From 5761e475eebb5fc5ee41cd06f50ca16e83def1a4 Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Miguel=20A=2E=20Col=C3=B3n=20V=C3=A9lez?= Date: Sat, 22 Aug 2015 05:57:20 -0400 Subject: [PATCH 1/5] Update bzip from 1.0.4 to 1.0.6. - Only adds 2 security fixes. - Add the CHANGES file. - Add local changes: + setmode to _setmode + fileno to _fileno + fdopen to _fdopen - sudonim1 removed all trailing whitespaces in svn2897 so I ran: find . -type f -name '*.c' -o -name '*.h' | xargs sed -i 's/[[:space:]]\+$//' This makes the delta of changes smaller. --- 3rdparty/bzip2/CHANGES | 327 +++++++++++++++++++++++++++++++++ 3rdparty/bzip2/LICENSE | 7 +- 3rdparty/bzip2/README | 14 +- 3rdparty/bzip2/blocksort.c | 4 +- 3rdparty/bzip2/bzlib.c | 7 +- 3rdparty/bzip2/bzlib.h | 4 +- 3rdparty/bzip2/bzlib_private.h | 16 +- 3rdparty/bzip2/compress.c | 4 +- 3rdparty/bzip2/crctable.c | 4 +- 3rdparty/bzip2/decompress.c | 24 ++- 3rdparty/bzip2/huffman.c | 4 +- 3rdparty/bzip2/randtable.c | 4 +- 12 files changed, 391 insertions(+), 28 deletions(-) create mode 100644 3rdparty/bzip2/CHANGES diff --git a/3rdparty/bzip2/CHANGES b/3rdparty/bzip2/CHANGES new file mode 100644 index 0000000000..a8c76dc502 --- /dev/null +++ b/3rdparty/bzip2/CHANGES @@ -0,0 +1,327 @@ + ------------------------------------------------------------------ + This file is part of bzip2/libbzip2, a program and library for + lossless, block-sorting data compression. + + bzip2/libbzip2 version 1.0.6 of 6 September 2010 + Copyright (C) 1996-2010 Julian Seward + + Please read the WARNING, DISCLAIMER and PATENTS sections in the + README file. + + This program is released under the terms of the license contained + in the file LICENSE. + ------------------------------------------------------------------ + + +0.9.0 +~~~~~ +First version. + + +0.9.0a +~~~~~~ +Removed 'ranlib' from Makefile, since most modern Unix-es +don't need it, or even know about it. + + +0.9.0b +~~~~~~ +Fixed a problem with error reporting in bzip2.c. This does not effect +the library in any way. Problem is: versions 0.9.0 and 0.9.0a (of the +program proper) compress and decompress correctly, but give misleading +error messages (internal panics) when an I/O error occurs, instead of +reporting the problem correctly. This shouldn't give any data loss +(as far as I can see), but is confusing. + +Made the inline declarations disappear for non-GCC compilers. + + +0.9.0c +~~~~~~ +Fixed some problems in the library pertaining to some boundary cases. +This makes the library behave more correctly in those situations. The +fixes apply only to features (calls and parameters) not used by +bzip2.c, so the non-fixedness of them in previous versions has no +effect on reliability of bzip2.c. + +In bzlib.c: + * made zero-length BZ_FLUSH work correctly in bzCompress(). + * fixed bzWrite/bzRead to ignore zero-length requests. + * fixed bzread to correctly handle read requests after EOF. + * wrong parameter order in call to bzDecompressInit in + bzBuffToBuffDecompress. Fixed. + +In compress.c: + * changed setting of nGroups in sendMTFValues() so as to + do a bit better on small files. This _does_ effect + bzip2.c. + + +0.9.5a +~~~~~~ +Major change: add a fallback sorting algorithm (blocksort.c) +to give reasonable behaviour even for very repetitive inputs. +Nuked --repetitive-best and --repetitive-fast since they are +no longer useful. + +Minor changes: mostly a whole bunch of small changes/ +bugfixes in the driver (bzip2.c). Changes pertaining to the +user interface are: + + allow decompression of symlink'd files to stdout + decompress/test files even without .bz2 extension + give more accurate error messages for I/O errors + when compressing/decompressing to stdout, don't catch control-C + read flags from BZIP2 and BZIP environment variables + decline to break hard links to a file unless forced with -f + allow -c flag even with no filenames + preserve file ownerships as far as possible + make -s -1 give the expected block size (100k) + add a flag -q --quiet to suppress nonessential warnings + stop decoding flags after --, so files beginning in - can be handled + resolved inconsistent naming: bzcat or bz2cat ? + bzip2 --help now returns 0 + +Programming-level changes are: + + fixed syntax error in GET_LL4 for Borland C++ 5.02 + let bzBuffToBuffDecompress return BZ_DATA_ERROR{_MAGIC} + fix overshoot of mode-string end in bzopen_or_bzdopen + wrapped bzlib.h in #ifdef __cplusplus ... extern "C" { ... } + close file handles under all error conditions + added minor mods so it compiles with DJGPP out of the box + fixed Makefile so it doesn't give problems with BSD make + fix uninitialised memory reads in dlltest.c + +0.9.5b +~~~~~~ +Open stdin/stdout in binary mode for DJGPP. + +0.9.5c +~~~~~~ +Changed BZ_N_OVERSHOOT to be ... + 2 instead of ... + 1. The + 1 +version could cause the sorted order to be wrong in some extremely +obscure cases. Also changed setting of quadrant in blocksort.c. + +0.9.5d +~~~~~~ +The only functional change is to make bzlibVersion() in the library +return the correct string. This has no effect whatsoever on the +functioning of the bzip2 program or library. Added a couple of casts +so the library compiles without warnings at level 3 in MS Visual +Studio 6.0. Included a Y2K statement in the file Y2K_INFO. All other +changes are minor documentation changes. + +1.0 +~~~ +Several minor bugfixes and enhancements: + +* Large file support. The library uses 64-bit counters to + count the volume of data passing through it. bzip2.c + is now compiled with -D_FILE_OFFSET_BITS=64 to get large + file support from the C library. -v correctly prints out + file sizes greater than 4 gigabytes. All these changes have + been made without assuming a 64-bit platform or a C compiler + which supports 64-bit ints, so, except for the C library + aspect, they are fully portable. + +* Decompression robustness. The library/program should be + robust to any corruption of compressed data, detecting and + handling _all_ corruption, instead of merely relying on + the CRCs. What this means is that the program should + never crash, given corrupted data, and the library should + always return BZ_DATA_ERROR. + +* Fixed an obscure race-condition bug only ever observed on + Solaris, in which, if you were very unlucky and issued + control-C at exactly the wrong time, both input and output + files would be deleted. + +* Don't run out of file handles on test/decompression when + large numbers of files have invalid magic numbers. + +* Avoid library namespace pollution. Prefix all exported + symbols with BZ2_. + +* Minor sorting enhancements from my DCC2000 paper. + +* Advance the version number to 1.0, so as to counteract the + (false-in-this-case) impression some people have that programs + with version numbers less than 1.0 are in some way, experimental, + pre-release versions. + +* Create an initial Makefile-libbz2_so to build a shared library. + Yes, I know I should really use libtool et al ... + +* Make the program exit with 2 instead of 0 when decompression + fails due to a bad magic number (ie, an invalid bzip2 header). + Also exit with 1 (as the manual claims :-) whenever a diagnostic + message would have been printed AND the corresponding operation + is aborted, for example + bzip2: Output file xx already exists. + When a diagnostic message is printed but the operation is not + aborted, for example + bzip2: Can't guess original name for wurble -- using wurble.out + then the exit value 0 is returned, unless some other problem is + also detected. + + I think it corresponds more closely to what the manual claims now. + + +1.0.1 +~~~~~ +* Modified dlltest.c so it uses the new BZ2_ naming scheme. +* Modified makefile-msc to fix minor build probs on Win2k. +* Updated README.COMPILATION.PROBLEMS. + +There are no functionality changes or bug fixes relative to version +1.0.0. This is just a documentation update + a fix for minor Win32 +build problems. For almost everyone, upgrading from 1.0.0 to 1.0.1 is +utterly pointless. Don't bother. + + +1.0.2 +~~~~~ +A bug fix release, addressing various minor issues which have appeared +in the 18 or so months since 1.0.1 was released. Most of the fixes +are to do with file-handling or documentation bugs. To the best of my +knowledge, there have been no data-loss-causing bugs reported in the +compression/decompression engine of 1.0.0 or 1.0.1. + +Note that this release does not improve the rather crude build system +for Unix platforms. The general plan here is to autoconfiscate/ +libtoolise 1.0.2 soon after release, and release the result as 1.1.0 +or perhaps 1.2.0. That, however, is still just a plan at this point. + +Here are the changes in 1.0.2. Bug-reporters and/or patch-senders in +parentheses. + +* Fix an infinite segfault loop in 1.0.1 when a directory is + encountered in -f (force) mode. + (Trond Eivind Glomsrod, Nicholas Nethercote, Volker Schmidt) + +* Avoid double fclose() of output file on certain I/O error paths. + (Solar Designer) + +* Don't fail with internal error 1007 when fed a long stream (> 48MB) + of byte 251. Also print useful message suggesting that 1007s may be + caused by bad memory. + (noticed by Juan Pedro Vallejo, fixed by me) + +* Fix uninitialised variable silly bug in demo prog dlltest.c. + (Jorj Bauer) + +* Remove 512-MB limitation on recovered file size for bzip2recover + on selected platforms which support 64-bit ints. At the moment + all GCC supported platforms, and Win32. + (me, Alson van der Meulen) + +* Hard-code header byte values, to give correct operation on platforms + using EBCDIC as their native character set (IBM's OS/390). + (Leland Lucius) + +* Copy file access times correctly. + (Marty Leisner) + +* Add distclean and check targets to Makefile. + (Michael Carmack) + +* Parameterise use of ar and ranlib in Makefile. Also add $(LDFLAGS). + (Rich Ireland, Bo Thorsen) + +* Pass -p (create parent dirs as needed) to mkdir during make install. + (Jeremy Fusco) + +* Dereference symlinks when copying file permissions in -f mode. + (Volker Schmidt) + +* Majorly simplify implementation of uInt64_qrm10. + (Bo Lindbergh) + +* Check the input file still exists before deleting the output one, + when aborting in cleanUpAndFail(). + (Joerg Prante, Robert Linden, Matthias Krings) + +Also a bunch of patches courtesy of Philippe Troin, the Debian maintainer +of bzip2: + +* Wrapper scripts (with manpages): bzdiff, bzgrep, bzmore. + +* Spelling changes and minor enhancements in bzip2.1. + +* Avoid race condition between creating the output file and setting its + interim permissions safely, by using fopen_output_safely(). + No changes to bzip2recover since there is no issue with file + permissions there. + +* do not print senseless report with -v when compressing an empty + file. + +* bzcat -f works on non-bzip2 files. + +* do not try to escape shell meta-characters on unix (the shell takes + care of these). + +* added --fast and --best aliases for -1 -9 for gzip compatibility. + + +1.0.3 (15 Feb 05) +~~~~~~~~~~~~~~~~~ +Fixes some minor bugs since the last version, 1.0.2. + +* Further robustification against corrupted compressed data. + There are currently no known bitstreams which can cause the + decompressor to crash, loop or access memory which does not + belong to it. If you are using bzip2 or the library to + decompress bitstreams from untrusted sources, an upgrade + to 1.0.3 is recommended. This fixes CAN-2005-1260. + +* The documentation has been converted to XML, from which html + and pdf can be derived. + +* Various minor bugs in the documentation have been fixed. + +* Fixes for various compilation warnings with newer versions of + gcc, and on 64-bit platforms. + +* The BZ_NO_STDIO cpp symbol was not properly observed in 1.0.2. + This has been fixed. + + +1.0.4 (20 Dec 06) +~~~~~~~~~~~~~~~~~ +Fixes some minor bugs since the last version, 1.0.3. + +* Fix file permissions race problem (CAN-2005-0953). + +* Avoid possible segfault in BZ2_bzclose. From Coverity's NetBSD + scan. + +* 'const'/prototype cleanups in the C code. + +* Change default install location to /usr/local, and handle multiple + 'make install's without error. + +* Sanitise file names more carefully in bzgrep. Fixes CAN-2005-0758 + to the extent that applies to bzgrep. + +* Use 'mktemp' rather than 'tempfile' in bzdiff. + +* Tighten up a couple of assertions in blocksort.c following automated + analysis. + +* Fix minor doc/comment bugs. + + +1.0.5 (10 Dec 07) +~~~~~~~~~~~~~~~~~ +Security fix only. Fixes CERT-FI 20469 as it applies to bzip2. + + +1.0.6 (6 Sept 10) +~~~~~~~~~~~~~~~~~ + +* Security fix for CVE-2010-0405. This was reported by Mikolaj + Izdebski. + +* Make the documentation build on Ubuntu 10.04 diff --git a/3rdparty/bzip2/LICENSE b/3rdparty/bzip2/LICENSE index 4458e35bb5..cc614178cf 100644 --- a/3rdparty/bzip2/LICENSE +++ b/3rdparty/bzip2/LICENSE @@ -2,7 +2,7 @@ -------------------------------------------------------------------------- This program, "bzip2", the associated library "libbzip2", and all -documentation, are copyright (C) 1996-2006 Julian R Seward. All +documentation, are copyright (C) 1996-2010 Julian R Seward. All rights