc_func -# define free_func z_free_func -# define in_func z_in_func -# define out_func z_out_func -# define Byte z_Byte -# define uInt z_uInt -# define uLong z_uLong -# define Bytef z_Bytef -# define charf z_charf -# define intf z_intf -# define uIntf z_uIntf -# define uLongf z_uLongf -# define voidpf z_voidpf -# define voidp z_voidp -#endif - -#if defined(__MSDOS__) && !defined(MSDOS) -# define MSDOS -#endif -#if (defined(OS_2) || defined(__OS2__)) && !defined(OS2) -# define OS2 -#endif -#if defined(_WINDOWS) && !defined(WINDOWS) -# define WINDOWS -#endif -#if defined(_WIN32) || defined(_WIN32_WCE) || defined(__WIN32__) -# ifndef WIN32 -# define WIN32 -# endif -#endif -#if (defined(MSDOS) || defined(OS2) || defined(WINDOWS)) && !defined(WIN32) -# if !defined(__GNUC__) && !defined(__FLAT__) && !defined(__386__) -# ifndef SYS16BIT -# define SYS16BIT -# endif -# endif -#endif - -/* - * Compile with -DMAXSEG_64K if the alloc function cannot allocate more - * than 64k bytes at a time (needed on systems with 16-bit int). - */ -#ifdef SYS16BIT -# define MAXSEG_64K -#endif -#ifdef MSDOS -# define UNALIGNED_OK -#endif - -#ifdef __STDC_VERSION__ -# ifndef STDC -# define STDC -# endif -# if __STDC_VERSION__ >= 199901L -# ifndef STDC99 -# define STDC99 -# endif -# endif -#endif -#if !defined(STDC) && (defined(__STDC__) || defined(__cplusplus)) -# define STDC -#endif -#if !defined(STDC) && (defined(__GNUC__) || defined(__BORLANDC__)) -# define STDC -#endif -#if !defined(STDC) && (defined(MSDOS) || defined(WINDOWS) || defined(WIN32)) -# define STDC -#endif -#if !defined(STDC) && (defined(OS2) || defined(__HOS_AIX__)) -# define STDC -#endif - -#if defined(__OS400__) && !defined(STDC) /* iSeries (formerly AS/400). */ -# define STDC -#endif - -#ifndef STDC -# ifndef const /* cannot use !defined(STDC) && !defined(const) on Mac */ -# define const /* note: need a more gentle solution here */ -# endif -#endif - -/* Some Mac compilers merge all .h files incorrectly: */ -#if defined(__MWERKS__)||defined(applec)||defined(THINK_C)||defined(__SC__) -# define NO_DUMMY_DECL -#endif - -/* Maximum value for memLevel in deflateInit2 */ -#ifndef MAX_MEM_LEVEL -# ifdef MAXSEG_64K -# define MAX_MEM_LEVEL 8 -# else -# define MAX_MEM_LEVEL 9 -# endif -#endif - -/* Maximum value for windowBits in deflateInit2 and inflateInit2. - * WARNING: reducing MAX_WBITS makes minigzip unable to extract .gz files - * created by gzip. (Files created by minigzip can still be extracted by - * gzip.) - */ -#ifndef MAX_WBITS -# define MAX_WBITS 15 /* 32K LZ77 window */ -#endif - -/* The memory requirements for deflate are (in bytes): - (1 << (windowBits+2)) + (1 << (memLevel+9)) - that is: 128K for windowBits=15 + 128K for memLevel = 8 (default values) - plus a few kilobytes for small objects. For example, if you want to reduce - the default memory requirements from 256K to 128K, compile with - make CFLAGS="-O -DMAX_WBITS=14 -DMAX_MEM_LEVEL=7" - Of course this will generally degrade compression (there's no free lunch). - - The memory requirements for inflate are (in bytes) 1 << windowBits - that is, 32K for windowBits=15 (default value) plus a few kilobytes - for small objects. -*/ - - /* Type declarations */ - -#ifndef OF /* function prototypes */ -# ifdef STDC -# define OF(args) args -# else -# define OF(args) () -# endif -#endif - -/* The following definitions for FAR are needed only for MSDOS mixed - * model programming (small or medium model with some far allocations). - * This was tested only with MSC; for other MSDOS compilers you may have - * to define NO_MEMCPY in zutil.h. If you don't need the mixed model, - * just define FAR to be empty. - */ -#ifdef SYS16BIT -# if defined(M_I86SM) || defined(M_I86MM) - /* MSC small or medium model */ -# define SMALL_MEDIUM -# ifdef _MSC_VER -# define FAR _far -# else -# define FAR far -# endif -# endif -# if (defined(__SMALL__) || defined(__MEDIUM__)) - /* Turbo C small or medium model */ -# define SMALL_MEDIUM -# ifdef __BORLANDC__ -# define FAR _far -# else -# define FAR far -# endif -# endif -#endif - -#if defined(WINDOWS) || defined(WIN32) - /* If building or using zlib as a DLL, define ZLIB_DLL. - * This is not mandatory, but it offers a little performance increase. - */ -# ifdef ZLIB_DLL -# if defined(WIN32) && (!defined(__BORLANDC__) || (__BORLANDC__ >= 0x500)) -# ifdef ZLIB_INTERNAL -# define ZEXTERN extern __declspec(dllexport) -# else -# define ZEXTERN extern __declspec(dllimport) -# endif -# endif -# endif /* ZLIB_DLL */ - /* If building or using zlib with the WINAPI/WINAPIV calling convention, - * define ZLIB_WINAPI. - * Caution: the standard ZLIB1.DLL is NOT compiled using ZLIB_WINAPI. - */ -# ifdef ZLIB_WINAPI -# ifdef FAR -# undef FAR -# endif -# include - /* No need for _export, use ZLIB.DEF instead. */ - /* For complete Windows compatibility, use WINAPI, not __stdcall. */ -# define ZEXPORT WINAPI -# ifdef WIN32 -# define ZEXPORTVA WINAPIV -# else -# define ZEXPORTVA FAR CDECL -# endif -# endif -#endif - -#if defined (__BEOS__) -# ifdef ZLIB_DLL -# ifdef ZLIB_INTERNAL -# define ZEXPORT __declspec(dllexport) -# define ZEXPORTVA __declspec(dllexport) -# else -# define ZEXPORT __declspec(dllimport) -# define ZEXPORTVA __declspec(dllimport) -# endif -# endif -#endif - -#ifndef ZEXTERN -# define ZEXTERN extern -#endif -#ifndef ZEXPORT -# define ZEXPORT -#endif -#ifndef ZEXPORTVA -# define ZEXPORTVA -#endif - -#ifndef FAR -# define FAR -#endif - -#if !defined(__MACTYPES__) -typedef unsigned char Byte; /* 8 bits */ -#endif -typedef unsigned int uInt; /* 16 bits or more */ -typedef unsigned long uLong; /* 32 bits or more */ - -#ifdef SMALL_MEDIUM - /* Borland C/C++ and some old MSC versions ignore FAR inside typedef */ -# define Bytef Byte FAR -#else - typedef Byte FAR Bytef; -#endif -typedef char FAR charf; -typedef int FAR intf; -typedef uInt FAR uIntf; -typedef uLong FAR uLongf; - -#ifdef STDC - typedef void const *voidpc; - typedef void FAR *voidpf; - typedef void *voidp; -#else - typedef Byte const *voidpc; - typedef Byte FAR *voidpf; - typedef Byte *voidp; -#endif - -#if 0 /* HAVE_UNISTD_H -- this line is updated by ./configure */ -# include /* for off_t */ -# include /* for SEEK_* and off_t */ -# ifdef VMS -# include /* for off_t */ -# endif -# define z_off_t off_t -#endif -#ifndef SEEK_SET -# define SEEK_SET 0 /* Seek from beginning of file. */ -# define SEEK_CUR 1 /* Seek from current position. */ -# define SEEK_END 2 /* Set file pointer to EOF plus "offset" */ -#endif -#ifndef z_off_t -# define z_off_t long -#endif - -#if defined(__OS400__) -# define NO_vsnprintf -#endif - -#if defined(__MVS__) -# define NO_vsnprintf -# ifdef FAR -# undef FAR -# endif -#endif - -/* MVS linker does not support external names larger than 8 bytes */ -#if defined(__MVS__) -# pragma map(deflateInit_,"DEIN") -# pragma map(deflateInit2_,"DEIN2") -# pragma map(deflateEnd,"DEEND") -# pragma map(deflateBound,"DEBND") -# pragma map(inflateInit_,"ININ") -# pragma map(inflateInit2_,"ININ2") -# pragma map(inflateEnd,"INEND") -# pragma map(inflateSync,"INSY") -# pragma map(inflateSetDictionary,"INSEDI") -# pragma map(compressBound,"CMBND") -# pragma map(inflate_table,"INTABL") -# pragma map(inflate_fast,"INFA") -# pragma map(inflate_copyright,"INCOPY") -#endif - -#endif /* ZCONF_H */ diff --git a/dependencies/zlib/zlib.h b/dependencies/zlib/zlib.h deleted file mode 100644 index 62d0e467..00000000 --- a/dependencies/zlib/zlib.h +++ /dev/null @@ -1,1357 +0,0 @@ -/* zlib.h -- interface of the 'zlib' general purpose compression library - version 1.2.3, July 18th, 2005 - - Copyright (C) 1995-2005 Jean-loup Gailly and Mark Adler - - This software is provided 'as-is', without any express or implied - warranty. In no event will the authors be held liable for any damages - arising from the use of this software. - - Permission is granted to anyone to use this software for any purpose, - including commercial applications, and to alter it and redistribute it - freely, subject to the following restrictions: - - 1. The origin of this software must not be misrepresented; you must not - claim that you wrote the original software. If you use this software - in a product, an acknowledgment in the product documentation would be - appreciated but is not required. - 2. Altered source versions must be plainly marked as such, and must not be - misrepresented as being the original software. - 3. This notice may not be removed or altered from any source distribution. - - Jean-loup Gailly Mark Adler - jloup@gzip.org madler@alumni.caltech.edu - - - The data format used by the zlib library is described by RFCs (Request for - Comments) 1950 to 1952 in the files http://www.ietf.org/rfc/rfc1950.txt - (zlib format), rfc1951.txt (deflate format) and rfc1952.txt (gzip format). -*/ - -#ifndef ZLIB_H -#define ZLIB_H - -#include "zconf.h" - -#ifdef __cplusplus -extern "C" { -#endif - -#define ZLIB_VERSION "1.2.3" -#define ZLIB_VERNUM 0x1230 - -/* - The 'zlib' compression library provides in-memory compression and - decompression functions, including integrity checks of the uncompressed - data. This version of the library supports only one compression method - (deflation) but other algorithms will be added later and will have the same - stream interface. - - Compression can be done in a single step if the buffers are large - enough (for example if an input file is mmap'ed), or can be done by - repeated calls of the compression function. In the latter case, the - application must provide more input and/or consume the output - (providing more output space) before each call. - - The compressed data format used by default by the in-memory functions is - the zlib format, which is a zlib wrapper documented in RFC 1950, wrapped - around a deflate stream, which is itself documented in RFC 1951. - - The library also supports reading and writing files in gzip (.gz) format - with an interface similar to that of stdio using the functions that start - with "gz". The gzip format is different from the zlib format. gzip is a - gzip wrapper, documented in RFC 1952, wrapped around a deflate stream. - - This library can optionally read and write gzip streams in memory as well. - - The zlib format was designed to be compact and fast for use in memory - and on communications channels. The gzip format was designed for single- - file compression on file systems, has a larger header than zlib to maintain - directory information, and uses a different, slower check method than zlib. - - The library does not install any signal handler. The decoder checks - the consistency of the compressed data, so the library should never - crash even in case of