reserved. Redistribution and use in source and binary forms, with or without @@ -36,8 +36,7 @@ WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. -Julian Seward, Cambridge, UK. -jseward@bzip.org -bzip2/libbzip2 version 1.0.4 of 20 December 2006 +Julian Seward, jseward@bzip.org +bzip2/libbzip2 version 1.0.6 of 6 September 2010 -------------------------------------------------------------------------- diff --git a/3rdparty/bzip2/README b/3rdparty/bzip2/README index b18c096b9e..9fb0f63601 100644 --- a/3rdparty/bzip2/README +++ b/3rdparty/bzip2/README @@ -6,8 +6,8 @@ This version is fully compatible with the previous public releases. This file is part of bzip2/libbzip2, a program and library for lossless, block-sorting data compression. -bzip2/libbzip2 version 1.0.4 of 20 December 2006 -Copyright (C) 1996-2006 Julian Seward +bzip2/libbzip2 version 1.0.6 of 6 September 2010 +Copyright (C) 1996-2010 Julian Seward Please read the WARNING, DISCLAIMER and PATENTS sections in this file. @@ -177,6 +177,14 @@ WHAT'S NEW IN 1.0.4 ? See the CHANGES file. +WHAT'S NEW IN 1.0.5 ? + + See the CHANGES file. + +WHAT'S NEW IN 1.0.6 ? + + See the CHANGES file. + I hope you find bzip2 useful. Feel free to contact me at jseward@bzip.org @@ -203,3 +211,5 @@ Cambridge, UK. 30 December 2001 (bzip2, version 1.0.2pre1) 15 February 2005 (bzip2, version 1.0.3) 20 December 2006 (bzip2, version 1.0.4) +10 December 2007 (bzip2, version 1.0.5) + 6 Sept 2010 (bzip2, version 1.0.6) diff --git a/3rdparty/bzip2/blocksort.c b/3rdparty/bzip2/blocksort.c index c624b9820c..a7b193a559 100644 --- a/3rdparty/bzip2/blocksort.c +++ b/3rdparty/bzip2/blocksort.c @@ -8,8 +8,8 @@ This file is part of bzip2/libbzip2, a program and library for lossless, block-sorting data compression. - bzip2/libbzip2 version 1.0.4 of 20 December 2006 - Copyright (C) 1996-2006 Julian Seward + bzip2/libbzip2 version 1.0.6 of 6 September 2010 + Copyright (C) 1996-2010 Julian Seward Please read the WARNING, DISCLAIMER and PATENTS sections in the README file. diff --git a/3rdparty/bzip2/bzlib.c b/3rdparty/bzip2/bzlib.c index f57b3ccabc..b5f1c47704 100644 --- a/3rdparty/bzip2/bzlib.c +++ b/3rdparty/bzip2/bzlib.c @@ -8,8 +8,8 @@ This file is part of bzip2/libbzip2, a program and library for lossless, block-sorting data compression. - bzip2/libbzip2 version 1.0.4 of 20 December 2006 - Copyright (C) 1996-2006 Julian Seward + bzip2/libbzip2 version 1.0.6 of 6 September 2010 + Copyright (C) 1996-2010 Julian Seward Please read the WARNING, DISCLAIMER and PATENTS sections in the README file. @@ -48,7 +48,7 @@ void BZ2_bz__AssertH__fail ( int errcode ) "component, you should also report this bug to the author(s)\n" "of that program. Please make an effort to report this bug;\n" "timely and accurate bug reports eventually lead to higher\n" - "quality software. Thanks. Julian Seward, 15 February 2005.\n\n", + "quality software. Thanks. Julian Seward, 10 December 2007.\n\n", errcode, BZ2_bzlibVersion() ); @@ -598,6 +598,7 @@ Bool unRLE_obuf_to_output_FAST ( DState* s ) UInt32 c_tPos = s->tPos; char* cs_next_out = s->strm->next_out; unsigned int cs_avail_out = s->strm->avail_out; + Int32 ro_blockSize100k = s->blockSize100k; /* end restore */ UInt32 avail_out_INIT = cs_avail_out; diff --git a/3rdparty/bzip2/bzlib.h b/3rdparty/bzip2/bzlib.h index 4a48b52e10..9c72d2d9da 100644 --- a/3rdparty/bzip2/bzlib.h +++ b/3rdparty/bzip2/bzlib.h @@ -8,8 +8,8 @@ This file is part of bzip2/libbzip2, a program and library for lossless, block-sorting data compression. - bzip2/libbzip2 version 1.0.4 of 20 December 2006 - Copyright (C) 1996-2006 Julian Seward + bzip2/libbzip2 version 1.0.6 of 6 September 2010 + Copyright (C) 1996-2010 Julian Seward Please read the WARNING, DISCLAIMER and PATENTS sections in the README file. diff --git a/3rdparty/bzip2/bzlib_private.h b/3rdparty/bzip2/bzlib_private.h index 80865f06c7..019dd95dbc 100644 --- a/3rdparty/bzip2/bzlib_private.h +++ b/3rdparty/bzip2/bzlib_private.h @@ -8,8 +8,8 @@ This file is part of bzip2/libbzip2, a program and library for lossless, block-sorting data compression. - bzip2/libbzip2 version 1.0.4 of 20 December 2006 - Copyright (C) 1996-2006 Julian Seward + bzip2/libbzip2 version 1.0.6 of 6 September 2010 + Copyright (C) 1996-2010 Julian Seward Please read the WARNING, DISCLAIMER and PATENTS sections in the README file. @@ -36,7 +36,7 @@ /*-- General stuff. --*/ -#define BZ_VERSION "1.0.4, 20-Dec-2006" +#define BZ_VERSION "1.0.6, 6-Sept-2010" typedef char Char; typedef unsigned char Bool; @@ -442,11 +442,15 @@ typedef /*-- Macros for decompression. --*/ #define BZ_GET_FAST(cccc) \ + /* c_tPos is unsigned, hence test < 0 is pointless. */ \ + if (s->tPos >= (UInt32)100000 * (UInt32)s->blockSize100k) return True; \ s->tPos = s->tt[s->tPos]; \ cccc = (UChar)(s->tPos & 0xff); \ s->tPos >>= 8; #define BZ_GET_FAST_C(cccc) \ + /* c_tPos is unsigned, hence test < 0 is pointless. */ \ + if (c_tPos >= (UInt32)100000 * (UInt32)ro_blockSize100k) return True; \ c_tPos = c_tt[c_tPos]; \ cccc = (UChar)(c_tPos & 0xff); \ c_tPos >>= 8; @@ -469,8 +473,10 @@ typedef (((UInt32)s->ll16[i]) | (GET_LL4(i) << 16)) #define BZ_GET_SMALL(cccc) \ - cccc = BZ2_indexIntoF ( s->tPos, s->cftab ); \ - s->tPos = GET_LL(s->tPos); + /* c_tPos is unsigned, hence test < 0 is pointless. */ \ + if (s->tPos >= (UInt32)100000 * (UInt32)s->blockSize100k) return True; \ + cccc = BZ2_indexIntoF ( s->tPos, s->cftab ); \ + s->tPos = GET_LL(s->tPos); /*-- externs for decompression. --*/ diff --git a/3rdparty/bzip2/compress.c b/3rdparty/bzip2/compress.c index 26b671634c..81c18fa214 100644 --- a/3rdparty/bzip2/compress.c +++ b/3rdparty/bzip2/compress.c @@ -8,8 +8,8 @@ This file is part of bzip2/libbzip2, a program and library for lossless, block-sorting data compression. - bzip2/libbzip2 version 1.0.4 of 20 December 2006 - Copyright (C) 1996-2006 Julian Seward + bzip2/libbzip2 version 1.0.6 of 6 September 2010 + Copyright (C) 1996-2010 Julian Seward Please read the WARNING, DISCLAIMER and PATENTS sections in the README file. diff --git a/3rdparty/bzip2/crctable.c b/3rdparty/bzip2/crctable.c index edcd1031a3..868fc0123b 100644 --- a/3rdparty/bzip2/crctable.c +++ b/3rdparty/bzip2/crctable.c @@ -8,8 +8,8 @@ This file is part of bzip2/libbzip2, a program and library for lossless, block-sorting data compression. - bzip2/libbzip2 version 1.0.4 of 20 December 2006 - Copyright (C) 1996-2006 Julian Seward + bzip2/libbzip2 version 1.0.6 of 6 September 2010 + Copyright (C) 1996-2010 Julian Seward Please read the WARNING, DISCLAIMER and PATENTS sections in the README file. diff --git a/3rdparty/bzip2/decompress.c b/3rdparty/bzip2/decompress.c index 129d28bf6d..88065feb0b 100644 --- a/3rdparty/bzip2/decompress.c +++ b/3rdparty/bzip2/decompress.c @@ -8,8 +8,8 @@ This file is part of bzip2/libbzip2, a program and library for lossless, block-sorting data compression. - bzip2/libbzip2 version 1.0.4 of 20 December 2006 - Copyright (C) 1996-2006 Julian Seward + bzip2/libbzip2 version 1.0.6 of 6 September 2010 + Copyright (C) 1996-2010 Julian Seward Please read the WARNING, DISCLAIMER and PATENTS sections in the README file. @@ -381,6 +381,13 @@ Int32 BZ2_decompress ( DState* s ) es = -1; N = 1; do { + /* Check that N doesn't get too big, so that es doesn't + go negative. The maximum value that can be + RUNA/RUNB encoded is equal to the block size (post + the initial RLE), viz, 900k, so bounding N at 2 + million should guard against overflow without + rejecting any legitimate inputs. */ + if (N >= 2*1024*1024) RETURN(BZ_DATA_ERROR); if (nextSym == BZ_RUNA) es = es + (0+1) * N; else if (nextSym == BZ_RUNB) es = es + (1+1) * N; N = N * 2; @@ -485,15 +492,28 @@ Int32 BZ2_decompress ( DState* s ) RETURN(BZ_DATA_ERROR); /*-- Set up cftab to facilitate generation of T^(-1) --*/ + /* Check: unzftab entries in range. */ + for (i = 0; i <= 255; i++) { + if (s->unzftab[i] < 0 || s->unzftab[i] > nblock) + RETURN(BZ_DATA_ERROR); + } + /* Actually generate cftab. */ s->cftab[0] = 0; for (i = 1; i <= 256; i++) s->cftab[i] = s->unzftab[i-1]; for (i = 1; i <= 256; i++) s->cftab[i] += s->cftab[i-1]; + /* Check: cftab entries in range. */ for (i = 0; i <= 256; i++) { if (s->cftab[i] < 0 || s->cftab[i] > nblock) { /* s->cftab[i] can legitimately be == nblock */ RETURN(BZ_DATA_ERROR); } } + /* Check: cftab entries non-descending. */ + for (i = 1; i <= 256; i++) { + if (s->cftab[i-1] > s->cftab[i]) { + RETURN(BZ_DATA_ERROR); + } + } s->state_out_len = 0; s->state_out_ch = 0; diff --git a/3rdparty/bzip2/huffman.c b/3rdparty/bzip2/huffman.c index d271c8b36f..442051f15c 100644 --- a/3rdparty/bzip2/huffman.c +++ b/3rdparty/bzip2/huffman.c @@ -8,8 +8,8 @@ This file is part of bzip2/libbzip2, a program and library for lossless, block-sorting data compression. - bzip2/libbzip2 version 1.0.4 of 20 December 2006 - Copyright (C) 1996-2006 Julian Seward + bzip2/libbzip2 version 1.0.6 of 6 September 2010 + Copyright (C) 1996-2010 Julian Seward Please read the WARNING, DISCLAIMER and PATENTS sections in the README file. diff --git a/3rdparty/bzip2/randtable.c b/3rdparty/bzip2/randtable.c index 4b04adc973..90c5bd1e10 100644 --- a/3rdparty/bzip2/randtable.c +++ b/3rdparty/bzip2/randtable.c @@ -8,8 +8,8 @@ This file is part of bzip2/libbzip2, a program and library for lossless, block-sorting data compression. - bzip2/libbzip2 version 1.0.4 of 20 December 2006 - Copyright (C) 1996-2006 Julian Seward + bzip2/libbzip2 version 1.0.6 of 6 September 2010 + Copyright (C) 1996-2010 Julian Seward Please read the WARNING, DISCLAIMER and PATENTS sections in the README file. From 3ef69c7fe9c838ec3efaf5924a4d44d26a0f0ba1 Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Miguel=20A=2E=20Col=C3=B3n=20V=C3=A9lez?= Date: Sat, 22 Aug 2015 06:27:07 -0400 Subject: [PATCH 2/5] Update zlib 1.2.7 to 1.2.8. There were no local changes done to zlib. . The examples were added later and are from 1.2.8. . This syncs the library to the examples. --- 3rdparty/zlib/ChangeLog | 63 ++++++++++++++++++++++++++++++++++++++ 3rdparty/zlib/Makefile.am | 6 ---- 3rdparty/zlib/README | 6 ++-- 3rdparty/zlib/compress.c | 2 +- 3rdparty/zlib/deflate.c | 12 +++++--- 3rdparty/zlib/deflate.h | 2 +- 3rdparty/zlib/gzguts.h | 22 ++++++++++++-- 3rdparty/zlib/gzlib.c | 40 ++++++++++++++++-------- 3rdparty/zlib/gzread.c | 21 ++++++++----- 3rdparty/zlib/gzwrite.c | 64 +++++++++++++++++++++++---------------- 3rdparty/zlib/infback.c | 2 +- 3rdparty/zlib/inffast.c | 6 ++-- 3rdparty/zlib/inflate.c | 64 ++++++++++++++++++++++++--------------- 3rdparty/zlib/inftrees.c | 14 ++++----- 3rdparty/zlib/trees.c | 14 +++++---- 3rdparty/zlib/uncompr.c | 2 +- 3rdparty/zlib/zconf.h | 33 +++++++++++--------- 3rdparty/zlib/zlib.h | 48 +++++++++++++++++++++-------- 3rdparty/zlib/zutil.c | 2 +- 3rdparty/zlib/zutil.h | 9 +++--- 20 files changed, 293 insertions(+), 139 deletions(-) delete mode 100644 3rdparty/zlib/Makefile.am diff --git a/3rdparty/zlib/ChangeLog b/3rdparty/zlib/ChangeLog index c2c643a1a9..f22aabaef5 100644 --- a/3rdparty/zlib/ChangeLog +++ b/3rdparty/zlib/ChangeLog @@ -1,6 +1,69 @@ ChangeLog file for zlib +Changes in 1.2.8 (28 Apr 2013) +- Update contrib/minizip/iowin32.c for Windows RT [Vollant] +- Do not force Z_CONST for C++ +- Clean up contrib/vstudio [Ro§] +- Correct spelling error in zlib.h +- Fix mixed line endings in contrib/vstudio + +Changes in 1.2.7.3 (13 Apr 2013) +- Fix version numbers and DLL names in contrib/vstudio/*/zlib.rc + +Changes in 1.2.7.2 (13 Apr 2013) +- Change check for a four-byte type back to hexadecimal +- Fix typo in win32/Makefile.msc +- Add casts in gzwrite.c for pointer differences + +Changes in 1.2.7.1 (24 Mar 2013) +- Replace use of unsafe string functions with snprintf if available +- Avoid including stddef.h on Windows for Z_SOLO compile [Niessink] +- Fix gzgetc undefine when Z_PREFIX set [Turk] +- Eliminate use of mktemp in Makefile (not always available) +- Fix bug in 'F' mode for gzopen() +- Add inflateGetDictionary() function +- Correct comment in deflate.h +- Use _snprintf for snprintf in Microsoft C +- On Darwin, only use /usr/bin/libtool if libtool is not Apple +- Delete "--version" file if created by "ar --version" [Richard G.] +- Fix configure check for veracity of compiler error return codes +- Fix CMake compilation of static lib for MSVC2010 x64 +- Remove unused variable in infback9.c +- Fix argument checks in gzlog_compress() and gzlog_write() +- Clean up the usage of z_const and respect const usage within zlib +- Clean up examples/gzlog.[ch] comparisons of different types +- Avoid shift equal to bits in type (caused endless loop) +- Fix unintialized value bug in gzputc() introduced by const patches +- Fix memory allocation error in examples/zran.c [Nor] +- Fix bug where gzopen(), gzclose() would write an empty file +- Fix bug in gzclose() when gzwrite() runs out of memory +- Check for input buffer malloc failure in examples/gzappend.c +- Add note to contrib/blast to use binary mode in stdio +- Fix comparisons of differently signed integers in contrib/blast +- Check for invalid code length codes in contrib/puff +- Fix serious but very rare decompression bug in inftrees.c +- Update inflateBack() comments, since inflate() can be faster +- Use underscored I/O function names for WINAPI_FAMILY +- Add _tr_flush_bits to the external symbols prefixed by --zprefix +- Add contrib/vstudio/vc10 pre-build step for static only +- Quote --version-script argument in CMakeLists.txt +- Don't specify --version-script on Apple platforms in CMakeLists.txt +- Fix casting error in contrib/testzlib/testzlib.c +- Fix types in contrib/minizip to match result of get_crc_table() +- Simplify contrib/vstudio/vc10 with 'd' suffix +- Add TOP support to win32/Makefile.msc +- Suport i686 and amd64 assembler builds in CMakeLists.txt +- Fix typos in the use of _LARGEFILE64_SOURCE in zconf.h +- Add vc11 and vc12 build files to contrib/vstudio +- Add gzvprintf() as an undocumented function in zlib +- Fix configure for Sun shell +- Remove runtime check in configure for four-byte integer type +- Add casts and consts to ease user conversion to C++ +- Add man pages for minizip and miniunzip +- In Makefile uninstall, don't rm if preceding cd fails +- Do not return Z_BUF_ERROR if deflateParam() has nothing to write + Changes in 1.2.7 (2 May 2012) - Replace use of memmove() with a simple copy for portability - Test for existence of strerror diff --git a/3rdparty/zlib/Makefile.am b/3rdparty/zlib/Makefile.am deleted file mode 100644 index ff26496e22..0000000000 --- a/3rdparty/zlib/Makefile.am +++ /dev/null @@ -1,6 +0,0 @@ -noinst_LIBRARIES = libpcsx2zlib.a - -libpcsx2zlib_a_SOURCES = \ -adler32.c crc32.c deflate.h inffast.c inflate.c inftrees.h trees.h zlib.h \ -crc32.h gzio.c inffast.h inflate.h uncompr.c zutil.c \ -compress.c deflate.c infback.c inffixed.h inftrees.c trees.c zconf.h zutil.h diff --git a/3rdparty/zlib/README b/3rdparty/zlib/README index 6f1255ffe4..5ca9d127ed 100644 --- a/3rdparty/zlib/README +++ b/3rdparty/zlib/README @@ -1,6 +1,6 @@ ZLIB DATA COMPRESSION LIBRARY -zlib 1.2.7 is a general purpose data compression library. All the code is +zlib 1.2.8 is a general purpose data compression library. All the code is thread safe. The data format used by the zlib library is described by RFCs (Request for Comments) 1950 to 1952 in the files http://tools.ietf.org/html/rfc1950 (zlib format), rfc1951 (deflate format) and @@ -31,7 +31,7 @@ Mark Nelson wrote an article about zlib for the Jan. 1997 issue of Dr. Dobb's Journal; a copy of the article is available at http://marknelson.us/1997/01/01/zlib-engine/ . -The changes made in version 1.2.7 are documented in the file ChangeLog. +The changes made in version 1.2.8 are documented in the file ChangeLog. Unsupported third party contributions are provided in directory contrib/ . @@ -84,7 +84,7 @@ Acknowledgments: Copyright notice: - (C) 1995-2012 Jean-loup Gailly and Mark Adler + (C) 1995-2013 Jean-loup Gailly and Mark Adler This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages diff --git a/3rdparty/zlib/compress.c b/3rdparty/zlib/compress.c index ea4dfbe9d7..6e9762676a 100644 --- a/3rdparty/zlib/compress.c +++ b/3rdparty/zlib/compress.c @@ -29,7 +29,7 @@ int ZEXPORT compress2 (dest, destLen, source, sourceLen, level) z_stream stream; int err; - stream.next_in = (Bytef*)source; + stream.next_in = (z_const Bytef *)source; stream.avail_in = (uInt)sourceLen; #ifdef MAXSEG_64K /* Check for source > 64K on 16-bit machine: */ diff --git a/3rdparty/zlib/deflate.c b/3rdparty/zlib/deflate.c index 9e4c2cbc8a..696957705b 100644 --- a/3rdparty/zlib/deflate.c +++ b/3rdparty/zlib/deflate.c @@ -1,5 +1,5 @@ /* deflate.c -- compress data using the deflation algorithm - * Copyright (C) 1995-2012 Jean-loup Gailly and Mark Adler + * Copyright (C) 1995-2013 Jean-loup Gailly and Mark Adler * For conditions of distribution and use, see copyright notice in zlib.h */ @@ -52,7 +52,7 @@ #include "deflate.h" const char deflate_copyright[] = - " deflate 1.2.7 Copyright 1995-2012 Jean-loup Gailly and Mark Adler "; + " deflate 1.2.8 Copyright 1995-2013 Jean-loup Gailly and Mark Adler "; /* If you use the zlib library in a product, an acknowledgment is welcome in the documentation of your product. If for some reason you cannot @@ -305,7 +305,7 @@ int ZEXPORT deflateInit2_(strm, level, method, windowBits, memLevel, strategy, if (s->window == Z_NULL || s->prev == Z_NULL || s->head == Z_NULL || s->pending_buf == Z_NULL) { s->status = FINISH_STATE; - strm->msg = (char*)ERR_MSG(Z_MEM_ERROR); + strm->msg = ERR_MSG(Z_MEM_ERROR); deflateEnd (strm); return Z_MEM_ERROR; } @@ -329,7 +329,7 @@ int ZEXPORT deflateSetDictionary (strm, dictionary, dictLength) uInt str, n; int wrap; unsigned avail; - unsigned char *next; + z_const unsigned char *next; if (strm == Z_NULL || strm->state == Z_NULL || dictionary == Z_NULL) return Z_STREAM_ERROR; @@ -359,7 +359,7 @@ int ZEXPORT deflateSetDictionary (strm, dictionary, dictLength) avail = strm->avail_in; next = strm->next_in; strm->avail_in = dictLength; - strm->next_in = (Bytef *)dictionary; + strm->next_in = (z_const Bytef *)dictionary; fill_window(s); while (s->lookahead >= MIN_MATCH) { str = s->strstart; @@ -513,6 +513,8 @@ int ZEXPORT deflateParams(strm, level, strategy) strm->total_in != 0) { /* Flush the last buffer: */ err = deflate(strm, Z_BLOCK); + if (err == Z_BUF_ERROR && s->pending == 0) + err = Z_OK; } if (s->level != level) { s->level = level; diff --git a/3rdparty/zlib/deflate.h b/3rdparty/zlib/deflate.h index fbac44d908..ce0299edd1 100644 --- a/3rdparty/zlib/deflate.h +++ b/3rdparty/zlib/deflate.h @@ -104,7 +104,7 @@ typedef struct internal_state { int wrap; /* bit 0 true for zlib, bit 1 true for gzip */ gz_headerp gzhead; /* gzip header information to write */ uInt gzindex; /* where in extra, name, or comment */ - Byte method; /* STORED (for zip only) or DEFLATED */ + Byte method; /* can only be DEFLATED */ int last_flush; /* value of flush param for previous deflate call */ /* used by deflate.c: */ diff --git a/3rdparty/zlib/gzguts.h b/3rdparty/zlib/gzguts.h index ee3f281aa5..d87659d031 100644 --- a/3rdparty/zlib/gzguts.h +++ b/3rdparty/zlib/gzguts.h @@ -1,5 +1,5 @@ /* gzguts.h -- zlib internal header definitions for gz* operations - * Copyright (C) 2004, 2005, 2010, 2011, 2012 Mark Adler + * Copyright (C) 2004, 2005, 2010, 2011, 2012, 2013 Mark Adler * For conditions of distribution and use, see copyright notice in zlib.h */ @@ -35,6 +35,13 @@ # include #endif +#ifdef WINAPI_FAMILY +# define open _open +# define read _read +# define write _write +# define close _close +#endif + #ifdef NO_DEFLATE /* for compatibility with old definition */ # define NO_GZCOMPRESS #endif @@ -60,7 +67,7 @@ #ifndef HAVE_VSNPRINTF # ifdef MSDOS /* vsnprintf may exist on some MS-DOS compilers (DJGPP?), - but for now we just assume it doesn't. */ + but for now we just assume it doesn't. */ # define NO_vsnprintf # endif # ifdef __TURBOC__ @@ -88,6 +95,14 @@ # endif #endif +/* unlike snprintf (which is required in C99, yet still not supported by + Microsoft more than a decade later!), _snprintf does not guarantee null + termination of the result -- however this is only used in gzlib.c where + the result is assured to fit in the space provided */ +#ifdef _MSC_VER +# define snprintf _snprintf +#endif + #ifndef local # define local static #endif @@ -127,7 +142,8 @@ # define DEF_MEM_LEVEL MAX_MEM_LEVEL #endif -/* default i/o buffer size -- double this for output when reading */ +/* default i/o buffer size -- double this for output when reading (this and + twice this must be able to fit in an unsigned type) */ #define GZBUFSIZE 8192 /* gzip modes, also provide a little integrity check on the passed structure */ diff --git a/3rdparty/zlib/gzlib.c b/3rdparty/zlib/gzlib.c index ca55c6ea92..fae202ef89 100644 --- a/3rdparty/zlib/gzlib.c +++ b/3rdparty/zlib/gzlib.c @@ -1,5 +1,5 @@ /* gzlib.c -- zlib functions common to reading and writing gzip files - * Copyright (C) 2004, 2010, 2011, 2012 Mark Adler + * Copyright (C) 2004, 2010, 2011, 2012, 2013 Mark Adler * For conditions of distribution and use, see copyright notice in zlib.h */ @@ -108,7 +108,7 @@ local gzFile gz_open(path, fd, mode) return NULL; /* allocate gzFile structure to return */ - state = malloc(sizeof(gz_state)); + state = (gz_statep)malloc(sizeof(gz_state)); if (state == NULL) return NULL; state->size = 0; /* no buffers allocated yet */ @@ -162,8 +162,10 @@ local gzFile gz_open(path, fd, mode) break; case 'F': state->strategy = Z_FIXED; + break; case 'T': state->direct = 1; + break; default: /* could consider as an error, but just ignore */ ; } @@ -194,8 +196,8 @@ local gzFile gz_open(path, fd, mode) } else #endif - len = strlen(path); - state->path = malloc(len + 1); + len = strlen((const char *)path); + state->path = (char *)malloc(len + 1); if (state->path == NULL) { free(state); return NULL; @@ -208,7 +210,11 @@ local gzFile gz_open(path, fd, mode) *(state->path) = 0; else #endif +#if !defined(NO_snprintf) && !defined(NO_vsnprintf) + snprintf(state->path, len + 1, "%s", (const char *)path); +#else strcpy(state->path, path); +#endif /* compute the flags for open() */ oflag = @@ -236,7 +242,7 @@ local gzFile gz_open(path, fd, mode) #ifdef _WIN32 fd == -2 ? _wopen(path, oflag, 0666) : #endif - open(path, oflag, 0666)); + open((const char *)path, oflag, 0666)); if (state->fd == -1) { free(state->path); free(state); @@ -282,9 +288,13 @@ gzFile ZEXPORT gzdopen(fd, mode) char *path; /* identifier for error messages */ gzFile gz; - if (fd == -1 || (path = malloc(7 + 3 * sizeof(int))) == NULL) + if (fd == -1 || (path = (char *)malloc(7 + 3 * sizeof(int))) == NULL) return NULL; +#if !defined(NO_snprintf) && !defined(NO_vsnprintf) + snprintf(path, 7 + 3 * sizeof(int), "", fd); /* for debugging */ +#else sprintf(path, "", fd); /* for debugging */ +#endif gz = gz_open(path, fd, mode); free(path); return gz; @@ -531,7 +541,8 @@ const char * ZEXPORT gzerror(file, errnum) /* return error information */ if (errnum != NULL) *errnum = state->err; - return state->msg == NULL ? "" : state->msg; + return state->err == Z_MEM_ERROR ? "out of memory" : + (state->msg == NULL ? "" : state->msg); } /* -- see zlib.h -- */ @@ -582,21 +593,24 @@ void ZLIB_INTERNAL gz_error(state, err, msg) if (msg == NULL) return; - /* for an out of memory error, save as static string */ - if (err == Z_MEM_ERROR) { - state->msg = (char *)msg; + /* for an out of memory error, return literal string when requested */ + if (err == Z_MEM_ERROR) return; - } /* construct error message with path */ - if ((state->msg = malloc(strlen(state->path) + strlen(msg) + 3)) == NULL) { + if ((state->msg = (char *)malloc(strlen(state->path) + strlen(msg) + 3)) == + NULL) { state->err = Z_MEM_ERROR; - state->msg = (char *)"out of memory"; return; } +#if !defined(NO_snprintf) && !defined(NO_vsnprintf) + snprintf(state->msg, strlen(state->path) + strlen(msg) + 3, + "%s%s%s", state->path, ": ", msg); +#else strcpy(state->msg, state->path); strcat(state->msg, ": "); strcat(state->msg, msg); +#endif return; } diff --git a/3rdparty/zlib/gzread.c b/3rdparty/zlib/gzread.c index 3493d34d4e..bf4538eb27 100644 --- a/3rdparty/zlib/gzread.c +++ b/3rdparty/zlib/gzread.c @@ -1,5 +1,5 @@ /* gzread.c -- zlib functions for reading gzip files - * Copyright (C) 2004, 2005, 2010, 2011, 2012 Mark Adler + * Copyright (C) 2004, 2005, 2010, 2011, 2012, 2013 Mark Adler * For conditions of distribution and use, see copyright notice in zlib.h */ @@ -58,7 +58,8 @@ local int gz_avail(state) return -1; if (state->eof == 0) { if (strm->avail_in) { /* copy what's there to the start */ - unsigned char *p = state->in, *q = strm->next_in; + unsigned char *p = state->in; + unsigned const char *q = strm->next_in; unsigned n = strm->avail_in; do { *p++ = *q++; @@ -90,8 +91,8 @@ local int gz_look(state) /* allocate read buffers and inflate memory */ if (state->size == 0) { /* allocate buffers */ - state->in = malloc(state->want); - state->out = malloc(state->want << 1); + state->in = (unsigned char *)malloc(state->want); + state->out = (unsigned char *)malloc(state->want << 1); if (state->in == NULL || state->out == NULL) { if (state->out != NULL) free(state->out); @@ -352,14 +353,14 @@ int ZEXPORT gzread(file, buf, len) /* large len -- read directly into user buffer */ else if (state->how == COPY) { /* read directly */ - if (gz_load(state, buf, len, &n) == -1) + if (gz_load(state, (unsigned char *)buf, len, &n) == -1) return -1; } /* large len -- decompress directly into user buffer */ else { /* state->how == GZIP */ strm->avail_out = len; - strm->next_out = buf; + strm->next_out = (unsigned char *)buf; if (gz_decomp(state) == -1) return -1; n = state->x.have; @@ -378,7 +379,11 @@ int ZEXPORT gzread(file, buf, len) } /* -- see zlib.h -- */ -#undef gzgetc +#ifdef Z_PREFIX_SET +# undef z_gzgetc +#else +# undef gzgetc +#endif int ZEXPORT gzgetc(file) gzFile file; { @@ -518,7 +523,7 @@ char * ZEXPORT gzgets(file, buf, len) /* look for end-of-line in current output buffer */ n = state->x.have > left ? left : state->x.have; - eol = memchr(state->x.next, '\n', n); + eol = (unsigned char *)memchr(state->x.next, '\n', n); if (eol != NULL) n = (unsigned)(eol - state->x.next) + 1; diff --git a/3rdparty/zlib/gzwrite.c b/3rdparty/zlib/gzwrite.c index 27cb3428e3..aa767fbf63 100644 --- a/3rdparty/zlib/gzwrite.c +++ b/3rdparty/zlib/gzwrite.c @@ -1,5 +1,5 @@ /* gzwrite.c -- zlib functions for writing gzip files - * Copyright (C) 2004, 2005, 2010, 2011, 2012 Mark Adler + * Copyright (C) 2004, 2005, 2010, 2011, 2012, 2013 Mark Adler * For conditions of distribution and use, see copyright notice in zlib.h */ @@ -19,7 +19,7 @@ local int gz_init(state) z_streamp strm = &(state->strm); /* allocate input buffer */ - state->in = malloc(state->want); + state->in = (unsigned char *)malloc(state->want); if (state->in == NULL) { gz_error(state, Z_MEM_ERROR, "out of memory"); return -1; @@ -28,7 +28,7 @@ local int gz_init(state) /* only need output buffer and deflate state if compressing */ if (!state->direct) { /* allocate output buffer */ - state->out = malloc(state->want); + state->out = (unsigned char *)malloc(state->want); if (state->out == NULL) { free(state->in); gz_error(state, Z_MEM_ERROR, "out of memory"); @@ -168,7 +168,6 @@ int ZEXPORT gzwrite(file, buf, len) unsigned len; { unsigned put = len; - unsigned n; gz_statep state; z_streamp strm; @@ -208,16 +207,19 @@ int ZEXPORT gzwrite(file, buf, len) if (len < state->size) { /* copy to input buffer, compress when full */ do { + unsigned have, copy; + if (strm->avail_in == 0) strm->next_in = state->in; - n = state->size - strm->avail_in; - if (n > len) - n = len; - memcpy(strm->next_in + strm->avail_in, buf, n); - strm->avail_in += n; - state->x.pos += n; - buf = (char *)buf + n; - len -= n; + have = (unsigned)((strm->next_in + strm->avail_in) - state->in); + copy = state->size - have; + if (copy > len) + copy = len; + memcpy(state->in + have, buf, copy); + strm->avail_in += copy; + state->x.pos += copy; + buf = (const char *)buf + copy; + len -= copy; if (len && gz_comp(state, Z_NO_FLUSH) == -1) return 0; } while (len); @@ -229,7 +231,7 @@ int ZEXPORT gzwrite(file, buf, len) /* directly compress user buffer to file */ strm->avail_in = len; - strm->next_in = (voidp)buf; + strm->next_in = (z_const Bytef *)buf; state->x.pos += len; if (gz_comp(state, Z_NO_FLUSH) == -1) return 0; @@ -244,6 +246,7 @@ int ZEXPORT gzputc(file, c) gzFile file; int c; { + unsigned have; unsigned char buf[1]; gz_statep state; z_streamp strm; @@ -267,12 +270,16 @@ int ZEXPORT gzputc(file, c) /* try writing to input buffer for speed (state->size == 0 if buffer not initialized) */ - if (strm->avail_in < state->size) { + if (state->size) { if (strm->avail_in == 0) strm->next_in = state->in; - strm->next_in[strm->avail_in++] = c; - state->x.pos++; - return c & 0xff; + have = (unsigned)((strm->next_in + strm->avail_in) - state->in); + if (have < state->size) { + state->in[have] = c; + strm->avail_in++; + state->x.pos++; + return c & 0xff; + } } /* no room in buffer or not initialized, use gz_write() */ @@ -300,12 +307,11 @@ int ZEXPORT gzputs(file, str) #include /* -- see zlib.h -- */ -int ZEXPORTVA gzprintf (gzFile file, const char *format, ...) +int ZEXPORTVA gzvprintf(gzFile file, const char *format, va_list va) { int size, len; gz_statep state; z_streamp strm; - va_list va; /* get internal structure */ if (file == NULL) @@ -335,25 +341,20 @@ int ZEXPORTVA gzprintf (gzFile file, const char *format, ...) /* do the printf() into the input buffer, put length in len */ size = (int)(state->size); state->in[size - 1] = 0; - va_start(va, format); #ifdef NO_vsnprintf # ifdef HAS_vsprintf_void (void)vsprintf((char *)(state->in), format, va); - va_end(va); for (len = 0; len < size; len++) if (state->in[len] == 0) break; # else len = vsprintf((char *)(state->in), format, va); - va_end(va); # endif #else # ifdef HAS_vsnprintf_void (void)vsnprintf((char *)(state->in), size, format, va); - va_end(va); len = strlen((char *)(state->in)); # else len = vsnprintf((char *)(state->in), size, format, va); - va_end(va); # endif #endif @@ -368,6 +369,17 @@ int ZEXPORTVA gzprintf (gzFile file, const char *format, ...) return len; } +int ZEXPORTVA gzprintf(gzFile file, const char *format, ...) +{ + va_list va; + int ret; + + va_start(va, format); + ret = gzvprintf(file, format, va); + va_end(va); + return ret; +} + #else /* !STDC && !Z_HAVE_STDARG_H */ /* -- see zlib.h -- */ @@ -547,9 +559,9 @@ int ZEXPORT gzclose_w(file) } /* flush, free memory, and close file */ + if (gz_comp(state, Z_FINISH) == -1) + ret = state->err; if (state->size) { - if (gz_comp(state, Z_FINISH) == -1) - ret = state->err; if (!state->direct) { (void)deflateEnd(&(state->strm)); free(state->out); diff --git a/3rdparty/zlib/infback.c b/3rdparty/zlib/infback.c index 981aff17c2..f3833c2e43 100644 --- a/3rdparty/zlib/infback.c +++ b/3rdparty/zlib/infback.c @@ -255,7 +255,7 @@ out_func out; void FAR *out_desc; { struct inflate_state FAR *state; - unsigned char FAR *next; /* next input */ + z_const unsigned char FAR *next; /* next input */ unsigned char FAR *put; /* next output */ unsigned have, left; /* available input and output */ unsigned long hold; /* bit buffer */ diff --git a/3rdparty/zlib/inffast.c b/3rdparty/zlib/inffast.c index 2f1d60b43b..bda59ceb6a 100644 --- a/3rdparty/zlib/inffast.c +++ b/3rdparty/zlib/inffast.c @@ -1,5 +1,5 @@ /* inffast.c -- fast decoding - * Copyright (C) 1995-2008, 2010 Mark Adler + * Copyright (C) 1995-2008, 2010, 2013 Mark Adler * For conditions of distribution and use, see copyright notice in zlib.h */ @@ -69,8 +69,8 @@ z_streamp strm; unsigned start; /* inflate()'s starting value for strm->avail_out */ { struct inflate_state FAR *state; - unsigned char FAR *in; /* local strm->next_in */ - unsigned char FAR *last; /* while in < last, enough input available */ + z_const unsigned char FAR *in; /* local strm->next_in */ + z_const unsigned char FAR *last; /* have enough input while in < last */ unsigned char FAR *out; /* local strm->next_out */ unsigned char FAR *beg; /* inflate()'s initial strm->next_out */ unsigned char FAR *end; /* while out < end, enough space available */ diff --git a/3rdparty/zlib/inflate.c b/3rdparty/zlib/inflate.c index 47418a1e1e..870f89bb4d 100644 --- a/3rdparty/zlib/inflate.c +++ b/3rdparty/zlib/inflate.c @@ -93,11 +93,12 @@ /* function prototypes */ local void fixedtables OF((struct inflate_state FAR *state)); -local int updatewindow OF((z_streamp strm, unsigned out)); +local int updatewindow OF((z_streamp strm, const unsigned char FAR *end, + unsigned copy)); #ifdef BUILDFIXED void makefixed OF((void)); #endif -local unsigned syncsearch OF((unsigned FAR *have, unsigned char FAR *buf, +local unsigned syncsearch OF((unsigned FAR *have, const unsigned char FAR *buf, unsigned len)); int ZEXPORT inflateResetKeep(strm) @@ -375,12 +376,13 @@ void makefixed() output will fall in the output data, making match copies simpler and faster. The advantage may be dependent on the size of the processor's data caches. */ -local int updatewindow(strm, out) +local int updatewindow(strm, end, copy) z_streamp strm; -unsigned out; +const Bytef *end; +unsigned copy; { struct inflate_state FAR *state; - unsigned copy, dist; + unsigned dist; state = (struct inflate_state FAR *)strm->state; @@ -400,19 +402,18 @@ unsigned out; } /* copy state->wsize or less output bytes into the circular window */ - copy = out - strm->avail_out; if (copy >= state->wsize) { - zmemcpy(state->window, strm->next_out - state->wsize, state->wsize); + zmemcpy(state->window, end - state->wsize, state->wsize); state->wnext = 0; state->whave = state->wsize; } else { dist = state->wsize - state->wnext; if (dist > copy) dist = copy; - zmemcpy(state->window + state->wnext, strm->next_out - copy, dist); + zmemcpy(state->window + state->wnext, end - copy, dist); copy -= dist; if (copy) { - zmemcpy(state->window, strm->next_out - copy, copy); + zmemcpy(state->window, end - copy, copy); state->wnext = copy; state->whave = state->wsize; } @@ -606,7 +607,7 @@ z_streamp strm; int flush; { struct inflate_state FAR *state; - unsigned char FAR *next; /* next input */ + z_const unsigned char FAR *next; /* next input */ unsigned char FAR *put; /* next output */ unsigned have, left; /* available input and output */ unsigned long hold; /* bit buffer */ @@ -920,7 +921,7 @@ int flush; while (state->have < 19) state->lens[order[state->have++]] = 0; state->next = state->codes; - state->lencode = (code const FAR *)(state->next); + state->lencode = (const code FAR *)(state->next); state->lenbits = 7; ret = inflate_table(CODES, state->lens, 19, &(state->next), &(state->lenbits), state->work); @@ -994,7 +995,7 @@ int flush; values here (9 and 6) without reading the comments in inftrees.h concerning the ENOUGH constants, which depend on those values */ state->next = state->codes; - state->lencode = (code const FAR *)(state->next); + state->lencode = (const code FAR *)(state->next); state->lenbits = 9; ret = inflate_table(LENS, state->lens, state->nlen, &(state->next), &(state->lenbits), state->work); @@ -1003,7 +1004,7 @@ int flush; state->mode = BAD; break; } - state->distcode = (code const FAR *)(state->next); + state->distcode = (const code FAR *)(state->next); state->distbits = 6; ret = inflate_table(DISTS, state->lens + state->nlen, state->ndist, &(state->next), &(state->distbits), state->work); @@ -1230,7 +1231,7 @@ int flush; RESTORE(); if (state->wsize || (out != strm->avail_out && state->mode < BAD && (state->mode < CHECK || flush != Z_FINISH))) - if (updatewindow(strm, out)) { + if (updatewindow(strm, strm->next_out, out - strm->avail_out)) { state->mode = MEM; return Z_MEM_ERROR; } @@ -1264,6 +1265,29 @@ z_streamp strm; return Z_OK; } +int ZEXPORT inflateGetDictionary(strm, dictionary, dictLength) +z_streamp strm; +Bytef *dictionary; +uInt *dictLength; +{ + struct inflate_state FAR *state; + + /* check state */ + if (strm == Z_NULL || strm->state == Z_NULL) return Z_STREAM_ERROR; + state = (struct inflate_state FAR *)strm->state; + + /* copy dictionary */ + if (state->whave && dictionary != Z_NULL) { + zmemcpy(dictionary, state->window + state->wnext, + state->whave - state->wnext); + zmemcpy(dictionary + state->whave - state->wnext, + state->window, state->wnext); + } + if (dictLength != Z_NULL) + *dictLength = state->whave; + return Z_OK; +} + int ZEXPORT inflateSetDictionary(strm, dictionary, dictLength) z_streamp strm; const Bytef *dictionary; @@ -1271,8 +1295,6 @@ uInt dictLength; { struct inflate_state FAR *state; unsigned long dictid; - unsigned char *next; - unsigned avail; int ret; /* check state */ @@ -1291,13 +1313,7 @@ uInt dictLength; /* copy dictionary to window using updatewindow(), which will amend the existing dictionary if appropriate */ - next = strm->next_out; - avail = strm->avail_out; - strm->next_out = (Bytef *)dictionary + dictLength; - strm->avail_out = 0; - ret = updatewindow(strm, dictLength); - strm->avail_out = avail; - strm->next_out = next; + ret = updatewindow(strm, dictionary + dictLength, dictLength); if (ret) { state->mode = MEM; return Z_MEM_ERROR; @@ -1337,7 +1353,7 @@ gz_headerp head; */ local unsigned syncsearch(have, buf, len) unsigned FAR *have; -unsigned char FAR *buf; +const unsigned char FAR *buf; unsigned len; { unsigned got; diff --git a/3rdparty/zlib/inftrees.c b/3rdparty/zlib/inftrees.c index abcd7c45ed..44d89cf24e 100644 --- a/3rdparty/zlib/inftrees.c +++ b/3rdparty/zlib/inftrees.c @@ -1,5 +1,5 @@ /* inftrees.c -- generate Huffman trees for efficient decoding - * Copyright (C) 1995-2012 Mark Adler + * Copyright (C) 1995-2013 Mark Adler * For conditions of distribution and use, see copyright notice in zlib.h */ @@ -9,7 +9,7 @@ #define MAXBITS 15 const char inflate_copyright[] = - " inflate 1.2.7 Copyright 1995-2012 Mark Adler "; + " inflate 1.2.8 Copyright 1995-2013 Mark Adler "; /* If you use the zlib library in a product, an acknowledgment is welcome in the documentation of your product. If for some reason you cannot @@ -62,7 +62,7 @@ unsigned short FAR *work; 35, 43, 51, 59, 67, 83, 99, 115, 131, 163, 195, 227, 258, 0, 0}; static const unsigned short lext[31] = { /* Length codes 257..285 extra */ 16, 16, 16, 16, 16, 16, 16, 16, 17, 17, 17, 17, 18, 18, 18, 18, - 19, 19, 19, 19, 20, 20, 20, 20, 21, 21, 21, 21, 16, 78, 68}; + 19, 19, 19, 19, 20, 20, 20, 20, 21, 21, 21, 21, 16, 72, 78}; static const unsigned short dbase[32] = { /* Distance codes 0..29 base */ 1, 2, 3, 4, 5, 7, 9, 13, 17, 25, 33, 49, 65, 97, 129, 193, 257, 385, 513, 769, 1025, 1537, 2049, 3073, 4097, 6145, @@ -208,8 +208,8 @@ unsigned short FAR *work; mask = used - 1; /* mask for comparing low */ /* check available table space */ - if ((type == LENS && used >= ENOUGH_LENS) || - (type == DISTS && used >= ENOUGH_DISTS)) + if ((type == LENS && used > ENOUGH_LENS) || + (type == DISTS && used > ENOUGH_DISTS)) return 1; /* process all codes and make table entries */ @@ -277,8 +277,8 @@ unsigned short FAR *work; /* check for enough space */ used += 1U << curr; - if ((type == LENS && used >= ENOUGH_LENS) || - (type == DISTS && used >= ENOUGH_DISTS)) + if ((type == LENS && used > ENOUGH_LENS) || + (type == DISTS && used > ENOUGH_DISTS)) return 1; /* point entry in root table to sub-table */ diff --git a/3rdparty/zlib/trees.c b/3rdparty/zlib/trees.c index 8c32b214b1..1fd7759ef0 100644 --- a/3rdparty/zlib/trees.c +++ b/3rdparty/zlib/trees.c @@ -146,8 +146,8 @@ local void send_tree