corrupted input. -*/ - -typedef voidpf (*alloc_func) OF((voidpf opaque, uInt items, uInt size)); -typedef void (*free_func) OF((voidpf opaque, voidpf address)); - -struct internal_state; - -typedef struct z_stream_s { - Bytef *next_in; /* next input byte */ - uInt avail_in; /* number of bytes available at next_in */ - uLong total_in; /* total nb of input bytes read so far */ - - Bytef *next_out; /* next output byte should be put there */ - uInt avail_out; /* remaining free space at next_out */ - uLong total_out; /* total nb of bytes output so far */ - - char *msg; /* last error message, NULL if no error */ - struct internal_state FAR *state; /* not visible by applications */ - - alloc_func zalloc; /* used to allocate the internal state */ - free_func zfree; /* used to free the internal state */ - voidpf opaque; /* private data object passed to zalloc and zfree */ - - int data_type; /* best guess about the data type: binary or text */ - uLong adler; /* adler32 value of the uncompressed data */ - uLong reserved; /* reserved for future use */ -} z_stream; - -typedef z_stream FAR *z_streamp; - -/* - gzip header information passed to and from zlib routines. See RFC 1952 - for more details on the meanings of these fields. -*/ -typedef struct gz_header_s { - int text; /* true if compressed data believed to be text */ - uLong time; /* modification time */ - int xflags; /* extra flags (not used when writing a gzip file) */ - int os; /* operating system */ - Bytef *extra; /* pointer to extra field or Z_NULL if none */ - uInt extra_len; /* extra field length (valid if extra != Z_NULL) */ - uInt extra_max; /* space at extra (only when reading header) */ - Bytef *name; /* pointer to zero-terminated file name or Z_NULL */ - uInt name_max; /* space at name (only when reading header) */ - Bytef *comment; /* pointer to zero-terminated comment or Z_NULL */ - uInt comm_max; /* space at comment (only when reading header) */ - int hcrc; /* true if there was or will be a header crc */ - int done; /* true when done reading gzip header (not used - when writing a gzip file) */ -} gz_header; - -typedef gz_header FAR *gz_headerp; - -/* - The application must update next_in and avail_in when avail_in has - dropped to zero. It must update next_out and avail_out when avail_out - has dropped to zero. The application must initialize zalloc, zfree and - opaque before calling the init function. All other fields are set by the - compression library and must not be updated by the application. - - The opaque value provided by the application will be passed as the first - parameter for calls of zalloc and zfree. This can be useful for custom - memory management. The compression library attaches no meaning to the - opaque value. - - zalloc must return Z_NULL if there is not enough memory for the object. - If zlib is used in a multi-threaded application, zalloc and zfree must be - thread safe. - - On 16-bit systems, the functions zalloc and zfree must be able to allocate - exactly 65536 bytes, but will not be required to allocate more than this - if the symbol MAXSEG_64K is defined (see zconf.h). WARNING: On MSDOS, - pointers returned by zalloc for objects of exactly 65536 bytes *must* - have their offset normalized to zero. The default allocation function - provided by this library ensures this (see zutil.c). To reduce memory - requirements and avoid any allocation of 64K objects, at the expense of - compression ratio, compile the library with -DMAX_WBITS=14 (see zconf.h). - - The fields total_in and total_out can be used for statistics or - progress reports. After compression, total_in holds the total size of - the uncompressed data and may be saved for use in the decompressor - (particularly if the decompressor wants to decompress everything in - a single step). -*/ - - /* constants */ - -#define Z_NO_FLUSH 0 -#define Z_PARTIAL_FLUSH 1 /* will be removed, use Z_SYNC_FLUSH instead */ -#define Z_SYNC_FLUSH 2 -#define Z_FULL_FLUSH 3 -#define Z_FINISH 4 -#define Z_BLOCK 5 -/* Allowed flush values; see deflate() and inflate() below for details */ - -#define Z_OK 0 -#define Z_STREAM_END 1 -#define Z_NEED_DICT 2 -#define Z_ERRNO (-1) -#define Z_STREAM_ERROR (-2) -#define Z_DATA_ERROR (-3) -#define Z_MEM_ERROR (-4) -#define Z_BUF_ERROR (-5) -#define Z_VERSION_ERROR (-6) -/* Return codes for the compression/decompression functions. Negative - * values are errors, positive values are used for special but normal events. - */ - -#define Z_NO_COMPRESSION 0 -#define Z_BEST_SPEED 1 -#define Z_BEST_COMPRESSION 9 -#define Z_DEFAULT_COMPRESSION (-1) -/* compression levels */ - -#define Z_FILTERED 1 -#define Z_HUFFMAN_ONLY 2 -#define Z_RLE 3 -#define Z_FIXED 4 -#define Z_DEFAULT_STRATEGY 0 -/* compression strategy; see deflateInit2() below for details */ - -#define Z_BINARY 0 -#define Z_TEXT 1 -#define Z_ASCII Z_TEXT /* for compatibility with 1.2.2 and earlier */ -#define Z_UNKNOWN 2 -/* Possible values of the data_type field (though see inflate()) */ - -#define Z_DEFLATED 8 -/* The deflate compression method (the only one supported in this version) */ - -#define Z_NULL 0 /* for initializing zalloc, zfree, opaque */ - -#define zlib_version zlibVersion() -/* for compatibility with versions < 1.0.2 */ - - /* basic functions */ - -ZEXTERN const char * ZEXPORT zlibVersion OF((void)); -/* The application can compare zlibVersion and ZLIB_VERSION for consistency. - If the first character differs, the library code actually used is - not compatible with the zlib.h header file used by the application. - This check is automatically made by deflateInit and inflateInit. - */ - -/* -ZEXTERN int ZEXPORT deflateInit OF((z_streamp strm, int level)); - - Initializes the internal stream state for compression. The fields - zalloc, zfree and opaque must be initialized before by the caller. - If zalloc and zfree are set to Z_NULL, deflateInit updates them to - use default allocation functions. - - The compression level must be Z_DEFAULT_COMPRESSION, or between 0 and 9: - 1 gives best speed, 9 gives best compression, 0 gives no compression at - all (the input data is simply copied a block at a time). - Z_DEFAULT_COMPRESSION requests a default compromise between speed and - compression (currently equivalent to level 6). - - deflateInit returns Z_OK if success, Z_MEM_ERROR if there was not - enough memory, Z_STREAM_ERROR if level is not a valid compression level, - Z_VERSION_ERROR if the zlib library version (zlib_version) is incompatible - with the version assumed by the caller (ZLIB_VERSION). - msg is set to null if there is no error message. deflateInit does not - perform any compression: this will be done by deflate(). -*/ - - -ZEXTERN int ZEXPORT deflate OF((z_streamp strm, int flush)); -/* - deflate compresses as much data as possible, and stops when the input - buffer becomes empty or the output buffer becomes full. It may introduce some - output latency (reading input without producing any output) except when - forced to flush. - - The detailed semantics are as follows. deflate performs one or both of the - following actions: - - - Compress more input starting at next_in and update next_in and avail_in - accordingly. If not all input can be processed (because there is not - enough room in the output buffer), next_in and avail_in are updated and - processing will resume at this point for the next call of deflate(). - - - Provide more output starting at next_out and update next_out and avail_out - accordingly. This action is forced if the parameter flush is non zero. - Forcing flush frequently degrades the compression ratio, so this parameter - should be set only when necessary (in interactive applications). - Some output may be provided even if flush is not set. - - Before the call of deflate(), the application should ensure that at least - one of the actions is possible, by providing more input and/or consuming - more output, and updating avail_in or avail_out accordingly; avail_out - should never be zero before the call. The application can consume the - compressed output when it wants, for example when the output buffer is full - (avail_out == 0), or after each call of deflate(). If deflate returns Z_OK - and with zero avail_out, it must be called again after making room in the - output buffer because there might be more output pending. - - Normally the parameter flush is set to Z_NO_FLUSH, which allows deflate to - decide how much data to accumualte before producing output, in order to - maximize compression. - - If the parameter flush is set to Z_SYNC_FLUSH, all pending output is - flushed to the output buffer and the output is aligned on a byte boundary, so - that the decompressor can get all input data available so far. (In particular - avail_in is zero after the call if enough output space has been provided - before the call.) Flushing may degrade compression for some compression - algorithms and so it should be used only when necessary. - - If flush is set to Z_FULL_FLUSH, all output is flushed as with - Z_SYNC_FLUSH, and the compression state is reset so that decompression can - restart from this point if previous compressed data has been damaged or if - random access is desired. Using Z_FULL_FLUSH too often can seriously degrade - compression. - - If deflate returns with avail_out == 0, this function must be called again - with the same value of the flush parameter and more output space (updated - avail_out), until the flush is complete (deflate returns with non-zero - avail_out). In the case of a Z_FULL_FLUSH or Z_SYNC_FLUSH, make sure that - avail_out is greater than six to avoid repeated flush markers due to - avail_out == 0 on return. - - If the parameter flush is set to Z_FINISH, pending input is processed, - pending output is flushed and deflate returns with Z_STREAM_END if there - was enough output space; if deflate returns with Z_OK, this function must be - called again with Z_FINISH and more output space (updated avail_out) but no - more input data, until it returns with Z_STREAM_END or an error. After - deflate has returned Z_STREAM_END, the only possible operations on the - stream are deflateReset or deflateEnd. - - Z_FINISH can be used immediately after deflateInit if all the compression - is to be done in a single step. In this case, avail_out must be at least - the value returned by deflateBound (see below). If deflate does not return - Z_STREAM_END, then it must be called again as described above. - - deflate() sets strm->adler to the adler32 checksum of all input read - so far (that is, total_in bytes). - - deflate() may update strm->data_type if it can make a good guess about - the input data type (Z_BINARY