OF((deflate_state *s, ct_data *tree, int max_code)); local int build_bl_tree OF((deflate_state *s)); local void send_all_trees OF((deflate_state *s, int lcodes, int dcodes, int blcodes)); -local void compress_block OF((deflate_state *s, ct_data *ltree, - ct_data *dtree)); +local void compress_block OF((deflate_state *s, const ct_data *ltree, + const ct_data *dtree)); local int detect_data_type OF((deflate_state *s)); local unsigned bi_reverse OF((unsigned value, int length)); local void bi_windup OF((deflate_state *s)); @@ -972,7 +972,8 @@ void ZLIB_INTERNAL _tr_flush_block(s, buf, stored_len, last) } else if (s->strategy == Z_FIXED || static_lenb == opt_lenb) { #endif send_bits(s, (STATIC_TREES<<1)+last, 3); - compress_block(s, (ct_data *)static_ltree, (ct_data *)static_dtree); + compress_block(s, (const ct_data *)static_ltree, + (const ct_data *)static_dtree); #ifdef DEBUG s->compressed_len += 3 + s->static_len; #endif @@ -980,7 +981,8 @@ void ZLIB_INTERNAL _tr_flush_block(s, buf, stored_len, last) send_bits(s, (DYN_TREES<<1)+last, 3); send_all_trees(s, s->l_desc.max_code+1, s->d_desc.max_code+1, max_blindex+1); - compress_block(s, (ct_data *)s->dyn_ltree, (ct_data *)s->dyn_dtree); + compress_block(s, (const ct_data *)s->dyn_ltree, + (const ct_data *)s->dyn_dtree); #ifdef DEBUG s->compressed_len += 3 + s->opt_len; #endif @@ -1057,8 +1059,8 @@ int ZLIB_INTERNAL _tr_tally (s, dist, lc) */ local void compress_block(s, ltree, dtree) deflate_state *s; - ct_data *ltree; /* literal tree */ - ct_data *dtree; /* distance tree */ + const ct_data *ltree; /* literal tree */ + const ct_data *dtree; /* distance tree */ { unsigned dist; /* distance of matched string */ int lc; /* match length or unmatched char (if dist == 0) */ diff --git a/3rdparty/zlib/uncompr.c b/3rdparty/zlib/uncompr.c index ad98be3a5d..242e9493df 100644 --- a/3rdparty/zlib/uncompr.c +++ b/3rdparty/zlib/uncompr.c @@ -30,7 +30,7 @@ int ZEXPORT uncompress (dest, destLen, source, sourceLen) z_stream stream; int err; - stream.next_in = (Bytef*)source; + stream.next_in = (z_const Bytef *)source; stream.avail_in = (uInt)sourceLen; /* Check for source > 64K on 16-bit machine: */ if ((uLong)stream.avail_in != sourceLen) return Z_BUF_ERROR; diff --git a/3rdparty/zlib/zconf.h b/3rdparty/zlib/zconf.h index 8a46a58b30..9987a77553 100644 --- a/3rdparty/zlib/zconf.h +++ b/3rdparty/zlib/zconf.h @@ -1,5 +1,5 @@ /* zconf.h -- configuration of the zlib compression library - * Copyright (C) 1995-2012 Jean-loup Gailly. + * Copyright (C) 1995-2013 Jean-loup Gailly. * For conditions of distribution and use, see copyright notice in zlib.h */ @@ -21,6 +21,7 @@ # define _dist_code z__dist_code # define _length_code z__length_code # define _tr_align z__tr_align +# define _tr_flush_bits z__tr_flush_bits # define _tr_flush_block z__tr_flush_block # define _tr_init z__tr_init # define _tr_stored_block z__tr_stored_block @@ -77,6 +78,7 @@ # define gzopen_w z_gzopen_w # endif # define gzprintf z_gzprintf +# define gzvprintf z_gzvprintf # define gzputc z_gzputc # define gzputs z_gzputs # define gzread z_gzread @@ -103,6 +105,7 @@ # define inflateReset z_inflateReset # define inflateReset2 z_inflateReset2 # define inflateSetDictionary z_inflateSetDictionary +# define inflateGetDictionary z_inflateGetDictionary # define inflateSync z_inflateSync # define inflateSyncPoint z_inflateSyncPoint # define inflateUndermine z_inflateUndermine @@ -388,20 +391,14 @@ typedef uLong FAR uLongf; typedef Byte *voidp; #endif -/* ./configure may #define Z_U4 here */ - #if !defined(Z_U4) && !defined(Z_SOLO) && defined(STDC) # include # if (UINT_MAX == 0xffffffffUL) # define Z_U4 unsigned -# else -# if (ULONG_MAX == 0xffffffffUL) -# define Z_U4 unsigned long -# else -# if (USHRT_MAX == 0xffffffffUL) -# define Z_U4 unsigned short -# endif -# endif +# elif (ULONG_MAX == 0xffffffffUL) +# define Z_U4 unsigned long +# elif (USHRT_MAX == 0xffffffffUL) +# define Z_U4 unsigned short # endif #endif @@ -425,8 +422,16 @@ typedef uLong FAR uLongf; # endif #endif +#if defined(STDC) || defined(Z_HAVE_STDARG_H) +# ifndef Z_SOLO +# include /* for va_list */ +# endif +#endif + #ifdef _WIN32 -# include /* for wchar_t */ +# ifndef Z_SOLO +# include /* for wchar_t */ +# endif #endif /* a little trick to accommodate both "#define _LARGEFILE64_SOURCE" and @@ -435,7 +440,7 @@ typedef uLong FAR uLongf; * both "#undef _LARGEFILE64_SOURCE" and "#define _LARGEFILE64_SOURCE 0" as * equivalently requesting no 64-bit operations */ -#if defined(LARGEFILE64_SOURCE) && -_LARGEFILE64_SOURCE - -1 == 1 +#if defined(_LARGEFILE64_SOURCE) && -_LARGEFILE64_SOURCE - -1 == 1 # undef _LARGEFILE64_SOURCE #endif @@ -443,7 +448,7 @@ typedef uLong FAR uLongf; # define Z_HAVE_UNISTD_H #endif #ifndef Z_SOLO -# if defined(Z_HAVE_UNISTD_H) || defined(LARGEFILE64_SOURCE) +# if defined(Z_HAVE_UNISTD_H) || defined(_LARGEFILE64_SOURCE) # include /* for SEEK_*, off_t, and _LFS64_LARGEFILE */ # ifdef VMS # include /* for off_t */ diff --git a/3rdparty/zlib/zlib.h b/3rdparty/zlib/zlib.h index 3edf3acdb5..3e0c7672ac 100644 --- a/3rdparty/zlib/zlib.h +++ b/3rdparty/zlib/zlib.h @@ -1,7 +1,7 @@ /* zlib.h -- interface of the 'zlib' general purpose compression library - version 1.2.7, May 2nd, 2012 + version 1.2.8, April 28th, 2013 - Copyright (C) 1995-2012 Jean-loup Gailly and Mark Adler + Copyright (C) 1995-2013 Jean-loup Gailly and Mark Adler This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -37,11 +37,11 @@ extern "C" { #endif -#define ZLIB_VERSION "1.2.7" -#define ZLIB_VERNUM 0x1270 +#define ZLIB_VERSION "1.2.8" +#define ZLIB_VERNUM 0x1280 #define ZLIB_VER_MAJOR 1 #define ZLIB_VER_MINOR 2 -#define ZLIB_VER_REVISION 7 +#define ZLIB_VER_REVISION 8 #define ZLIB_VER_SUBREVISION 0 /* @@ -839,6 +839,21 @@ ZEXTERN int ZEXPORT inflateSetDictionary OF((z_streamp strm, inflate(). */ +ZEXTERN int ZEXPORT inflateGetDictionary OF((z_streamp strm, + Bytef *dictionary, + uInt *dictLength)); +/* + Returns the sliding dictionary being maintained by inflate. dictLength is + set to the number of bytes in the dictionary, and that many bytes are copied + to dictionary. dictionary must have enough space, where 32768 bytes is + always enough. If inflateGetDictionary() is called with dictionary equal to + Z_NULL, then only the dictionary length is returned, and nothing is copied. + Similary, if dictLength is Z_NULL, then it is not set. + + inflateGetDictionary returns Z_OK on success, or Z_STREAM_ERROR if the + stream state is inconsistent. +*/ + ZEXTERN int ZEXPORT inflateSync OF((z_streamp strm)); /* Skips invalid compressed data until a possible full flush point (see above @@ -846,7 +861,7 @@ ZEXTERN int ZEXPORT inflateSync OF((z_streamp strm)); available input is skipped. No output is provided. inflateSync searches for a 00 00 FF FF pattern in the compressed data. - All full flush points have this pattern, but not all occurences of this + All full flush points have this pattern, but not all occurrences of this pattern are full flush points. inflateSync returns Z_OK if a possible full flush point has been found, @@ -1007,7 +1022,8 @@ ZEXTERN int ZEXPORT inflateBackInit OF((z_streamp strm, int windowBits, the version of the header file. */ -typedef unsigned (*in_func) OF((void FAR *, unsigned char FAR * FAR *)); +typedef unsigned (*in_func) OF((void FAR *, + z_const unsigned char FAR * FAR *)); typedef int (*out_func) OF((void FAR *, unsigned char FAR *, unsigned)); ZEXTERN int ZEXPORT inflateBack OF((z_streamp strm, @@ -1015,11 +1031,12 @@ ZEXTERN int ZEXPORT inflateBack OF((z_streamp strm, out_func out, void FAR *out_desc)); /* inflateBack() does a raw inflate with a single call using a call-back - interface for input and output. This is more efficient than inflate() for - file i/o applications in that it avoids copying between the output and the - sliding window by simply making the window itself the output buffer. This - function trusts the application to not change the output buffer passed by - the output function, at least until inflateBack() returns. + interface for input and output. This is potentially more efficient than + inflate() for file i/o applications, in that it avoids copying between the + output and the sliding window by simply making the window itself the output + buffer. inflate() can be faster on modern CPUs when used with large + buffers. inflateBack() trusts the application to not change the output + buffer passed by the output function, at least until inflateBack() returns. inflateBackInit() must be called first to allocate the internal state and to initialize the state with the user-provided window buffer. @@ -1736,6 +1753,13 @@ ZEXTERN int ZEXPORT deflateResetKeep OF((z_streamp)); ZEXTERN gzFile ZEXPORT gzopen_w OF((const wchar_t *path, const char *mode)); #endif +#if defined(STDC) || defined(Z_HAVE_STDARG_H) +# ifndef Z_SOLO +ZEXTERN int ZEXPORTVA gzvprintf Z_ARG((gzFile file, + const char *format, + va_list va)); +# endif +#endif #ifdef __cplusplus } diff --git a/3rdparty/zlib/zutil.c b/3rdparty/zlib/zutil.c index 65e0d3b72b..23d2ebef00 100644 --- a/3rdparty/zlib/zutil.c +++ b/3rdparty/zlib/zutil.c @@ -14,7 +14,7 @@ struct internal_state {int dummy;}; /* for buggy compilers */ #endif -const char * const z_errmsg[10] = { +z_const char * const z_errmsg[10] = { "need dictionary", /* Z_NEED_DICT 2 */ "stream end", /* Z_STREAM_END 1 */ "", /* Z_OK 0 */ diff --git a/3rdparty/zlib/zutil.h b/3rdparty/zlib/zutil.h index 4e3dcc6ae9..24ab06b1cf 100644 --- a/3rdparty/zlib/zutil.h +++ b/3rdparty/zlib/zutil.h @@ -1,5 +1,5 @@ /* zutil.h -- internal interface and configuration of the compression library - * Copyright (C) 1995-2012 Jean-loup Gailly. + * Copyright (C) 1995-2013 Jean-loup Gailly. * For conditions of distribution and use, see copyright notice in zlib.h */ @@ -44,13 +44,13 @@ typedef unsigned short ush; typedef ush FAR ushf; typedef unsigned long ulg; -extern const char * const z_errmsg[10]; /* indexed by 2-zlib_error */ +extern z_const char * const z_errmsg[10]; /* indexed by 2-zlib_error */ /* (size given to avoid silly warnings with Visual C++) */ #define ERR_MSG(err) z_errmsg[Z_NEED_DICT-(err)] #define ERR_RETURN(strm,err) \ - return (strm->msg = (char*)ERR_MSG(err), (err)) + return (strm->msg = ERR_MSG(err), (err)) /* To be used only when the state is known to be valid */ /* common constants */ @@ -168,7 +168,8 @@ extern const char * const z_errmsg[10]; /* indexed by 2-zlib_error */ #endif /* provide prototypes for these when building zlib without LFS */ -#if !defined(_WIN32) && (!defined(_LARGEFILE64_SOURCE) || _LFS64_LARGEFILE-0 == 0) +#if !defined(_WIN32) && \ + (!defined(_LARGEFILE64_SOURCE) || _LFS64_LARGEFILE-0 == 0) ZEXTERN uLong ZEXPORT adler32_combine64 OF((uLong, uLong, z_off_t)); ZEXTERN uLong ZEXPORT crc32_combine64 OF((uLong, uLong, z_off_t)); #endif From 9f2642a7147a8e741c142d8973760538b1bb4ecc Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Miguel=20A=2E=20Col=C3=B3n=20V=C3=A9lez?= Date: Sat, 22 Aug 2015 07:00:56 -0400 Subject: [PATCH 3/5] Update glext.h to the latest version. --- 3rdparty/GL/glext.h | 2173 ++++++++++++++++++++++++++++++++----------- 1 file changed, 1604 insertions(+), 569 deletions(-) diff --git a/3rdparty/GL/glext.h b/3rdparty/GL/glext.h index 8a9b9add48..a3dbb94279 100644 --- a/3rdparty/GL/glext.h +++ b/3rdparty/GL/glext.h @@ -6,7 +6,7 @@ extern "C" { #endif /* -** Copyright (c) 2013 The Khronos Group Inc. +** Copyright (c) 2013-2015 The Khronos Group Inc. ** ** Permission is hereby granted, free of charge, to any person obtaining a ** copy of this software and/or associated documentation files (the @@ -33,7 +33,7 @@ extern "C" { ** used to make the header, and the header can be found at ** http://www.opengl.org/registry/ ** -** Khronos $Revision$ on $Date$ +** Khronos $Revision: 31811 $ on $Date: 2015-08-10 03:01:11 -0400 (Mon, 10 Aug 2015) $ */ #if defined(_WIN32) && !defined(APIENTRY) && !defined(__CYGWIN__) && !defined(__SCITECH_SNAP__) @@ -53,7 +53,7 @@ extern "C" { #define GLAPI extern #endif -#define GL_GLEXT_VERSION 20130729 +#define GL_GLEXT_VERSION 20150809 /* Generated C header for: * API: gl @@ -108,18 +108,14 @@ extern "C" { #define GL_SINGLE_COLOR 0x81F9 #define GL_SEPARATE_SPECULAR_COLOR 0x81FA #define GL_ALIASED_POINT_SIZE_RANGE 0x846D -typedef void (APIENTRYP PFNGLBLENDCOLORPROC) (GLfloat red, GLfloat green, GLfloat blue, GLfloat alpha); -typedef void (APIENTRYP PFNGLBLENDEQUATIONPROC) (GLenum mode); -typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices); -typedef void (APIENTRYP PFNGLTEXIMAGE3DPROC) (GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices); +typedef void (APIENTRYP PFNGLTEXIMAGE3DPROC) (GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glBlendColor (GLfloat red, GLfloat green, GLfloat blue, GLfloat alpha); -GLAPI void APIENTRY glBlendEquation (GLenum mode); -GLAPI void APIENTRY glDrawRangeElements (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices); -GLAPI void APIENTRY glTexImage3D (GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -GLAPI void APIENTRY glTexSubImage3D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); +GLAPI void APIENTRY glDrawRangeElements (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices); +GLAPI void APIENTRY glTexImage3D (GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTexSubImage3D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); GLAPI void APIENTRY glCopyTexSubImage3D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); #endif #endif /* GL_VERSION_1_2 */ @@ -224,13 +220,13 @@ GLAPI void APIENTRY glCopyTexSubImage3D (GLenum target, GLint level, GLint xoffs #define GL_DOT3_RGBA 0x86AF typedef void (APIENTRYP PFNGLACTIVETEXTUREPROC) (GLenum texture); typedef void (APIENTRYP PFNGLSAMPLECOVERAGEPROC) (GLfloat value, GLboolean invert); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE3DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE2DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE1DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE2DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE1DPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXIMAGEPROC) (GLenum target, GLint level, GLvoid *img); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE3DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE2DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE1DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE2DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE1DPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXIMAGEPROC) (GLenum target, GLint level, void *img); typedef void (APIENTRYP PFNGLCLIENTACTIVETEXTUREPROC) (GLenum texture); typedef void (APIENTRYP PFNGLMULTITEXCOORD1DPROC) (GLenum target, GLdouble s); typedef void (APIENTRYP PFNGLMULTITEXCOORD1DVPROC) (GLenum target, const GLdouble *v); @@ -271,13 +267,13 @@ typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXDPROC) (const GLdouble *m); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glActiveTexture (GLenum texture); GLAPI void APIENTRY glSampleCoverage (GLfloat value, GLboolean invert); -GLAPI void APIENTRY glCompressedTexImage3D (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data); -GLAPI void APIENTRY glCompressedTexImage2D (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data); -GLAPI void APIENTRY glCompressedTexImage1D (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data); -GLAPI void APIENTRY glCompressedTexSubImage3D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data); -GLAPI void APIENTRY glCompressedTexSubImage2D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data); -GLAPI void APIENTRY glCompressedTexSubImage1D (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data); -GLAPI void APIENTRY glGetCompressedTexImage (GLenum target, GLint level, GLvoid *img); +GLAPI void APIENTRY glCompressedTexImage3D (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexImage2D (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexImage1D (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexSubImage3D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexSubImage2D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexSubImage1D (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glGetCompressedTexImage (GLenum target, GLint level, void *img); GLAPI void APIENTRY glClientActiveTexture (GLenum texture); GLAPI void APIENTRY glMultiTexCoord1d (GLenum target, GLdouble s); GLAPI void APIENTRY glMultiTexCoord1dv (GLenum target, const GLdouble *v); @@ -370,7 +366,7 @@ GLAPI void APIENTRY glMultTransposeMatrixd (const GLdouble *m); #define GL_ONE_MINUS_CONSTANT_ALPHA 0x8004 typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSPROC) (GLenum mode, const GLint *first, const GLsizei *count, GLsizei drawcount); -typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSPROC) (GLenum mode, const GLsizei *count, GLenum type, const GLvoid *const*indices, GLsizei drawcount); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSPROC) (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei drawcount); typedef void (APIENTRYP PFNGLPOINTPARAMETERFPROC) (GLenum pname, GLfloat param); typedef void (APIENTRYP PFNGLPOINTPARAMETERFVPROC) (GLenum pname, const GLfloat *params); typedef void (APIENTRYP PFNGLPOINTPARAMETERIPROC) (GLenum pname, GLint param); @@ -379,7 +375,7 @@ typedef void (APIENTRYP PFNGLFOGCOORDFPROC) (GLfloat coord); typedef void (APIENTRYP PFNGLFOGCOORDFVPROC) (const GLfloat *coord); typedef void (APIENTRYP PFNGLFOGCOORDDPROC) (GLdouble coord); typedef void (APIENTRYP PFNGLFOGCOORDDVPROC) (const GLdouble *coord); -typedef void (APIENTRYP PFNGLFOGCOORDPOINTERPROC) (GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLFOGCOORDPOINTERPROC) (GLenum type, GLsizei stride, const void *pointer); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BPROC) (GLbyte red, GLbyte green, GLbyte blue); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BVPROC) (const GLbyte *v); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DPROC) (GLdouble red, GLdouble green, GLdouble blue); @@ -396,7 +392,7 @@ typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIPROC) (GLuint red, GLuint green, G typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIVPROC) (const GLuint *v); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USPROC) (GLushort red, GLushort green, GLushort blue); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USVPROC) (const GLushort *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTERPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTERPROC) (GLint size, GLenum type, GLsizei stride, const void *pointer); typedef void (APIENTRYP PFNGLWINDOWPOS2DPROC) (GLdouble x, GLdouble y); typedef void (APIENTRYP PFNGLWINDOWPOS2DVPROC) (const GLdouble *v); typedef void (APIENTRYP PFNGLWINDOWPOS2FPROC) (GLfloat x, GLfloat y); @@ -413,10 +409,12 @@ typedef void (APIENTRYP PFNGLWINDOWPOS3IPROC) (GLint x, GLint y, GLint z); typedef void (APIENTRYP PFNGLWINDOWPOS3IVPROC) (const GLint *v); typedef void (APIENTRYP PFNGLWINDOWPOS3SPROC) (GLshort x, GLshort y, GLshort z); typedef void (APIENTRYP PFNGLWINDOWPOS3SVPROC) (const GLshort *v); +typedef void (APIENTRYP PFNGLBLENDCOLORPROC) (GLfloat red, GLfloat green, GLfloat blue, GLfloat alpha); +typedef void (APIENTRYP PFNGLBLENDEQUATIONPROC) (GLenum mode); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glBlendFuncSeparate (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); GLAPI void APIENTRY glMultiDrawArrays (GLenum mode, const GLint *first, const GLsizei *count, GLsizei drawcount); -GLAPI void APIENTRY glMultiDrawElements (GLenum mode, const GLsizei *count, GLenum type, const GLvoid *const*indices, GLsizei drawcount); +GLAPI void APIENTRY glMultiDrawElements (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei drawcount); GLAPI void APIENTRY glPointParameterf (GLenum pname, GLfloat param); GLAPI void APIENTRY glPointParameterfv (GLenum pname, const GLfloat *params); GLAPI void APIENTRY glPointParameteri (GLenum pname, GLint param); @@ -425,7 +423,7 @@ GLAPI void APIENTRY glFogCoordf (GLfloat coord); GLAPI void APIENTRY glFogCoordfv (const GLfloat *coord); GLAPI void APIENTRY glFogCoordd (GLdouble coord); GLAPI void APIENTRY glFogCoorddv (const GLdouble *coord); -GLAPI void APIENTRY glFogCoordPointer (GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glFogCoordPointer (GLenum type, GLsizei stride, const void *pointer); GLAPI void APIENTRY glSecondaryColor3b (GLbyte red, GLbyte green, GLbyte blue); GLAPI void APIENTRY glSecondaryColor3bv (const GLbyte *v); GLAPI void APIENTRY glSecondaryColor3d (GLdouble red, GLdouble green, GLdouble blue); @@ -442,7 +440,7 @@ GLAPI void APIENTRY glSecondaryColor3ui (GLuint red, GLuint green, GLuint blue); GLAPI void APIENTRY glSecondaryColor3uiv (const GLuint *v); GLAPI void APIENTRY glSecondaryColor3us (GLushort red, GLushort green, GLushort blue); GLAPI void APIENTRY glSecondaryColor3usv (const GLushort *v); -GLAPI void APIENTRY glSecondaryColorPointer (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glSecondaryColorPointer (GLint size, GLenum type, GLsizei stride, const void *pointer); GLAPI void APIENTRY glWindowPos2d (GLdouble x, GLdouble y); GLAPI void APIENTRY glWindowPos2dv (const GLdouble *v); GLAPI void APIENTRY glWindowPos2f (GLfloat x, GLfloat y); @@ -459,6 +457,8 @@ GLAPI void APIENTRY glWindowPos3i (GLint x, GLint y, GLint z); GLAPI void APIENTRY glWindowPos3iv (const GLint *v); GLAPI void APIENTRY glWindowPos3s (GLshort x, GLshort y, GLshort z); GLAPI void APIENTRY glWindowPos3sv (const GLshort *v); +GLAPI void APIENTRY glBlendColor (GLfloat red, GLfloat green, GLfloat blue, GLfloat alpha); +GLAPI void APIENTRY glBlendEquation (GLenum mode); #endif #endif /* GL_VERSION_1_4 */ @@ -529,13 +529,13 @@ typedef void (APIENTRYP PFNGLBINDBUFFERPROC) (GLenum target, GLuint buffer); typedef void (APIENTRYP PFNGLDELETEBUFFERSPROC) (GLsizei n, const GLuint *buffers); typedef void (APIENTRYP PFNGLGENBUFFERSPROC) (GLsizei n, GLuint *buffers); typedef GLboolean (APIENTRYP PFNGLISBUFFERPROC) (GLuint buffer); -typedef void (APIENTRYP PFNGLBUFFERDATAPROC) (GLenum target, GLsizeiptr size, const GLvoid *data, GLenum usage); -typedef void (APIENTRYP PFNGLBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, const GLvoid *data); -typedef void (APIENTRYP PFNGLGETBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, GLvoid *data); +typedef void (APIENTRYP PFNGLBUFFERDATAPROC) (GLenum target, GLsizeiptr size, const void *data, GLenum usage); +typedef void (APIENTRYP PFNGLBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, const void *data); +typedef void (APIENTRYP PFNGLGETBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, void *data); typedef void *(APIENTRYP PFNGLMAPBUFFERPROC) (GLenum target, GLenum access); typedef GLboolean (APIENTRYP PFNGLUNMAPBUFFERPROC) (GLenum target); typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETBUFFERPOINTERVPROC) (GLenum target, GLenum pname, GLvoid **params); +typedef void (APIENTRYP PFNGLGETBUFFERPOINTERVPROC) (GLenum target, GLenum pname, void **params); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glGenQueries (GLsizei n, GLuint *ids); GLAPI void APIENTRY glDeleteQueries (GLsizei n, const GLuint *ids); @@ -549,13 +549,13 @@ GLAPI void APIENTRY glBindBuffer (GLenum target, GLuint buffer); GLAPI void APIENTRY glDeleteBuffers (GLsizei n, const GLuint *buffers); GLAPI void APIENTRY glGenBuffers (GLsizei n, GLuint *buffers); GLAPI GLboolean APIENTRY glIsBuffer (GLuint buffer); -GLAPI void APIENTRY glBufferData (GLenum target, GLsizeiptr size, const GLvoid *data, GLenum usage); -GLAPI void APIENTRY glBufferSubData (GLenum target, GLintptr offset, GLsizeiptr size, const GLvoid *data); -GLAPI void APIENTRY glGetBufferSubData (GLenum target, GLintptr offset, GLsizeiptr size, GLvoid *data); +GLAPI void APIENTRY glBufferData (GLenum target, GLsizeiptr size, const void *data, GLenum usage); +GLAPI void APIENTRY glBufferSubData (GLenum target, GLintptr offset, GLsizeiptr size, const void *data); +GLAPI void APIENTRY glGetBufferSubData (GLenum target, GLintptr offset, GLsizeiptr size, void *data); GLAPI void *APIENTRY glMapBuffer (GLenum target, GLenum access); GLAPI GLboolean APIENTRY glUnmapBuffer (GLenum target); GLAPI void APIENTRY glGetBufferParameteriv (GLenum target, GLenum pname, GLint *params); -GLAPI void APIENTRY glGetBufferPointerv (GLenum target, GLenum pname, GLvoid **params); +GLAPI void APIENTRY glGetBufferPointerv (GLenum target, GLenum pname, void **params); #endif #endif /* GL_VERSION_1_5 */ @@ -676,7 +676,7 @@ typedef void (APIENTRYP PFNGLGETUNIFORMIVPROC) (GLuint program, GLint location, typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVPROC) (GLuint index, GLenum pname, GLdouble *params); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVPROC) (GLuint index, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVPROC) (GLuint index, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVPROC) (GLuint index, GLenum pname, GLvoid **pointer); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVPROC) (GLuint index, GLenum pname, void **pointer); typedef GLboolean (APIENTRYP PFNGLISPROGRAMPROC) (GLuint program); typedef GLboolean (APIENTRYP PFNGLISSHADERPROC) (GLuint shader); typedef void (APIENTRYP PFNGLLINKPROGRAMPROC) (GLuint program); @@ -738,7 +738,7 @@ typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVPROC) (GLuint index, const GLshort * typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVPROC) (GLuint index, const GLubyte *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4UIVPROC) (GLuint index, const GLuint *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4USVPROC) (GLuint index, const GLushort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const void *pointer); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glBlendEquationSeparate (GLenum modeRGB, GLenum modeAlpha); GLAPI void APIENTRY glDrawBuffers (GLsizei n, const GLenum *bufs); @@ -770,7 +770,7 @@ GLAPI void APIENTRY glGetUniformiv (GLuint program, GLint location, GLint *param GLAPI void APIENTRY glGetVertexAttribdv (GLuint index, GLenum pname, GLdouble *params); GLAPI void APIENTRY glGetVertexAttribfv (GLuint index, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetVertexAttribiv (GLuint index, GLenum pname, GLint *params); -GLAPI void APIENTRY glGetVertexAttribPointerv (GLuint index, GLenum pname, GLvoid **pointer); +GLAPI void APIENTRY glGetVertexAttribPointerv (GLuint index, GLenum pname, void **pointer); GLAPI GLboolean APIENTRY glIsProgram (GLuint program); GLAPI GLboolean APIENTRY glIsShader (GLuint shader); GLAPI void APIENTRY glLinkProgram (GLuint program); @@ -832,7 +832,7 @@ GLAPI void APIENTRY glVertexAttrib4sv (GLuint index, const GLshort *v); GLAPI void APIENTRY glVertexAttrib4ubv (GLuint index, const GLubyte *v); GLAPI void APIENTRY glVertexAttrib4uiv (GLuint index, const GLuint *v); GLAPI void APIENTRY glVertexAttrib4usv (GLuint index, const GLushort *v); -GLAPI void APIENTRY glVertexAttribPointer (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glVertexAttribPointer (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const void *pointer); #endif #endif /* GL_VERSION_2_0 */ @@ -1041,6 +1041,22 @@ typedef unsigned short GLhalf; #define GL_COLOR_ATTACHMENT13 0x8CED #define GL_COLOR_ATTACHMENT14 0x8CEE #define GL_COLOR_ATTACHMENT15 0x8CEF +#define GL_COLOR_ATTACHMENT16 0x8CF0 +#define GL_COLOR_ATTACHMENT17 0x8CF1 +#define GL_COLOR_ATTACHMENT18 0x8CF2 +#define GL_COLOR_ATTACHMENT19 0x8CF3 +#define GL_COLOR_ATTACHMENT20 0x8CF4 +#define GL_COLOR_ATTACHMENT21 0x8CF5 +#define GL_COLOR_ATTACHMENT22 0x8CF6 +#define GL_COLOR_ATTACHMENT23 0x8CF7 +#define GL_COLOR_ATTACHMENT24 0x8CF8 +#define GL_COLOR_ATTACHMENT25 0x8CF9 +#define GL_COLOR_ATTACHMENT26 0x8CFA +#define GL_COLOR_ATTACHMENT27 0x8CFB +#define GL_COLOR_ATTACHMENT28 0x8CFC +#define GL_COLOR_ATTACHMENT29 0x8CFD +#define GL_COLOR_ATTACHMENT30 0x8CFE +#define GL_COLOR_ATTACHMENT31 0x8CFF #define GL_DEPTH_ATTACHMENT 0x8D00 #define GL_STENCIL_ATTACHMENT 0x8D20 #define GL_FRAMEBUFFER 0x8D40 @@ -1116,7 +1132,7 @@ typedef void (APIENTRYP PFNGLGETTRANSFORMFEEDBACKVARYINGPROC) (GLuint program, G typedef void (APIENTRYP PFNGLCLAMPCOLORPROC) (GLenum target, GLenum clamp); typedef void (APIENTRYP PFNGLBEGINCONDITIONALRENDERPROC) (GLuint id, GLenum mode); typedef void (APIENTRYP PFNGLENDCONDITIONALRENDERPROC) (void); -typedef void (APIENTRYP PFNGLVERTEXATTRIBIPOINTERPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLVERTEXATTRIBIPOINTERPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const void *pointer); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIIVPROC) (GLuint index, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIUIVPROC) (GLuint index, GLenum pname, GLuint *params); typedef void (APIENTRYP PFNGLVERTEXATTRIBI1IPROC) (GLuint index, GLint x); @@ -1201,7 +1217,7 @@ GLAPI void APIENTRY glGetTransformFeedbackVarying (GLuint program, GLuint index, GLAPI void APIENTRY glClampColor (GLenum target, GLenum clamp); GLAPI void APIENTRY glBeginConditionalRender (GLuint id, GLenum mode); GLAPI void APIENTRY glEndConditionalRender (void); -GLAPI void APIENTRY glVertexAttribIPointer (GLuint index, GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glVertexAttribIPointer (GLuint index, GLint size, GLenum type, GLsizei stride, const void *pointer); GLAPI void APIENTRY glGetVertexAttribIiv (GLuint index, GLenum pname, GLint *params); GLAPI void APIENTRY glGetVertexAttribIuiv (GLuint index, GLenum pname, GLuint *params); GLAPI void APIENTRY glVertexAttribI1i (GLuint index, GLint x); @@ -1308,11 +1324,13 @@ GLAPI GLboolean APIENTRY glIsVertexArray (GLuint array); #define GL_UNIFORM_BUFFER_START 0x8A29 #define GL_UNIFORM_BUFFER_SIZE 0x8A2A #define GL_MAX_VERTEX_UNIFORM_BLOCKS 0x8A2B +#define GL_MAX_GEOMETRY_UNIFORM_BLOCKS 0x8A2C #define GL_MAX_FRAGMENT_UNIFORM_BLOCKS 0x8A2D #define GL_MAX_COMBINED_UNIFORM_BLOCKS 0x8A2E #define GL_MAX_UNIFORM_BUFFER_BINDINGS 0x8A2F #define GL_MAX_UNIFORM_BLOCK_SIZE 0x8A30 #define GL_MAX_COMBINED_VERTEX_UNIFORM_COMPONENTS 0x8A31 +#define GL_MAX_COMBINED_GEOMETRY_UNIFORM_COMPONENTS 0x8A32 #define GL_MAX_COMBINED_FRAGMENT_UNIFORM_COMPONENTS 0x8A33 #define GL_UNIFORM_BUFFER_OFFSET_ALIGNMENT 0x8A34 #define GL_ACTIVE_UNIFORM_BLOCK_MAX_NAME_LENGTH 0x8A35 @@ -1331,10 +1349,11 @@ GLAPI GLboolean APIENTRY glIsVertexArray (GLuint array); #define GL_UNIFORM_BLOCK_ACTIVE_UNIFORMS 0x8A42 #define GL_UNIFORM_BLOCK_ACTIVE_UNIFORM_INDICES 0x8A43 #define GL_UNIFORM_BLOCK_REFERENCED_BY_VERTEX_SHADER 0x8A44 +#define GL_UNIFORM_BLOCK_REFERENCED_BY_GEOMETRY_SHADER 0x8A45 #define GL_UNIFORM_BLOCK_REFERENCED_BY_FRAGMENT_SHADER 0x8A46 #define GL_INVALID_INDEX 0xFFFFFFFFu typedef void (APIENTRYP PFNGLDRAWARRAYSINSTANCEDPROC) (GLenum mode, GLint first, GLsizei count, GLsizei instancecount); -typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDPROC) (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLsizei instancecount); +typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount); typedef void (APIENTRYP PFNGLTEXBUFFERPROC) (GLenum target, GLenum internalformat, GLuint buffer); typedef void (APIENTRYP PFNGLPRIMITIVERESTARTINDEXPROC) (GLuint index); typedef void (APIENTRYP PFNGLCOPYBUFFERSUBDATAPROC) (GLenum readTarget, GLenum writeTarget, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); @@ -1347,7 +1366,7 @@ typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMBLOCKNAMEPROC) (GLuint program, GLu typedef void (APIENTRYP PFNGLUNIFORMBLOCKBINDINGPROC) (GLuint program, GLuint uniformBlockIndex, GLuint uniformBlockBinding); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glDrawArraysInstanced (GLenum mode, GLint first, GLsizei count, GLsizei instancecount); -GLAPI void APIENTRY glDrawElementsInstanced (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLsizei instancecount); +GLAPI void APIENTRY glDrawElementsInstanced (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount); GLAPI void APIENTRY glTexBuffer (GLenum target, GLenum internalformat, GLuint buffer); GLAPI void APIENTRY glPrimitiveRestartIndex (GLuint index); GLAPI void APIENTRY glCopyBufferSubData (GLenum readTarget, GLenum writeTarget, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); @@ -1467,45 +1486,45 @@ typedef int64_t GLint64; #define GL_MAX_COLOR_TEXTURE_SAMPLES 0x910E #define GL_MAX_DEPTH_TEXTURE_SAMPLES 0x910F #define GL_MAX_INTEGER_SAMPLES 0x9110 -typedef void (APIENTRYP PFNGLDRAWELEMENTSBASEVERTEXPROC) (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLint basevertex); -typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSBASEVERTEXPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices, GLint basevertex); -typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXPROC) (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLsizei instancecount, GLint basevertex); -typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSBASEVERTEXPROC) (GLenum mode, const GLsizei *count, GLenum type, const GLvoid *const*indices, GLsizei drawcount, const GLint *basevertex); +typedef void (APIENTRYP PFNGLDRAWELEMENTSBASEVERTEXPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLint basevertex); +typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSBASEVERTEXPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices, GLint basevertex); +typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSBASEVERTEXPROC) (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei drawcount, const GLint *basevertex); typedef void (APIENTRYP PFNGLPROVOKINGVERTEXPROC) (GLenum mode); typedef GLsync (APIENTRYP PFNGLFENCESYNCPROC) (GLenum condition, GLbitfield flags); typedef GLboolean (APIENTRYP PFNGLISSYNCPROC) (GLsync sync); typedef void (APIENTRYP PFNGLDELETESYNCPROC) (GLsync sync); typedef GLenum (APIENTRYP PFNGLCLIENTWAITSYNCPROC) (GLsync sync, GLbitfield flags, GLuint64 timeout); typedef void (APIENTRYP PFNGLWAITSYNCPROC) (GLsync sync, GLbitfield flags, GLuint64 timeout); -typedef void (APIENTRYP PFNGLGETINTEGER64VPROC) (GLenum pname, GLint64 *params); +typedef void (APIENTRYP PFNGLGETINTEGER64VPROC) (GLenum pname, GLint64 *data); typedef void (APIENTRYP PFNGLGETSYNCIVPROC) (GLsync sync, GLenum pname, GLsizei bufSize, GLsizei *length, GLint *values); typedef void (APIENTRYP PFNGLGETINTEGER64I_VPROC) (GLenum target, GLuint index, GLint64 *data); typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERI64VPROC) (GLenum target, GLenum pname, GLint64 *params); typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level); -typedef void (APIENTRYP PFNGLTEXIMAGE2DMULTISAMPLEPROC) (GLenum target, GLsizei samples, GLint internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations); -typedef void (APIENTRYP PFNGLTEXIMAGE3DMULTISAMPLEPROC) (GLenum target, GLsizei samples, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations); +typedef void (APIENTRYP PFNGLTEXIMAGE2DMULTISAMPLEPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations); +typedef void (APIENTRYP PFNGLTEXIMAGE3DMULTISAMPLEPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations); typedef void (APIENTRYP PFNGLGETMULTISAMPLEFVPROC) (GLenum pname, GLuint index, GLfloat *val); -typedef void (APIENTRYP PFNGLSAMPLEMASKIPROC) (GLuint index, GLbitfield mask); +typedef void (APIENTRYP PFNGLSAMPLEMASKIPROC) (GLuint maskNumber, GLbitfield mask); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glDrawElementsBaseVertex (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLint basevertex); -GLAPI void APIENTRY glDrawRangeElementsBaseVertex (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices, GLint basevertex); -GLAPI void APIENTRY glDrawElementsInstancedBaseVertex (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLsizei instancecount, GLint basevertex); -GLAPI void APIENTRY glMultiDrawElementsBaseVertex (GLenum mode, const GLsizei *count, GLenum type, const GLvoid *const*indices, GLsizei drawcount, const GLint *basevertex); +GLAPI void APIENTRY glDrawElementsBaseVertex (GLenum mode, GLsizei count, GLenum type, const void *indices, GLint basevertex); +GLAPI void APIENTRY glDrawRangeElementsBaseVertex (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices, GLint basevertex); +GLAPI void APIENTRY glDrawElementsInstancedBaseVertex (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex); +GLAPI void APIENTRY glMultiDrawElementsBaseVertex (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei drawcount, const GLint *basevertex); GLAPI void APIENTRY glProvokingVertex (GLenum mode); GLAPI GLsync APIENTRY glFenceSync (GLenum condition, GLbitfield flags); GLAPI GLboolean APIENTRY glIsSync (GLsync sync); GLAPI void APIENTRY glDeleteSync (GLsync sync); GLAPI GLenum APIENTRY glClientWaitSync (GLsync sync, GLbitfield flags, GLuint64 timeout); GLAPI void APIENTRY glWaitSync (GLsync sync, GLbitfield flags, GLuint64 timeout); -GLAPI void APIENTRY glGetInteger64v (GLenum pname, GLint64 *params); +GLAPI void APIENTRY glGetInteger64v (GLenum pname, GLint64 *data); GLAPI void APIENTRY glGetSynciv (GLsync sync, GLenum pname, GLsizei bufSize, GLsizei *length, GLint *values); GLAPI void APIENTRY glGetInteger64i_v (GLenum target, GLuint index, GLint64 *data); GLAPI void APIENTRY glGetBufferParameteri64v (GLenum target, GLenum pname, GLint64 *params); GLAPI void APIENTRY glFramebufferTexture (GLenum target, GLenum attachment, GLuint texture, GLint level); -GLAPI void APIENTRY glTexImage2DMultisample (GLenum target, GLsizei samples, GLint internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations); -GLAPI void APIENTRY glTexImage3DMultisample (GLenum target, GLsizei samples, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations); +GLAPI void APIENTRY glTexImage2DMultisample (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations); +GLAPI void APIENTRY glTexImage3DMultisample (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations); GLAPI void APIENTRY glGetMultisamplefv (GLenum pname, GLuint index, GLfloat *val); -GLAPI void APIENTRY glSampleMaski (GLuint index, GLbitfield mask); +GLAPI void APIENTRY glSampleMaski (GLuint maskNumber, GLbitfield mask); #endif #endif /* GL_VERSION_3_2 */ @@ -1731,8 +1750,8 @@ typedef void (APIENTRYP PFNGLBLENDEQUATIONIPROC) (GLuint buf, GLenum mode); typedef void (APIENTRYP PFNGLBLENDEQUATIONSEPARATEIPROC) (GLuint buf, GLenum modeRGB, GLenum modeAlpha); typedef void (APIENTRYP PFNGLBLENDFUNCIPROC) (GLuint buf, GLenum src, GLenum dst); typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEIPROC) (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha); -typedef void (APIENTRYP PFNGLDRAWARRAYSINDIRECTPROC) (GLenum mode, const GLvoid *indirect); -typedef void (APIENTRYP PFNGLDRAWELEMENTSINDIRECTPROC) (GLenum mode, GLenum type, const GLvoid *indirect); +typedef void (APIENTRYP PFNGLDRAWARRAYSINDIRECTPROC) (GLenum mode, const void *indirect); +typedef void (APIENTRYP PFNGLDRAWELEMENTSINDIRECTPROC) (GLenum mode, GLenum type, const void *indirect); typedef void (APIENTRYP PFNGLUNIFORM1DPROC) (GLint location, GLdouble x); typedef void (APIENTRYP PFNGLUNIFORM2DPROC) (GLint location, GLdouble x, GLdouble y); typedef void (APIENTRYP PFNGLUNIFORM3DPROC) (GLint location, GLdouble x, GLdouble y, GLdouble z); @@ -1778,8 +1797,8 @@ GLAPI void APIENTRY glBlendEquationi (GLuint buf, GLenum mode); GLAPI void APIENTRY glBlendEquationSeparatei (GLuint buf, GLenum modeRGB, GLenum modeAlpha); GLAPI void APIENTRY glBlendFunci (GLuint buf, GLenum src, GLenum dst); GLAPI void APIENTRY glBlendFuncSeparatei (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha); -GLAPI void APIENTRY