or Z_TEXT). In doubt, the data is considered - binary. This field is only for information purposes and does not affect - the compression algorithm in any manner. - - deflate() returns Z_OK if some progress has been made (more input - processed or more output produced), Z_STREAM_END if all input has been - consumed and all output has been produced (only when flush is set to - Z_FINISH), Z_STREAM_ERROR if the stream state was inconsistent (for example - if next_in or next_out was NULL), Z_BUF_ERROR if no progress is possible - (for example avail_in or avail_out was zero). Note that Z_BUF_ERROR is not - fatal, and deflate() can be called again with more input and more output - space to continue compressing. -*/ - - -ZEXTERN int ZEXPORT deflateEnd OF((z_streamp strm)); -/* - All dynamically allocated data structures for this stream are freed. - This function discards any unprocessed input and does not flush any - pending output. - - deflateEnd returns Z_OK if success, Z_STREAM_ERROR if the - stream state was inconsistent, Z_DATA_ERROR if the stream was freed - prematurely (some input or output was discarded). In the error case, - msg may be set but then points to a static string (which must not be - deallocated). -*/ - - -/* -ZEXTERN int ZEXPORT inflateInit OF((z_streamp strm)); - - Initializes the internal stream state for decompression. The fields - next_in, avail_in, zalloc, zfree and opaque must be initialized before by - the caller. If next_in is not Z_NULL and avail_in is large enough (the exact - value depends on the compression method), inflateInit determines the - compression method from the zlib header and allocates all data structures - accordingly; otherwise the allocation will be deferred to the first call of - inflate. If zalloc and zfree are set to Z_NULL, inflateInit updates them to - use default allocation functions. - - inflateInit returns Z_OK if success, Z_MEM_ERROR if there was not enough - memory, Z_VERSION_ERROR if the zlib library version is incompatible with the - version assumed by the caller. msg is set to null if there is no error - message. inflateInit does not perform any decompression apart from reading - the zlib header if present: this will be done by inflate(). (So next_in and - avail_in may be modified, but next_out and avail_out are unchanged.) -*/ - - -ZEXTERN int ZEXPORT inflate OF((z_streamp strm, int flush)); -/* - inflate decompresses as much data as possible, and stops when the input - buffer becomes empty or the output buffer becomes full. It may introduce - some output latency (reading input without producing any output) except when - forced to flush. - - The detailed semantics are as follows. inflate performs one or both of the - following actions: - - - Decompress more input starting at next_in and update next_in and avail_in - accordingly. If not all input can be processed (because there is not - enough room in the output buffer), next_in is updated and processing - will resume at this point for the next call of inflate(). - - - Provide more output starting at next_out and update next_out and avail_out - accordingly. inflate() provides as much output as possible, until there - is no more input data or no more space in the output buffer (see below - about the flush parameter). - - Before the call of inflate(), the application should ensure that at least - one of the actions is possible, by providing more input and/or consuming - more output, and updating the next_* and avail_* values accordingly. - The application can consume the uncompressed output when it wants, for - example when the output buffer is full (avail_out == 0), or after each - call of inflate(). If inflate returns Z_OK and with zero avail_out, it - must be called again after making room in the output buffer because there - might be more output pending. - - The flush parameter of inflate() can be Z_NO_FLUSH, Z_SYNC_FLUSH, - Z_FINISH, or Z_BLOCK. Z_SYNC_FLUSH requests that inflate() flush as much - output as possible to the output buffer. Z_BLOCK requests that inflate() stop - if and when it gets to the next deflate block boundary. When decoding the - zlib or gzip format, this will cause inflate() to return immediately after - the header and before the first block. When doing a raw inflate, inflate() - will go ahead and process the first block, and will return when it gets to - the end of that block, or when it runs out of data. - - The Z_BLOCK option assists in appending to or combining deflate streams. - Also to assist in this, on return inflate() will set strm->data_type to the - number of unused bits in the last byte taken from strm->next_in, plus 64 - if inflate() is currently decoding the last block in the deflate stream, - plus 128 if inflate() returned immediately after decoding an end-of-block - code or decoding the complete header up to just before the first byte of the - deflate stream. The end-of-block will not be indicated until all of the - uncompressed data from that block has been written to strm->next_out. The - number of unused bits may in general be greater than seven, except when - bit 7 of data_type is set, in which case the number of unused bits will be - less than eight. - - inflate() should normally be called until it returns Z_STREAM_END or an - error. However if all decompression is to be performed in a single step - (a single call of inflate), the parameter flush should be set to - Z_FINISH. In this case all pending input is processed and all pending - output is flushed; avail_out must be large enough to hold all the - uncompressed data. (The size of the uncompressed data may have been saved - by the compressor for this purpose.) The next operation on this stream must - be inflateEnd to deallocate the decompression state. The use of Z_FINISH - is never required, but can be used to inform inflate that a faster approach - may be used for the single inflate() call. - - In this implementation, inflate() always flushes as much output as - possible to the output buffer, and always uses the faster approach on the - first call. So the only effect of the flush parameter in this implementation - is on the return value of inflate(), as noted below, or when it returns early - because Z_BLOCK is used. - - If a preset dictionary is needed after this call (see inflateSetDictionary - below), inflate sets strm->adler to the adler32 checksum of the dictionary - chosen by the compressor and returns Z_NEED_DICT; otherwise it sets - strm->adler to the adler32 checksum of all output produced so far (that is, - total_out bytes) and returns Z_OK, Z_STREAM_END or an error code as described - below. At the end of the stream, inflate() checks that its computed adler32 - checksum is equal to that saved by the compressor and returns Z_STREAM_END - only if the checksum is correct. - - inflate() will decompress and check either zlib-wrapped or gzip-wrapped - deflate data. The header type is detected automatically. Any information - contained in the gzip header is not retained, so applications that need that - information should instead use raw inflate, see inflateInit2() below, or - inflateBack() and perform their own processing of the gzip header and - trailer. - - inflate() returns Z_OK if some progress has been made (more input processed - or more output produced), Z_STREAM_END if the end of the compressed data has - been reached and all uncompressed output has been produced, Z_NEED_DICT if a - preset dictionary is needed at this point, Z_DATA_ERROR if the input data was - corrupted (input stream not conforming to the zlib format or incorrect check - value), Z_STREAM_ERROR if the stream structure was inconsistent (for example - if next_in or next_out was NULL), Z_MEM_ERROR if there was not enough memory, - Z_BUF_ERROR if no progress is possible or if there was not enough room in the - output buffer when Z_FINISH is used. Note that Z_BUF_ERROR is not fatal, and - inflate() can be called again with more input and more output space to - continue decompressing. If Z_DATA_ERROR is returned, the application may then - call inflateSync() to look for a good compression block if a partial recovery - of the data is desired. -*/ - - -ZEXTERN int ZEXPORT inflateEnd OF((z_streamp strm)); -/* - All dynamically allocated data structures for this stream are freed. - This function discards any unprocessed input and does not flush any - pending output. - - inflateEnd returns Z_OK if success, Z_STREAM_ERROR if the stream state - was inconsistent. In the error case, msg may be set but then points to a - static string (which must not be deallocated). -*/ - - /* Advanced functions */ - -/* - The following functions are needed only in some special applications. -*/ - -/* -ZEXTERN int ZEXPORT deflateInit2 OF((z_streamp strm, - int level, - int method, - int windowBits, - int memLevel, - int strategy)); - - This is another version of deflateInit with more compression options. The - fields next_in, zalloc, zfree and opaque must be initialized before by - the caller. - - The method parameter is the compression method. It must be Z_DEFLATED in - this version of the library. - - The windowBits parameter is the base two logarithm of the window size - (the size of the history buffer). It should be in the range 8..15 for this - version of the library. Larger values of this parameter result in better - compression at the expense of memory usage. The default value is 15 if - deflateInit is used instead. - - windowBits can also be -8..-15 for raw deflate. In this case, -windowBits - determines the window size. deflate() will then generate raw deflate data - with no zlib header or trailer, and will not compute an adler32 check value. - - windowBits can also be greater than 15 for optional gzip encoding. Add - 16 to windowBits to write a simple gzip header and trailer around the - compressed data instead of a zlib wrapper. The gzip header will have no - file name, no extra data, no comment, no modification time (set to zero), - no header crc, and the operating system will be set to 255 (unknown). If a - gzip stream is being written, strm->adler is a crc32 instead of an adler32. - - The memLevel parameter specifies how much memory should be allocated - for the internal compression state. memLevel=1 uses minimum memory but - is slow and reduces compression ratio; memLevel=9 uses maximum memory - for optimal speed. The default value is 8. See zconf.h for total memory - usage as a function of windowBits and memLevel. - - The strategy parameter is used to tune the compression algorithm. Use the - value Z_DEFAULT_STRATEGY for normal data, Z_FILTERED for data produced by a - filter (or predictor), Z_HUFFMAN_ONLY to force Huffman encoding only (no - string match), or Z_RLE to limit match distances to one (run-length - encoding). Filtered data consists mostly of small values with a somewhat - random distribution. In this case, the compression algorithm is tuned to - compress them better. The effect of Z_FILTERED is to force more Huffman - coding and less string matching; it is somewhat intermediate between - Z_DEFAULT and Z_HUFFMAN_ONLY. Z_RLE is designed to be almost as fast as - Z_HUFFMAN_ONLY, but give better compression for PNG image data. The strategy - parameter only affects the compression ratio but not the correctness of the - compressed output even if it is not set appropriately. Z_FIXED prevents the - use of dynamic Huffman codes, allowing for a simpler decoder for special - applications. - - deflateInit2 returns Z_OK if success, Z_MEM_ERROR if there was not enough - memory, Z_STREAM_ERROR if a parameter is invalid (such as an invalid - method). msg is set to null if there is no error message. deflateInit2 does - not perform any compression: this will be done by deflate(). -*/ - -ZEXTERN int ZEXPORT deflateSetDictionary OF((z_streamp strm, - const Bytef *dictionary, - uInt dictLength)); -/* - Initializes the compression dictionary from the given byte sequence - without producing any compressed output. This function must be called - immediately after deflateInit, deflateInit2 or deflateReset, before any - call of deflate. The compressor and decompressor must use exactly the same - dictionary (see inflateSetDictionary). - - The dictionary should consist of strings (byte sequences) that are likely - to be encountered later in the data to be compressed, with the most commonly - used strings preferably put towards the end of the dictionary. Using a - dictionary is most useful when the data to be compressed is short and can be - predicted with good accuracy; the data can then be compressed better than - with the default empty dictionary. - - Depending on the size of the compression data structures selected by - deflateInit or deflateInit2, a part of the dictionary may in effect be - discarded, for example if the dictionary is larger than the window size in - deflate or deflate2. Thus the strings most likely to be useful should be - put at the end of the dictionary, not at the front. In addition, the - current implementation of deflate will use at most the window size minus - 262 bytes of the provided dictionary. - - Upon return of this function, strm->adler is set to the adler32 value - of the dictionary; the decompressor may later use this value to determine - which dictionary has been used by the compressor. (The adler32 value - applies to the whole dictionary even if only a subset of the dictionary is - actually used by the compressor.) If a raw deflate was requested, then the - adler32 value is not computed and strm->adler is not set. - - deflateSetDictionary returns Z_OK if success, or Z_STREAM_ERROR if a - parameter is invalid (such as NULL dictionary) or the stream state is - inconsistent (for example if deflate has already been called for this stream - or if the compression method is bsort). deflateSetDictionary does not - perform any compression: this will be done by deflate(). -*/ - -ZEXTERN int ZEXPORT deflateCopy OF((z_streamp dest, - z_streamp source)); -/* - Sets the destination stream as a complete copy of the source stream. - - This function can be useful when several compression strategies will be - tried, for example when there are several ways of pre-processing the input - data with a filter. The streams that will be discarded should then be freed - by calling deflateEnd. Note that deflateCopy duplicates the internal - compression state which can be quite large, so this strategy is slow and - can consume lots of memory. - - deflateCopy returns Z_OK if success, Z_MEM_ERROR if there was not - enough memory, Z_STREAM_ERROR if the source stream state was inconsistent - (such as zalloc being NULL). msg is left unchanged in both source and - destination. -*/ - -ZEXTERN int ZEXPORT deflateReset OF((z_streamp strm)); -/* - This function is equivalent to deflateEnd followed by deflateInit, - but does not free and reallocate all the internal compression state. - The stream will keep the same compression level and any other attributes - that may have been set by deflateInit2. - - deflateReset returns Z_OK if success, or Z_STREAM_ERROR if the source - stream state was inconsistent (such as zalloc or state being NULL). -*/ - -ZEXTERN int ZEXPORT deflateParams OF((z_streamp strm, - int level, - int strategy)); -/* - Dynamically update the compression level and compression strategy. The - interpretation of level and strategy is as in deflateInit2. This can be - used to switch between compression and straight copy of the input data, or - to switch to a different kind of input data requiring a different - strategy. If the compression level is changed, the input available so far - is compressed with the old level (and may be flushed); the new level will - take effect only at the next call of deflate(). - - Before the call of deflateParams, the stream state must be set as for - a call of deflate(), since the currently available input may have to - be compressed and flushed. In particular, strm->avail_out must be non-zero. - - deflateParams returns Z_OK if success, Z_STREAM_ERROR if the source - stream state was inconsistent or if a parameter was invalid, Z_BUF_ERROR - if strm->avail_out was zero. -*/ - -ZEXTERN int ZEXPORT deflateTune OF((z_streamp strm, - int good_length, - int max_lazy, - int nice_length, - int max_chain)); -/* - Fine tune deflate's internal compression parameters. This should only be - used by someone who understands the algorithm used by zlib's deflate for - searching for the best matching string, and even then only by the most - fanatic optimizer trying to squeeze out the last compressed bit for their - specific input data. Read the deflate.c source code for the meaning of the - max_lazy, good_length, nice_length, and max_chain parameters. - - deflateTune() can be called after deflateInit() or deflateInit2(), and - returns Z_OK on success, or Z_STREAM_ERROR for an invalid deflate stream. - */ - -ZEXTERN uLong ZEXPORT deflateBound OF((z_streamp strm, - uLong sourceLen)); -/* - deflateBound() returns an upper bound on the compressed size after - deflation of sourceLen bytes. It must be called after deflateInit() - or deflateInit2(). This would be used to allocate an output buffer - for deflation in a single pass, and so would be called before deflate(). -*/ - -ZEXTERN int ZEXPORT deflatePrime OF((z_streamp strm, - int bits, - int value)); -/* - deflatePrime() inserts bits in the deflate output stream. The intent - is that this function is used to start off the deflate output with the - bits leftover from a previous deflate stream when appending to it. As such, - this function can only be used for raw deflate, and must be used before the - first deflate() call after a deflateInit2() or deflateReset(). bits must be - less than or equal to 16, and that many of the least significant bits of - value will be inserted in the output. - - deflatePrime returns Z_OK if success, or Z_STREAM_ERROR if the source - stream state was inconsistent. -*/ - -ZEXTERN int ZEXPORT deflateSetHeader OF((z_streamp strm, - gz_headerp head)); -/* - deflateSetHeader() provides gzip header information for when a gzip - stream is requested by deflateInit2(). deflateSetHeader() may be called - after deflateInit2() or deflateReset() and before the first call of - deflate(). The text, time, os, extra field, name, and comment information - in the provided gz_header structure are written to the gzip header (xflag is - ignored -- the extra flags are set according to the compression level). The - caller must assure that, if not Z_NULL, name and comment are terminated with - a zero byte, and that if extra is not Z_NULL, that extra_len bytes are - available there. If hcrc is true, a gzip header crc is included. Note that - the current versions of the command-line version of gzip (up through version - 1.3.x) do not support header crc's, and will report that it is a "multi-part - gzip file" and give up. - - If deflateSetHeader is not used, the default gzip header has text false, - the time set to zero, and os set to 255, with no extra, name, or comment - fields. The gzip header is returned to the default state by deflateReset(). - - deflateSetHeader returns Z_OK if success, or Z_STREAM_ERROR if the source - stream state was inconsistent. -*/ - -/* -ZEXTERN int ZEXPORT inflateInit2 OF((z_streamp strm, - int windowBits)); - - This is another version of inflateInit with an extra parameter. The - fields next_in, avail_in, zalloc, zfree and opaque must be initialized - before by the caller. - - The windowBits parameter is the base two logarithm of the maximum window - size (the size of the history buffer). It should be in the range 8..15 for - this version of the library. The default value is 15 if inflateInit is used - instead. windowBits must be greater than or equal to the windowBits value - provided to deflateInit2() while compressing, or it must be equal to 15 if - deflateInit2() was not used. If a compressed stream with a larger window - size is given as input, inflate() will return with the error code - Z_DATA_ERROR instead of trying to allocate a larger window. - - windowBits can also be -8..-15 for raw inflate. In this case, -windowBits - determines the window size. inflate() will then process raw deflate data, - not looking for a zlib or gzip header, not generating a check value, and not - looking for any check values for comparison at the end of the stream. This - is for use with other formats that use the deflate compressed data format - such as zip. Those formats provide their own check values. If a custom - format is developed using the raw deflate format for compressed data, it is - recommended that a check value such as an adler32 or a crc32 be applied to - the uncompressed data as is done in the zlib, gzip, and zip formats. For - most applications, the zlib format should be used as is. Note that comments - above on the use in deflateInit2() applies to the magnitude of windowBits. - - windowBits can also be greater than 15 for optional gzip decoding. Add - 32 to windowBits to enable zlib and gzip decoding with automatic header - detection, or add 16 to decode only the gzip format (the zlib format will - return a Z_DATA_ERROR). If a gzip stream is being decoded, strm->adler is - a crc32 instead of an adler32. - - inflateInit2 returns Z_OK if success, Z_MEM_ERROR if there was not enough - memory, Z_STREAM_ERROR if a parameter is invalid (such as a null strm). msg - is set to null if there is no error message. inflateInit2 does not perform - any decompression apart from reading the zlib header if present: this will - be done by inflate(). (So next_in and avail_in may be modified, but next_out - and avail_out are unchanged.) -*/ - -ZEXTERN int ZEXPORT inflateSetDictionary OF((z_streamp strm, - const Bytef *dictionary, - uInt dictLength)); -/* - Initializes the decompression dictionary from the given uncompressed byte - sequence. This function must be called immediately after a call of inflate, - if that call returned Z_NEED_DICT. The dictionary chosen by the compressor - can be determined from the adler32 value returned by that call of inflate. - The compressor and decompressor must use exactly the same dictionary (see - deflateSetDictionary). For raw inflate, this function can be called - immediately after inflateInit2() or inflateReset() and before any call of - inflate() to set the dictionary. The application must insure that the - dictionary that was used for compression is provided. - - inflateSetDictionary returns Z_OK if success, Z_STREAM_ERROR if a - parameter is invalid (such as NULL dictionary) or the stream state is - inconsistent, Z_DATA_ERROR if the given dictionary doesn't match the - expected one (incorrect adler32 value). inflateSetDictionary does not - perform any decompression: this will be done by subsequent calls of - inflate(). -*/ - -ZEXTERN int ZEXPORT inflateSync OF((z_streamp strm)); -/* - Skips invalid compressed data until a full flush point (see above the - description of deflate with Z_FULL_FLUSH) can be found, or until all - available input is skipped. No output is provided. - - inflateSync returns Z_OK if a full flush point has been found, Z_BUF_ERROR - if no more input was provided, Z_DATA_ERROR if no flush point has been found, - or Z_STREAM_ERROR if the stream structure was inconsistent. In the success - case, the application may save the current current value of total_in which - indicates where valid compressed data was found. In the error case, the - application may repeatedly call inflateSync, providing more input each time, - until success or end of the input data. -*/ - -ZEXTERN int ZEXPORT inflateCopy OF((z_streamp dest, - z_streamp source)); -/* - Sets the destination stream as a complete copy of the source stream. - - This function can be useful when randomly accessing a large stream. The - first pass through the stream can periodically record the inflate state, - allowing restarting inflate at those points when randomly accessing the - stream. - - inflateCopy returns Z_OK if success, Z_MEM_ERROR if there was not - enough memory, Z_STREAM_ERROR if the source stream state was inconsistent - (such as zalloc being NULL). msg is left unchanged in both source and - destination. -*/ - -ZEXTERN int ZEXPORT inflateReset OF((z_streamp strm)); -/* - This function is equivalent to inflateEnd followed by inflateInit, - but does not free and reallocate all the internal decompression state. - The stream will keep attributes that may have been set by inflateInit2. - - inflateReset returns Z_OK if success, or Z_STREAM_ERROR if the source - stream state was inconsistent (such as zalloc or state being NULL). -*/ - -ZEXTERN int ZEXPORT inflatePrime OF((z_streamp strm, - int bits, - int value)); -/* - This function inserts bits in the inflate input stream. The intent is - that this function is used to start inflating at a bit position in the - middle of a byte. The provided bits will be used before any bytes are used - from next_in. This function should only be used with raw inflate, and - should be used before the first inflate() call after inflateInit2() or - inflateReset(). bits must be less than or equal to 16, and that many of the - least significant bits of value will be inserted in the input. - - inflatePrime returns Z_OK if success, or Z_STREAM_ERROR if the source - stream state was inconsistent. -*/ - -ZEXTERN int ZEXPORT inflateGetHeader OF((z_streamp strm, - gz_headerp head)); -/* - inflateGetHeader() requests that gzip header information be stored in the - provided gz_header structure. inflateGetHeader() may be called after - inflateInit2() or inflateReset(), and before the first call of inflate(). - As inflate() processes the gzip stream, head->done is zero until the header - is completed, at which time head->done is set to one. If a zlib stream is - being decoded, then head->done is set to -1 to indicate that there will be - no gzip header information forthcoming. Note that Z_BLOCK can be used to - force inflate() to return immediately after header processing is complete - and before any actual data is decompressed. - - The text, time, xflags, and os fields are filled in with the gzip header - contents. hcrc is set to true if there is a header CRC. (The header CRC - was valid if done is set to one.) If extra is not Z_NULL, then extra_max - contains the maximum number of bytes to write to extra. Once done is true, - extra_len contains the actual extra field length, and extra contains the - extra field, or that field truncated if extra_max is less than extra_len. - If name is not Z_NULL, then up to name_max characters are written there, - terminated with a zero unless the length is greater than name_max. If - comment is not Z_NULL, then up to comm_max characters are written there, - terminated with a zero unless the length is greater than comm_max. When - any of extra, name, or comment are not Z_NULL and the respective field is - not present in the header, then that field is set to Z_NULL to signal its - absence. This allows the use of deflateSetHeader() with the returned - structure to duplicate the header. However if those fields are set to - allocated memory, then the application will need to save those pointers - elsewhere so that they can be eventually freed. - - If inflateGetHeader is not used, then the header information is simply - discarded. The header is always checked for validity, including the header - CRC if present. inflateReset() will reset the process to discard the header - information. The application would need to call inflateGetHeader() again to - retrieve the header from the next gzip stream. - - inflateGetHeader returns Z_OK if success, or Z_STREAM_ERROR if the source - stream state was inconsistent. -*/ - -/* -ZEXTERN int ZEXPORT inflateBackInit OF((z_streamp strm, int windowBits, - unsigned char FAR *window)); - - Initialize the internal stream state for decompression using inflateBack() - calls. The fields zalloc, zfree and opaque in strm must be initialized - before the call. If zalloc and zfree are Z_NULL, then the default library- - derived memory allocation routines are used. windowBits is the base two - logarithm of the window size, in the range 8..15. window is a caller - supplied buffer of that size. Except for special applications where it is - assured that deflate was used with small window sizes, windowBits must be 15 - and a 32K byte window must be supplied to be able to decompress general - deflate streams. - - See inflateBack() for the usage of these routines. - - inflateBackInit will return Z_OK on success, Z_STREAM_ERROR if any of - the paramaters are invalid, Z_MEM_ERROR if the internal state could not - be allocated, or Z_VERSION_ERROR if the version of the library does not - match the version of the header file. -*/ - -typedef unsigned (*in_func) OF((void FAR *, unsigned char FAR * FAR *)); -typedef int (*out_func) OF((void FAR *, unsigned char FAR *, unsigned)); - -ZEXTERN int ZEXPORT inflateBack OF((z_streamp strm, - in_func in, void FAR *in_desc, - out_func out, void FAR *out_desc)); -/* - inflateBack() does a raw inflate with a single call using a call-back - interface for input and output. This is more efficient than inflate() for - file i/o applications in that it avoids copying between the output and the - sliding window by simply making the window itself the output buffer. This - function trusts the application to not change the output buffer passed by - the output function, at least until inflateBack() returns. - - inflateBackInit() must be called first to allocate the internal state - and to initialize the state with the user-provided window buffer. - inflateBack() may then be used multiple times to inflate a complete, raw - deflate stream with each call. inflateBackEnd() is then called to free - the allocated state. - - A raw deflate stream is one with no zlib or gzip header or trailer. - This routine would normally be used in a utility that reads zip or gzip - files and writes out uncompressed files. The utility would decode the - header and process the trailer on its own, hence this routine expects - only the raw deflate stream to decompress. This is different from the - normal behavior of inflate(), which expects either a zlib or gzip header and - trailer around the deflate stream. - - inflateBack() uses two subroutines supplied by the caller that are then - called by inflateBack() for input and output. inflateBack() calls those - routines until it reads a complete deflate stream and writes out all of the - uncompressed data, or until it encounters an error. The function's - parameters and return types are defined above in the in_func and out_func - typedefs. inflateBack() will call in(in_desc, &buf) which should return the - number of bytes of provided input, and a pointer to that input in buf. If - there is no input available, in() must return zero--buf is ignored in that - case--and inflateBack() will return a buffer error. inflateBack() will call - out(out_desc, buf, len) to write the uncompressed data buf[0..len-1]. out() - should return zero on success, or non-zero on failure. If out() returns - non-zero, inflateBack() will return with an error. Neither in() nor out() - are permitted to change the contents of the window provided to - inflateBackInit(), which is also the buffer that out() uses to write from. - The length written by out() will be at most the window size. Any non-zero - amount of input may be provided by in(). - - For convenience, inflateBack() can be provided input on the first call by - setting strm->next_in and strm->avail_in. If that input is exhausted, then - in() will be called. Therefore strm->next_in must be initialized before - calling inflateBack(). If strm->next_in is Z_NULL, then in() will be called - immediately for input. If strm->next_in is not Z_NULL, then strm->avail_in - must also be initialized, and then if strm->avail_in is not zero, input will - initially be taken from strm->next_in[0 .. strm->avail_in - 1]. - - The in_desc and out_desc parameters of inflateBack() is passed as the - first parameter of in() and out() respectively when they are called. These - descriptors can be optionally used to pass any information that the caller- - supplied in() and out() functions need to do their job. - - On return, inflateBack() will set strm->next_in and strm->avail_in to - pass back any unused input that was provided by the last in() call. The - return values of inflateBack() can be Z_STREAM_END on success, Z_BUF_ERROR - if in() or out() returned an error, Z_DATA_ERROR if there was a format - error in the deflate stream (in which case strm->msg is set to indicate the - nature of the error), or Z_STREAM_ERROR if the stream was not properly - initialized. In the case of Z_BUF_ERROR, an input or output error can be - distinguished using strm->next_in which will be Z_NULL only if in() returned - an error. If strm->next is not Z_NULL, then the Z_BUF_ERROR was due to - out() returning non-zero. (in() will always be called before out(), so - strm->next_in is assured to be defined if out() returns non-zero.) Note - that inflateBack() cannot return Z_OK. -*/ - -ZEXTERN int ZEXPORT inflateBackEnd OF((z_streamp strm)); -/* - All memory allocated by inflateBackInit() is freed. - - inflateBackEnd() returns Z_OK on success, or Z_STREAM_ERROR if the stream - state was inconsistent. -*/ - -ZEXTERN uLong ZEXPORT zlibCompileFlags OF((void)); -/* Return flags indicating compile-time options. - - Type sizes, two bits each, 00 = 16 bits, 01 = 32, 10 = 64, 11 = other: - 1.0: size of uInt - 3.2: size of uLong - 5.4: size of voidpf (pointer) - 7.6: size of z_off_t - - Compiler, assembler, and debug options: - 8: DEBUG - 9: ASMV or ASMINF -- use ASM code - 10: ZLIB_WINAPI -- exported functions use the WINAPI calling convention - 11: 0 (reserved) - - One-time table building (smaller code, but not thread-safe if true): - 12: BUILDFIXED -- build static block decoding tables when needed - 13: DYNAMIC_CRC_TABLE -- build CRC calculation tables when needed - 14,15: 0 (reserved) - - Library content (indicates missing functionality): - 16: NO_GZCOMPRESS -- gz* functions cannot compress (to avoid linking - deflate code when not needed) - 17: NO_GZIP -- deflate can't write gzip streams, and inflate can't detect - and decode gzip streams (to avoid linking crc code) - 18-19: 0 (reserved) - - Operation variations (changes in library functionality): - 20: PKZIP_BUG_WORKAROUND -- slightly more permissive inflate - 21: FASTEST -- deflate algorithm with only one, lowest compression level - 22,23: 0 (reserved) - - The sprintf variant used by gzprintf (zero is best): - 24: 0 = vs*, 1 = s* -- 1 means limited to 20 arguments after the format - 25: 0 = *nprintf, 1 = *printf -- 1 means gzprintf() not secure! - 26: 0 = returns value, 1 = void -- 1 means inferred string length returned - - Remainder: - 27-31: 0 (reserved) - */ - - - /* utility functions */ - -/* - The following utility functions are implemented on top of the - basic stream-oriented functions. To simplify the interface, some - default options are assumed (compression level and memory usage, - standard memory allocation functions). The source code of these - utility functions can easily be modified if you need special options. -*/ - -ZEXTERN int ZEXPORT compress OF((Bytef *dest, uLongf *destLen, - const Bytef *source, uLong sourceLen)); -/* - Compresses the source buffer into the destination buffer. sourceLen is - the byte length of the source buffer. Upon entry, destLen is the total - size of the destination buffer, which must be at least the value returned - by compressBound(sourceLen). Upon exit, destLen is the actual size of the - compressed buffer. - This function can be used to compress a whole file at once if the - input file is mmap'ed. - compress returns Z_OK if success, Z_MEM_ERROR if there was not - enough memory, Z_BUF_ERROR if there was not enough room in the output - buffer. -*/ - -ZEXTERN int ZEXPORT compress2 OF((Bytef *dest, uLongf *destLen, - const Bytef *source, uLong sourceLen, - int level)); -/* - Compresses the source buffer into the destination buffer. The level - parameter has the same meaning as in deflateInit. sourceLen is the byte - length of the source buffer. Upon entry, destLen is the total size of the - destination buffer, which must be at least the value returned by - compressBound(sourceLen). Upon exit, destLen is the actual size of the - compressed buffer. - - compress2 returns Z_OK if success, Z_MEM_ERROR if there was not enough - memory, Z_BUF_ERROR if there was not enough room in the output buffer, - Z_STREAM_ERROR if the level parameter is invalid. -*/ - -ZEXTERN uLong ZEXPORT compressBound OF((uLong sourceLen)); -/* - compressBound() returns an upper bound on the compressed size after - compress() or compress2() on sourceLen bytes. It would be used before - a compress() or compress2() call to allocate the destination buffer. -*/ - -ZEXTERN int ZEXPORT uncompress OF((Bytef *dest, uLongf *destLen, - const Bytef *source, uLong sourceLen)); -/* - Decompresses the source buffer into the destination buffer. sourceLen is - the byte length of the source buffer. Upon entry, destLen is the total - size of the destination buffer, which must be large enough to hold the - entire uncompressed data. (The size of the uncompressed data must have - been saved previously by the compressor and transmitted to the decompressor - by some mechanism outside the scope of this compression library.) - Upon exit, destLen is the actual size of the compressed buffer. - This function can be used to decompress a whole file at once if the - input file is mmap'ed. - - uncompress returns Z_OK if success, Z_MEM_ERROR if there was not - enough memory, Z_BUF_ERROR if there was not enough room in the output - buffer, or Z_DATA_ERROR if the input data was corrupted or incomplete. -*/ - - -typedef voidp gzFile; - -ZEXTERN gzFile ZEXPORT gzopen OF((const char *path, const char *mode)); -/* - Opens a gzip (.gz) file for reading or writing. The mode parameter - is as in fopen ("rb" or "wb") but can also include a compression level - ("wb9") or a strategy: 'f' for filtered data as in "wb6f", 'h' for - Huffman only compression as in "wb1h", or 'R' for run-length encoding - as in "wb1R". (See the description of deflateInit2 for more information - about the strategy parameter.) - - gzopen can be used to read a file which is not in gzip format; in this - case gzread will directly read from the file without decompression. - - gzopen returns NULL if the file could not be opened or if there was - insufficient memory to allocate the (de)compression state; errno - can be checked to distinguish the two cases (if errno is zero, the - zlib error is Z_MEM_ERROR). */ - -ZEXTERN gzFile ZEXPORT gzdopen OF((int fd, const char *mode)); -/* - gzdopen() associates a gzFile with the file descriptor fd. File - descriptors are obtained from calls like open, dup, creat, pipe or - fileno (in the file has been previously opened with fopen). - The mode parameter is as in gzopen. - The next call of gzclose on the returned gzFile will also close the - file descriptor fd, just like fclose(fdopen(fd), mode) closes the file - descriptor fd. If you want to keep fd open, use gzdopen(dup(fd), mode). - gzdopen returns NULL if there was insufficient memory to allocate - the (de)compression state. -*/ - -ZEXTERN int ZEXPORT gzsetparams OF((gzFile file, int level, int strategy)); -/* - Dynamically update the compression level or strategy. See the description - of deflateInit2 for the meaning of these parameters. - gzsetparams returns Z_OK if success, or Z_STREAM_ERROR if the file was not - opened for writing. -*/ - -ZEXTERN int ZEXPORT gzread OF((gzFile file, voidp buf, unsigned len)); -/* - Reads the given number of uncompressed bytes from the compressed file. - If the input file was not in gzip format, gzread copies the given number - of bytes into the buffer. - gzread returns the number of uncompressed bytes actually read (0 for - end of file, -1 for error). */ - -ZEXTERN int ZEXPORT gzwrite OF((gzFile file, - voidpc buf, unsigned len)); -/* - Writes the given number of uncompressed bytes into the compressed file. - gzwrite returns the number of uncompressed bytes actually written - (0 in case of error). -*/ - -ZEXTERN int ZEXPORTVA gzprintf OF((gzFile file, const char *format, ...)); -/* - Converts, formats, and writes the args to the compressed file under - control of the format string, as in fprintf. gzprintf returns the number of - uncompressed bytes actually written (0 in case of error). The number of - uncompressed bytes written is limited to 4095. The caller should assure that - this limit is not exceeded. If it is exceeded, then gzprintf() will return - return an error (0) with nothing written. In this case, there may also be a - buffer overflow with unpredictable consequences, which is possible only if - zlib was compiled with the insecure functions sprintf() or vsprintf() - because the secure snprintf() or vsnprintf() functions were not available. -*/ - -ZEXTERN int ZEXPORT gzputs OF((gzFile file, const char *s)); -/* - Writes the given null-terminated string to the compressed file, excluding - the terminating null character. - gzputs returns the number of characters written, or -1 in case of error. -*/ - -ZEXTERN char * ZEXPORT gzgets OF((gzFile file, char *buf, int len)); -/* - Reads bytes from the compressed file until len-1 characters are read, or - a newline character is read and transferred to buf, or an end-of-file - condition is encountered. The string is then terminated with a null - character. - gzgets returns buf, or Z_NULL in case of error. -*/ - -ZEXTERN int ZEXPORT gzputc OF((gzFile file, int c)); -/* - Writes c, converted to an unsigned char, into the compressed file. - gzputc returns the value that was written, or -1 in case of error. -*/ - -ZEXTERN int ZEXPORT gzgetc OF((gzFile file)); -/* - Reads one byte from the compressed file. gzgetc returns this byte - or -1 in case of end of file or error. -*/ - -ZEXTERN int ZEXPORT gzungetc OF((int c, gzFile file)); -/* - Push one character back onto the stream to be read again later. - Only one character of push-back is allowed. gzungetc() returns the - character pushed, or -1 on failure. gzungetc() will fail if a - character has been pushed but not read yet, or if c is -1. The pushed - character will be discarded if the stream is repositioned with gzseek() - or gzrewind(). -*/ - -ZEXTERN int ZEXPORT gzflush OF((gzFile file, int flush)); -/* - Flushes all pending output into the compressed file. The parameter - flush is as in the deflate() function. The return value is the zlib - error number (see function gzerror below). gzflush returns Z_OK if - the flush parameter is Z_FINISH and all output could be flushed. - gzflush should be called only when strictly necessary because it can - degrade compression. -*/ - -ZEXTERN z_off_t ZEXPORT gzseek OF((gzFile file, - z_off_t offset, int whence)); -/* - Sets the starting position for the next gzread or gzwrite on the - given compressed file. The offset represents a number of bytes in the - uncompressed data stream. The whence parameter is defined as in lseek(2); - the value SEEK_END is not supported. - If the file is opened for reading, this function is emulated but can be - extremely slow. If the file is opened for writing, only forward seeks are - supported; gzseek then compresses a sequence of zeroes up to the new - starting position. - - gzseek returns the resulting offset location as measured in bytes from - the beginning of the uncompressed stream, or -1 in case of error, in - particular if the file is opened for writing and the new starting position - would be before the current position. -*/ - -ZEXTERN int ZEXPORT gzrewind OF((gzFile file)); -/* - Rewinds the given file. This function is supported only for reading. - - gzrewind(file) is equivalent to (int)gzseek(file, 0L, SEEK_SET) -*/ - -ZEXTERN z_off_t ZEXPORT gztell OF((gzFile file)); -/* - Returns the starting position for the next gzread or gzwrite on the - given compressed file. This position represents a number of bytes in the - uncompressed data stream. - - gztell(file) is equivalent to gzseek(file, 0L, SEEK_CUR) -*/ - -ZEXTERN int ZEXPORT gzeof OF((gzFile file)); -/* - Returns 1 when EOF has previously been detected reading the given - input stream, otherwise zero. -*/ - -ZEXTERN int ZEXPORT gzdirect OF((gzFile file)); -/* - Returns 1 if file is being read directly without decompression, otherwise - zero. -*/ - -ZEXTERN int ZEXPORT gzclose OF((gzFile file)); -/* - Flushes all pending output if necessary, closes the compressed file - and deallocates all the (de)compression state. The return value is the zlib - error number (see function gzerror below). -*/ - -ZEXTERN const char * ZEXPORT gzerror OF((gzFile file, int *errnum)); -/* - Returns the error message for the last error which occurred on the - given compressed file. errnum is set to zlib error number. If an - error occurred in the file system and not in the compression library, - errnum is set to Z_ERRNO and the application may consult errno - to get the exact error code. -*/ - -ZEXTERN void ZEXPORT gzclearerr OF((gzFile file)); -/* - Clears the error and end-of-file flags for file. This is analogous to the - clearerr() function in stdio. This is useful for continuing to read a gzip - file that is being written concurrently. -*/ - - /* checksum functions */ - -/* - These functions are not related to compression but are exported - anyway because they might be useful in applications using the - compression library. -*/ - -ZEXTERN uLong ZEXPORT adler32 OF((uLong adler, const Bytef *buf, uInt len)); -/* - Update a running Adler-32 checksum with the bytes buf[0..len-1] and - return the updated checksum. If buf is NULL, this function returns - the required initial value for the checksum. - An Adler-32 checksum is almost as reliable as a CRC32 but can be computed - much faster. Usage example: - - uLong adler = adler32(0L, Z_NULL, 0); - - while (read_buffer(buffer, length) != EOF) { - adler = adler32(adler, buffer, length); - } - if (adler != original_adler) error(); -*/ - -ZEXTERN uLong ZEXPORT adler32_combine OF((uLong adler1, uLong adler2, - z_off_t len2)); -/* - Combine two Adler-32 checksums into one. For two sequences of bytes, seq1 - and seq2 with lengths len1 and len2, Adler-32 checksums were calculated for - each, adler1 and adler2. adler32_combine() returns the Adler-32 checksum of - seq1 and seq2 concatenated, requiring only adler1, adler2, and len2. -*/ - -ZEXTERN uLong ZEXPORT crc32 OF((uLong crc, const Bytef *buf, uInt len)); -/* - Update a running CRC-32 with the bytes buf[0..len-1] and return the - updated CRC-32. If buf is NULL, this function returns the required initial - value for the for the crc. Pre- and post-conditioning (one's complement) is - performed within this function so it shouldn't be done by the application. - Usage example: - - uLong crc = crc32(0L, Z_NULL, 0); - - while (read_buffer(buffer, length) != EOF) { - crc = crc32(crc, buffer, length); - } - if (crc != original_crc) error(); -*/ - -ZEXTERN uLong ZEXPORT crc32_combine OF((uLong crc1, uLong crc2, z_off_t len2)); - -/* - Combine two CRC-32 check values into one. For two sequences of bytes, - seq1 and seq2 with lengths len1 and len2, CRC-32 check values were - calculated for each, crc1 and crc2. crc32_combine() returns the CRC-32 - check value of seq1 and seq2 concatenated, requiring only crc1, crc2, and - len2. -*/ - - - /* various hacks, don't look :) */ - -/* deflateInit and inflateInit are macros to allow checking the zlib version - * and the compiler's view of z_stream: - */ -ZEXTERN int ZEXPORT deflateInit_ OF((z_streamp strm, int level, - const char *version, int stream_size)); -ZEXTERN int ZEXPORT inflateInit_ OF((z_streamp strm, - const char *version, int stream_size)); -ZEXTERN int ZEXPORT deflateInit2_ OF((z_streamp strm, int level, int method, - int windowBits, int memLevel, - int strategy, const char *version, - int stream_size)); -ZEXTERN int ZEXPORT inflateInit2_ OF((z_streamp strm, int windowBits, - const char *version, int stream_size)); -ZEXTERN int ZEXPORT inflateBackInit_ OF((z_streamp strm, int windowBits, - unsigned char FAR *window, - const char *version, - int stream_size)); -#define deflateInit(strm, level) \ - deflateInit_((strm), (level), ZLIB_VERSION, sizeof(z_stream)) -#define inflateInit(strm) \ - inflateInit_((strm), ZLIB_VERSION, sizeof(z_stream)) -#define deflateInit2(strm, level, method, windowBits, memLevel, strategy) \ - deflateInit2_((strm),(level),(method),(windowBits),(memLevel),\ - (strategy), ZLIB_VERSION, sizeof(z_stream)) -#define inflateInit2(strm, windowBits) \ - inflateInit2_((strm), (windowBits), ZLIB_VERSION, sizeof(z_stream)) -#define inflateBackInit(strm, windowBits, window) \ - inflateBackInit_((strm), (windowBits), (window), \ - ZLIB_VERSION, sizeof(z_stream)) - - -#if !defined(ZUTIL_H) && !defined(NO_DUMMY_DECL) - struct internal_state {int dummy;}; /* hack for buggy compilers */ -#endif - -ZEXTERN const char * ZEXPORT zError OF((int)); -ZEXTERN int ZEXPORT inflateSyncPoint OF((z_streamp z)); -ZEXTERN const uLongf * ZEXPORT get_crc_table OF((void)); - -#ifdef __cplusplus -} -#endif - -#endif /* ZLIB_H */ diff --git a/dependencies/zlib/zlib.lib b/dependencies/zlib/zlib.lib deleted file mode 100644 index 6386354b..00000000 Binary files a/dependencies/zlib/zlib.lib and /dev/null differ diff --git a/dependencies/zlib/zlib.vcproj b/dependencies/zlib/zlib.vcproj deleted file mode 100644 index 83160892..00000000 --- a/dependencies/zlib/zlib.vcproj +++ /dev/null @@ -1,259 +0,0 @@ - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - diff --git a/dependencies/zlib/zlib.vcproj.GOLIATH.Shawn.user b/dependencies/zlib/zlib.vcproj.GOLIATH.Shawn.user deleted file mode 100644 index 3737b836..00000000 --- a/dependencies/zlib/zlib.vcproj.GOLIATH.Shawn.user +++ /dev/null @@ -1,65 +0,0 @@ - - - - - - - - - - - diff --git a/dependencies/zlib/zlibd.lib b/dependencies/zlib/zlibd.lib deleted file mode 100644 index 963ed360..00000000 Binary files a/dependencies/zlib/zlibd.lib and /dev/null differ diff --git a/dependencies/zlib/zutil.c b/dependencies/zlib/zutil.c deleted file mode 100644 index 0f4bd787..00000000 --- a/dependencies/zlib/zutil.c +++ /dev/null @@ -1,318 +0,0 @@ -/* zutil.c -- target dependent utility functions for the compression library - * Copyright (C) 1995-2005 Jean-loup Gailly. - * For conditions of distribution and use, see copyright notice in zlib.h - */ - -/* @(#) $Id$ */ - -#include "zutil.h" - -#ifndef NO_DUMMY_DECL -struct internal_state {int dummy;}; /* for buggy compilers */ -#endif - -const char * const z_errmsg[10] = { -"need dictionary", /* Z_NEED_DICT 2 */ -"stream end", /* Z_STREAM_END 1 */ -"", /* Z_OK 0 */ -"file error", /* Z_ERRNO (-1) */ -"stream error", /* Z_STREAM_ERROR (-2) */ -"data error", /* Z_DATA_ERROR (-3) */ -"insufficient memory", /* Z_MEM_ERROR (-4) */ -"buffer error", /* Z_BUF_ERROR (-5) */ -"incompatible version",/* Z_VERSION_ERROR (-6) */ -""}; - - -const char * ZEXPORT zlibVersion() -{ - return ZLIB_VERSION; -} - -uLong ZEXPORT zlibCompileFlags() -{ - uLong flags; - - flags = 0; - switch (sizeof(uInt)) { - case 2: break; - case 4: flags += 1; break; - case 8: flags += 2; break; - default: flags += 3; - } - switch (sizeof(uLong)) { - case 2: break; - case 4: flags += 1 << 2; break; - case 8: flags += 2 << 2; break; - default: flags += 3 << 2; - } - switch (sizeof(voidpf)) { - case 2: break; - case 4: flags += 1 << 4; break; - case 8: flags += 2 << 4; break; - default: flags += 3 << 4; - } - switch (sizeof(z_off_t)) { - case 2: break; - case 4: flags += 1 << 6; break; - case 8: flags += 2 << 6; break; - default: flags += 3 << 6; - } -#ifdef DEBUG - flags += 1 << 8; -#endif -#if defined(ASMV) || defined(ASMINF) - flags += 1 << 9; -#endif -#ifdef ZLIB_WINAPI - flags += 1 << 10; -#endif -#ifdef BUILDFIXED - flags += 1 << 12; -#endif -#ifdef DYNAMIC_CRC_TABLE - flags += 1 << 13; -#endif -#ifdef NO_GZCOMPRESS - flags += 1L << 16; -#endif -#ifdef NO_GZIP - flags += 1L << 17; -#endif -#ifdef PKZIP_BUG_WORKAROUND - flags += 1L << 20; -#endif -#ifdef FASTEST - flags += 1L << 21; -#endif -#ifdef STDC -# ifdef NO_vsnprintf - flags += 1L << 25; -# ifdef HAS_vsprintf_void - flags += 1L << 26; -# endif -# else -# ifdef HAS_vsnprintf_void - flags += 1L << 26; -# endif -# endif -#else - flags += 1L << 24; -# ifdef NO_snprintf - flags += 1L << 25; -# ifdef HAS_sprintf_void - flags += 1L << 26; -# endif -# else -# ifdef HAS_snprintf_void - flags += 1L << 26; -# endif -# endif -#endif - return flags; -} - -#ifdef DEBUG - -# ifndef verbose -# define verbose 0 -# endif -int z_verbose = verbose; - -void z_error (m) - char *m; -{ - fprintf(stderr, "%s\n", m); - exit(1); -} -#endif - -/* exported to allow conversion of error code to string for compress() and - * uncompress() - */ -const char * ZEXPORT zError(err) - int err; -{ - return ERR_MSG(err); -} - -#if defined(_WIN32_WCE) - /* The Microsoft C Run-Time Library for Windows CE doesn't have - * errno. We define it as a global variable to simplify porting. - * Its value is always 0 and should not be used. - */ - int errno = 0; -#endif - -#ifndef HAVE_MEMCPY - -void zmemcpy(dest, source, len) - Bytef* dest; - const Bytef* source; - uInt len; -{ - if (len == 0) return; - do { - *dest++ = *source++; /* ??? to be unrolled */ - } while (--len != 0); -} - -int zmemcmp(s1, s2, len) - const Bytef* s1; - const Bytef* s2; - uInt len; -{ - uInt j; - - for (j = 0; j < len; j++) { - if (s1[j] != s2[j]) return 2*(s1[j] > s2[j])-1; - } - return 0; -} - -void zmemzero(dest, len) - Bytef* dest; - uInt len; -{ - if (len == 0) return; - do { - *dest++ = 0; /* ??? to be unrolled */ - } while (--len != 0); -} -#endif - - -#ifdef SYS16BIT - -#ifdef __TURBOC__ -/* Turbo C in 16-bit mode */ - -# define MY_ZCALLOC - -/* Turbo C malloc() does not allow dynamic allocation of 64K bytes - * and farmalloc(64K) returns a pointer with an offset of 8, so we - * must fix the pointer. Warning: the pointer must be put back to its - * original form in order to free it, use zcfree(). - */ - -#define MAX_PTR 10 -/* 10*64K = 640K */ - -local int next_ptr = 0; - -typedef struct ptr_table_s { - voidpf org_ptr; - voidpf new_ptr; -} ptr_table; - -local ptr_table table[MAX_PTR]; -/* This table is used to remember the original form of pointers - * to large buffers (64K). Such pointers are normalized with a zero offset. - * Since MSDOS is not a preemptive multitasking OS, this table is not - * protected from concurrent access. This hack doesn't work anyway on - * a protected system like OS/2. Use Microsoft C instead. - */ - -voidpf zcalloc (voidpf opaque, unsigned items, unsigned size) -{ - voidpf buf = opaque; /* just to make some compilers happy */ - ulg bsize = (ulg)items*size; - - /* If we allocate less than 65520 bytes, we assume that farmalloc - * will return a usable pointer which doesn't have to be normalized. - */ - if (bsize < 65520L) { - buf = farmalloc(bsize); - if (*(ush*)&buf != 0) return buf; - } else { - buf = farmalloc(bsize + 16L); - } - if (buf == NULL || next_ptr >= MAX_PTR) return NULL; - table[next_ptr].org_ptr = buf; - - /* Normalize the pointer to seg:0 */ - *((ush*)&buf+1) += ((ush)((uch*)buf-0) + 15) >> 4; - *(ush*)&buf = 0; - table[next_ptr++].new_ptr = buf; - return buf; -} - -void zcfree (voidpf opaque, voidpf ptr) -{ - int n; - if (*(ush*)&ptr != 0) { /* object < 64K */ - farfree(ptr); - return; - } - /* Find the original pointer */ - for (n = 0; n < next_ptr; n++) { - if (ptr != table[n].new_ptr) continue; - - farfree(table[n].org_ptr); - while (++n < next_ptr) { - table[n-1] = table[n]; - } - next_ptr--; - return; - } - ptr = opaque; /* just to make some compilers happy */ - Assert(0, "zcfree: ptr not found"); -} - -#endif /* __TURBOC__ */ - - -#ifdef M_I86 -/* Microsoft C in 16-bit mode */ - -# define MY_ZCALLOC - -#if (!defined(_MSC_VER) || (_MSC_VER <= 600)) -# define _halloc halloc -# define _hfree hfree -#endif - -voidpf zcalloc (voidpf opaque, unsigned items, unsigned size) -{ - if (opaque) opaque = 0; /* to make compiler happy */ - return _halloc((long)items, size); -} - -void zcfree (voidpf opaque, voidpf ptr) -{ - if (opaque) opaque = 0; /* to make compiler happy */ - _hfree(ptr); -} - -#endif /* M_I86 */ - -#endif /* SYS16BIT */ - - -#ifndef MY_ZCALLOC /* Any system without a special alloc function */ - -#ifndef STDC -extern voidp malloc OF((uInt size)); -extern voidp calloc OF((uInt items, uInt size)); -extern void free OF((voidpf ptr)); -#endif - -voidpf zcalloc (opaque, items, size) - voidpf opaque; - unsigned items; - unsigned size; -{ - if (opaque) items += size - size; /* make compiler happy */ - return sizeof(uInt) > 2 ? (voidpf)malloc(items * size) : - (voidpf)calloc(items, size); -} - -void zcfree (opaque, ptr) - voidpf opaque; - voidpf ptr; -{ - free(ptr); - if (opaque) return; /* make compiler happy */ -} - -#endif /* MY_ZCALLOC */ diff --git a/dependencies/zlib/zutil.h b/dependencies/zlib/zutil.h deleted file mode 100644 index 0ba6e020..00000000 --- a/dependencies/zlib/zutil.h +++ /dev/null @@ -1,269 +0,0 @@ -/* zutil.h -- internal interface and configuration of the compression library - * Copyright (C) 1995-2005 Jean-loup Gailly. - * For conditions of distribution and use, see copyright notice in zlib.h - */ - -/* WARNING: this file should *not* be used by applications. It is - part of the implementation of the compression library and is - subject to change. Applications should only use zlib.h. - */ - -/* @(#) $Id$ */ - -#ifndef ZUTIL_H -#define ZUTIL_H - -#define ZLIB_INTERNAL -#include "zlib.h" - -#ifdef STDC -# ifndef _WIN32_WCE -# include -# endif -# include -# include -#endif -#ifdef NO_ERRNO_H -# ifdef _WIN32_WCE - /* The Microsoft C Run-Time Library for Windows CE doesn't have - * errno. We define it as a global variable to simplify porting. - * Its value is always 0 and should not be used. We rename it to - * avoid conflict with other libraries that use the same workaround. - */ -# define errno z_errno -# endif - extern int errno; -#else -# ifndef _WIN32_WCE -# include -# endif -#endif - -#ifndef local -# define local static -#endif -/* compile with -Dlocal if your debugger can't find static symbols */ - -typedef unsigned char uch; -typedef uch FAR uchf; -typedef unsigned short ush; -typedef ush FAR ushf; -typedef unsigned long ulg; - -extern const char * const z_errmsg[10]; /* indexed by 2-zlib_error */ -/* (size given to avoid silly warnings with Visual C++) */ - -#define ERR_MSG(err) z_errmsg[Z_NEED_DICT-(err)] - -#define ERR_RETURN(strm,err) \ - return (strm->msg = (char*)ERR_MSG(err), (err)) -/* To be used only when the state is known to be valid */ - - /* common constants */ - -#ifndef DEF_WBITS -# define DEF_WBITS MAX_WBITS -#endif -/* default windowBits for decompression. MAX_WBITS is for compression only */ - -#if MAX_MEM_LEVEL >= 8 -# define DEF_MEM_LEVEL 8 -#else -# define DEF_MEM_LEVEL MAX_MEM_LEVEL -#endif -/* default memLevel */ - -#define STORED_BLOCK 0 -#define STATIC_TREES 1 -#define DYN_TREES 2 -/* The three kinds of block type */ - -#define MIN_MATCH 3 -#define MAX_MATCH 258 -/* The minimum and maximum match lengths */ - -#define PRESET_DICT 0x20 /* preset dictionary flag in zlib header */ - - /* target dependencies */ - -#if defined(MSDOS) || (defined(WINDOWS) && !defined(WIN32)) -# define OS_CODE 0x00 -# if defined(__TURBOC__) || defined(__BORLANDC__) -# if(__STDC__ == 1) && (defined(__LARGE__) || defined(__COMPACT__)) - /* Allow compilation with ANSI keywords only enabled */ - void _Cdecl farfree( void *block ); - void *_Cdecl farmalloc( unsigned long nbytes ); -# else -# include -# endif -# else /* MSC or DJGPP */ -# include -# endif -#endif - -#ifdef AMIGA -# define OS_CODE 0x01 -#endif - -#if defined(VAXC) || defined(VMS) -# define OS_CODE 0x02 -# define F_OPEN(name, mode) \ - fopen((name), (mode), "mbc=60", "ctx=stm", "rfm=fix", "mrs=512") -#endif - -#if defined(ATARI) || defined(atarist) -# define OS_CODE 0x05 -#endif - -#ifdef OS2 -# define OS_CODE 0x06 -# ifdef M_I86 - #include -# endif -#endif - -#if defined(MACOS) || defined(TARGET_OS_MAC) -# define OS_CODE 0x07 -# if defined(__MWERKS__) && __dest_os != __be_os && __dest_os != __win32_os -# include /* for fdopen */ -# else -# ifndef fdopen -# define fdopen(fd,mode) NULL /* No fdopen() */ -# endif -# endif -#endif - -#ifdef TOPS20 -# define OS_CODE 0x0a -#endif - -#ifdef WIN32 -# ifndef __CYGWIN__ /* Cygwin is Unix, not Win32 */ -# define OS_CODE 0x0b -# endif -#endif - -#ifdef __50SERIES /* Prime/PRIMOS */ -# define OS_CODE 0x0f -#endif - -#if defined(_BEOS_) || defined(RISCOS) -# define fdopen(fd,mode) NULL /* No fdopen() */ -#endif - -#if (defined(_MSC_VER) && (_MSC_VER > 600)) -# if defined(_WIN32_WCE) -# define fdopen(fd,mode) NULL /* No fdopen() */ -# ifndef _PTRDIFF_T_DEFINED - typedef int ptrdiff_t; -# define _PTRDIFF_T_DEFINED -# endif -# else -# define fdopen(fd,type) _fdopen(fd,type) -# endif -#endif - - /* common defaults */ - -#ifndef OS_CODE -# define OS_CODE 0x03 /* assume Unix */ -#endif - -#ifndef F_OPEN -# define F_OPEN(name, mode) fopen((name), (mode)) -#endif - - /* functions */ - -#if defined(STDC99) || (defined(__TURBOC__) && __TURBOC__ >= 0x550) -# ifndef HAVE_VSNPRINTF -# define HAVE_VSNPRINTF -# endif -#endif -#if defined(__CYGWIN__) -# ifndef HAVE_VSNPRINTF -# define HAVE_VSNPRINTF -# endif -#endif -#ifndef HAVE_VSNPRINTF -# ifdef MSDOS - /* vsnprintf may exist on some MS-DOS compilers (DJGPP?), - but for now we just assume it doesn't. */ -# define NO_vsnprintf -# endif -# ifdef __TURBOC__ -# define NO_vsnprintf -# endif -# ifdef WIN32 - /* In Win32, vsnprintf is available as the "non-ANSI" _vsnprintf. */ -# if !defined(vsnprintf) && !defined(NO_vsnprintf) -# define vsnprintf _vsnprintf -# endif -# endif -# ifdef __SASC -# define NO_vsnprintf -# endif -#endif -#ifdef VMS -# define NO_vsnprintf -#endif - -#if defined(pyr) -# define NO_MEMCPY -#endif -#if defined(SMALL_MEDIUM) && !defined(_MSC_VER) && !defined(__SC__) - /* Use our own functions for small and medium model with MSC <= 5.0. - * You may have to use the same strategy for Borland C (untested). - * The __SC__ check is for Symantec. - */ -# define NO_MEMCPY -#endif -#if defined(STDC) && !defined(HAVE_MEMCPY) && !defined(NO_MEMCPY) -# define HAVE_MEMCPY -#endif -#ifdef HAVE_MEMCPY -# ifdef SMALL_MEDIUM /* MSDOS small or medium model */ -# define zmemcpy _fmemcpy -# define zmemcmp _fmemcmp -# define zmemzero(dest, len) _fmemset(dest, 0, len) -# else -# define zmemcpy memcpy -# define zmemcmp memcmp -# define zmemzero(dest, len) memset(dest, 0, len) -# endif -#else - extern void zmemcpy OF((Bytef* dest, const Bytef* source, uInt len)); - extern int zmemcmp OF((const Bytef* s1, const Bytef* s2, uInt len)); - extern void zmemzero OF((Bytef* dest, uInt len)); -#endif - -/* Diagnostic functions */ -#ifdef DEBUG -# include - extern int z_verbose; - extern void z_error OF((char *m)); -# define Assert(cond,msg) {if(!(cond)) z_error(msg);} -# define Trace(x) {if (z_verbose>=0) fprintf x ;} -# define Tracev(x) {if (z_verbose>0) fprintf x ;} -# define Tracevv(x) {if (z_verbose>1) fprintf x ;} -# define Tracec(c,x) {if (z_verbose>0 && (c)) fprintf x ;} -# define Tracecv(c,x) {if (z_verbose>1 && (c)) fprintf x ;} -#else -# define Assert(cond,msg) -# define Trace(x) -# define Tracev(x) -# define Tracevv(x) -# define Tracec(c,x) -# define Tracecv(c,x) -#endif - - -voidpf zcalloc OF((voidpf opaque, unsigned items, unsigned size)); -void zcfree OF((voidpf opaque, voidpf ptr)); - -#define ZALLOC(strm, items, size) \ - (*((strm)->zalloc))((strm)->opaque, (items), (size)) -#define ZFREE(strm, addr) (*((strm)->zfree))((strm)->opaque, (voidpf)(addr)) -#define TRY_FREE(s, p) {if (p) ZFREE(s, p);} - -#endif /* ZUTIL_H */