glDrawArraysIndirect (GLenum mode, const GLvoid *indirect); -GLAPI void APIENTRY glDrawElementsIndirect (GLenum mode, GLenum type, const GLvoid *indirect); +GLAPI void APIENTRY glDrawArraysIndirect (GLenum mode, const void *indirect); +GLAPI void APIENTRY glDrawElementsIndirect (GLenum mode, GLenum type, const void *indirect); GLAPI void APIENTRY glUniform1d (GLint location, GLdouble x); GLAPI void APIENTRY glUniform2d (GLint location, GLdouble x, GLdouble y); GLAPI void APIENTRY glUniform3d (GLint location, GLdouble x, GLdouble y, GLdouble z); @@ -1860,12 +1879,12 @@ GLAPI void APIENTRY glGetQueryIndexediv (GLenum target, GLuint index, GLenum pna #define GL_VIEWPORT_INDEX_PROVOKING_VERTEX 0x825F #define GL_UNDEFINED_VERTEX 0x8260 typedef void (APIENTRYP PFNGLRELEASESHADERCOMPILERPROC) (void); -typedef void (APIENTRYP PFNGLSHADERBINARYPROC) (GLsizei count, const GLuint *shaders, GLenum binaryformat, const GLvoid *binary, GLsizei length); +typedef void (APIENTRYP PFNGLSHADERBINARYPROC) (GLsizei count, const GLuint *shaders, GLenum binaryformat, const void *binary, GLsizei length); typedef void (APIENTRYP PFNGLGETSHADERPRECISIONFORMATPROC) (GLenum shadertype, GLenum precisiontype, GLint *range, GLint *precision); typedef void (APIENTRYP PFNGLDEPTHRANGEFPROC) (GLfloat n, GLfloat f); typedef void (APIENTRYP PFNGLCLEARDEPTHFPROC) (GLfloat d); -typedef void (APIENTRYP PFNGLGETPROGRAMBINARYPROC) (GLuint program, GLsizei bufSize, GLsizei *length, GLenum *binaryFormat, GLvoid *binary); -typedef void (APIENTRYP PFNGLPROGRAMBINARYPROC) (GLuint program, GLenum binaryFormat, const GLvoid *binary, GLsizei length); +typedef void (APIENTRYP PFNGLGETPROGRAMBINARYPROC) (GLuint program, GLsizei bufSize, GLsizei *length, GLenum *binaryFormat, void *binary); +typedef void (APIENTRYP PFNGLPROGRAMBINARYPROC) (GLuint program, GLenum binaryFormat, const void *binary, GLsizei length); typedef void (APIENTRYP PFNGLPROGRAMPARAMETERIPROC) (GLuint program, GLenum pname, GLint value); typedef void (APIENTRYP PFNGLUSEPROGRAMSTAGESPROC) (GLuint pipeline, GLbitfield stages, GLuint program); typedef void (APIENTRYP PFNGLACTIVESHADERPROGRAMPROC) (GLuint pipeline, GLuint program); @@ -1935,7 +1954,7 @@ typedef void (APIENTRYP PFNGLVERTEXATTRIBL1DVPROC) (GLuint index, const GLdouble typedef void (APIENTRYP PFNGLVERTEXATTRIBL2DVPROC) (GLuint index, const GLdouble *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBL3DVPROC) (GLuint index, const GLdouble *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBL4DVPROC) (GLuint index, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBLPOINTERPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLVERTEXATTRIBLPOINTERPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const void *pointer); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBLDVPROC) (GLuint index, GLenum pname, GLdouble *params); typedef void (APIENTRYP PFNGLVIEWPORTARRAYVPROC) (GLuint first, GLsizei count, const GLfloat *v); typedef void (APIENTRYP PFNGLVIEWPORTINDEXEDFPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat w, GLfloat h); @@ -1949,12 +1968,12 @@ typedef void (APIENTRYP PFNGLGETFLOATI_VPROC) (GLenum target, GLuint index, GLfl typedef void (APIENTRYP PFNGLGETDOUBLEI_VPROC) (GLenum target, GLuint index, GLdouble *data); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glReleaseShaderCompiler (void); -GLAPI void APIENTRY glShaderBinary (GLsizei count, const GLuint *shaders, GLenum binaryformat, const GLvoid *binary, GLsizei length); +GLAPI void APIENTRY glShaderBinary (GLsizei count, const GLuint *shaders, GLenum binaryformat, const void *binary, GLsizei length); GLAPI void APIENTRY glGetShaderPrecisionFormat (GLenum shadertype, GLenum precisiontype, GLint *range, GLint *precision); GLAPI void APIENTRY glDepthRangef (GLfloat n, GLfloat f); GLAPI void APIENTRY glClearDepthf (GLfloat d); -GLAPI void APIENTRY glGetProgramBinary (GLuint program, GLsizei bufSize, GLsizei *length, GLenum *binaryFormat, GLvoid *binary); -GLAPI void APIENTRY glProgramBinary (GLuint program, GLenum binaryFormat, const GLvoid *binary, GLsizei length); +GLAPI void APIENTRY glGetProgramBinary (GLuint program, GLsizei bufSize, GLsizei *length, GLenum *binaryFormat, void *binary); +GLAPI void APIENTRY glProgramBinary (GLuint program, GLenum binaryFormat, const void *binary, GLsizei length); GLAPI void APIENTRY glProgramParameteri (GLuint program, GLenum pname, GLint value); GLAPI void APIENTRY glUseProgramStages (GLuint pipeline, GLbitfield stages, GLuint program); GLAPI void APIENTRY glActiveShaderProgram (GLuint pipeline, GLuint program); @@ -2024,7 +2043,7 @@ GLAPI void APIENTRY glVertexAttribL1dv (GLuint index, const GLdouble *v); GLAPI void APIENTRY glVertexAttribL2dv (GLuint index, const GLdouble *v); GLAPI void APIENTRY glVertexAttribL3dv (GLuint index, const GLdouble *v); GLAPI void APIENTRY glVertexAttribL4dv (GLuint index, const GLdouble *v); -GLAPI void APIENTRY glVertexAttribLPointer (GLuint index, GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glVertexAttribLPointer (GLuint index, GLint size, GLenum type, GLsizei stride, const void *pointer); GLAPI void APIENTRY glGetVertexAttribLdv (GLuint index, GLenum pname, GLdouble *params); GLAPI void APIENTRY glViewportArrayv (GLuint first, GLsizei count, const GLfloat *v); GLAPI void APIENTRY glViewportIndexedf (GLuint index, GLfloat x, GLfloat y, GLfloat w, GLfloat h); @@ -2041,6 +2060,10 @@ GLAPI void APIENTRY glGetDoublei_v (GLenum target, GLuint index, GLdouble *data) #ifndef GL_VERSION_4_2 #define GL_VERSION_4_2 1 +#define GL_COPY_READ_BUFFER_BINDING 0x8F36 +#define GL_COPY_WRITE_BUFFER_BINDING 0x8F37 +#define GL_TRANSFORM_FEEDBACK_ACTIVE 0x8E24 +#define GL_TRANSFORM_FEEDBACK_PAUSED 0x8E23 #define GL_UNPACK_COMPRESSED_BLOCK_WIDTH 0x9127 #define GL_UNPACK_COMPRESSED_BLOCK_HEIGHT 0x9128 #define GL_UNPACK_COMPRESSED_BLOCK_DEPTH 0x9129 @@ -2144,11 +2167,15 @@ GLAPI void APIENTRY glGetDoublei_v (GLenum target, GLuint index, GLdouble *data) #define GL_MAX_GEOMETRY_IMAGE_UNIFORMS 0x90CD #define GL_MAX_FRAGMENT_IMAGE_UNIFORMS 0x90CE #define GL_MAX_COMBINED_IMAGE_UNIFORMS 0x90CF +#define GL_COMPRESSED_RGBA_BPTC_UNORM 0x8E8C +#define GL_COMPRESSED_SRGB_ALPHA_BPTC_UNORM 0x8E8D +#define GL_COMPRESSED_RGB_BPTC_SIGNED_FLOAT 0x8E8E +#define GL_COMPRESSED_RGB_BPTC_UNSIGNED_FLOAT 0x8E8F #define GL_TEXTURE_IMMUTABLE_FORMAT 0x912F typedef void (APIENTRYP PFNGLDRAWARRAYSINSTANCEDBASEINSTANCEPROC) (GLenum mode, GLint first, GLsizei count, GLsizei instancecount, GLuint baseinstance); typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDBASEINSTANCEPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLuint baseinstance); typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXBASEINSTANCEPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex, GLuint baseinstance); -typedef void (APIENTRYP PFNGLGETINTERNALFORMATI64VPROC) (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint64 *params); +typedef void (APIENTRYP PFNGLGETINTERNALFORMATIVPROC) (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint *params); typedef void (APIENTRYP PFNGLGETACTIVEATOMICCOUNTERBUFFERIVPROC) (GLuint program, GLuint bufferIndex, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLBINDIMAGETEXTUREPROC) (GLuint unit, GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum access, GLenum format); typedef void (APIENTRYP PFNGLMEMORYBARRIERPROC) (GLbitfield barriers); @@ -2161,7 +2188,7 @@ typedef void (APIENTRYP PFNGLDRAWTRANSFORMFEEDBACKSTREAMINSTANCEDPROC) (GLenum m GLAPI void APIENTRY glDrawArraysInstancedBaseInstance (GLenum mode, GLint first, GLsizei count, GLsizei instancecount, GLuint baseinstance); GLAPI void APIENTRY glDrawElementsInstancedBaseInstance (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLuint baseinstance); GLAPI void APIENTRY glDrawElementsInstancedBaseVertexBaseInstance (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex, GLuint baseinstance); -GLAPI void APIENTRY glGetInternalformati64v (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint64 *params); +GLAPI void APIENTRY glGetInternalformativ (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint *params); GLAPI void APIENTRY glGetActiveAtomicCounterBufferiv (GLuint program, GLuint bufferIndex, GLenum pname, GLint *params); GLAPI void APIENTRY glBindImageTexture (GLuint unit, GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum access, GLenum format); GLAPI void APIENTRY glMemoryBarrier (GLbitfield barriers); @@ -2200,14 +2227,15 @@ typedef void (APIENTRY *GLDEBUGPROC)(GLenum source,GLenum type,GLuint id,GLenum #define GL_MAX_COMPUTE_ATOMIC_COUNTER_BUFFERS 0x8264 #define GL_MAX_COMPUTE_ATOMIC_COUNTERS 0x8265 #define GL_MAX_COMBINED_COMPUTE_UNIFORM_COMPONENTS 0x8266 -#define GL_MAX_COMPUTE_LOCAL_INVOCATIONS 0x90EB +#define GL_MAX_COMPUTE_WORK_GROUP_INVOCATIONS 0x90EB #define GL_MAX_COMPUTE_WORK_GROUP_COUNT 0x91BE #define GL_MAX_COMPUTE_WORK_GROUP_SIZE 0x91BF -#define GL_COMPUTE_LOCAL_WORK_SIZE 0x8267 +#define GL_COMPUTE_WORK_GROUP_SIZE 0x8267 #define GL_UNIFORM_BLOCK_REFERENCED_BY_COMPUTE_SHADER 0x90EC #define GL_ATOMIC_COUNTER_BUFFER_REFERENCED_BY_COMPUTE_SHADER 0x90ED #define GL_DISPATCH_INDIRECT_BUFFER 0x90EE #define GL_DISPATCH_INDIRECT_BUFFER_BINDING 0x90EF +#define GL_COMPUTE_SHADER_BIT 0x00000020 #define GL_DEBUG_OUTPUT_SYNCHRONOUS 0x8242 #define GL_DEBUG_NEXT_LOGGED_MESSAGE_LENGTH 0x8243 #define GL_DEBUG_CALLBACK_FUNCTION 0x8244 @@ -2432,6 +2460,7 @@ typedef void (APIENTRY *GLDEBUGPROC)(GLenum source,GLenum type,GLuint id,GLenum #define GL_VERTEX_BINDING_STRIDE 0x82D8 #define GL_MAX_VERTEX_ATTRIB_RELATIVE_OFFSET 0x82D9 #define GL_MAX_VERTEX_ATTRIB_BINDINGS 0x82DA +#define GL_VERTEX_BINDING_BUFFER 0x8F4F #define GL_DISPLAY_LIST 0x82E7 typedef void (APIENTRYP PFNGLCLEARBUFFERDATAPROC) (GLenum target, GLenum internalformat, GLenum format, GLenum type, const void *data); typedef void (APIENTRYP PFNGLCLEARBUFFERSUBDATAPROC) (GLenum target, GLenum internalformat, GLintptr offset, GLsizeiptr size, GLenum format, GLenum type, const void *data); @@ -2440,6 +2469,7 @@ typedef void (APIENTRYP PFNGLDISPATCHCOMPUTEINDIRECTPROC) (GLintptr indirect); typedef void (APIENTRYP PFNGLCOPYIMAGESUBDATAPROC) (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth); typedef void (APIENTRYP PFNGLFRAMEBUFFERPARAMETERIPROC) (GLenum target, GLenum pname, GLint param); typedef void (APIENTRYP PFNGLGETFRAMEBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETINTERNALFORMATI64VPROC) (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint64 *params); typedef void (APIENTRYP PFNGLINVALIDATETEXSUBIMAGEPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth); typedef void (APIENTRYP PFNGLINVALIDATETEXIMAGEPROC) (GLuint texture, GLint level); typedef void (APIENTRYP PFNGLINVALIDATEBUFFERSUBDATAPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length); @@ -2468,7 +2498,7 @@ typedef void (APIENTRYP PFNGLVERTEXBINDINGDIVISORPROC) (GLuint bindingindex, GLu typedef void (APIENTRYP PFNGLDEBUGMESSAGECONTROLPROC) (GLenum source, GLenum type, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled); typedef void (APIENTRYP PFNGLDEBUGMESSAGEINSERTPROC) (GLenum source, GLenum type, GLuint id, GLenum severity, GLsizei length, const GLchar *buf); typedef void (APIENTRYP PFNGLDEBUGMESSAGECALLBACKPROC) (GLDEBUGPROC callback, const void *userParam); -typedef GLuint (APIENTRYP PFNGLGETDEBUGMESSAGELOGPROC) (GLuint count, GLsizei bufsize, GLenum *sources, GLenum *types, GLuint *ids, GLenum *severities, GLsizei *lengths, GLchar *messageLog); +typedef GLuint (APIENTRYP PFNGLGETDEBUGMESSAGELOGPROC) (GLuint count, GLsizei bufSize, GLenum *sources, GLenum *types, GLuint *ids, GLenum *severities, GLsizei *lengths, GLchar *messageLog); typedef void (APIENTRYP PFNGLPUSHDEBUGGROUPPROC) (GLenum source, GLuint id, GLsizei length, const GLchar *message); typedef void (APIENTRYP PFNGLPOPDEBUGGROUPPROC) (void); typedef void (APIENTRYP PFNGLOBJECTLABELPROC) (GLenum identifier, GLuint name, GLsizei length, const GLchar *label); @@ -2483,6 +2513,7 @@ GLAPI void APIENTRY glDispatchComputeIndirect (GLintptr indirect); GLAPI void APIENTRY glCopyImageSubData (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth); GLAPI void APIENTRY glFramebufferParameteri (GLenum target, GLenum pname, GLint param); GLAPI void APIENTRY glGetFramebufferParameteriv (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetInternalformati64v (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint64 *params); GLAPI void APIENTRY glInvalidateTexSubImage (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth); GLAPI void APIENTRY glInvalidateTexImage (GLuint texture, GLint level); GLAPI void APIENTRY glInvalidateBufferSubData (GLuint buffer, GLintptr offset, GLsizeiptr length); @@ -2511,7 +2542,7 @@ GLAPI void APIENTRY glVertexBindingDivisor (GLuint bindingindex, GLuint divisor) GLAPI void APIENTRY glDebugMessageControl (GLenum source, GLenum type, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled); GLAPI void APIENTRY glDebugMessageInsert (GLenum source, GLenum type, GLuint id, GLenum severity, GLsizei length, const GLchar *buf); GLAPI void APIENTRY glDebugMessageCallback (GLDEBUGPROC callback, const void *userParam); -GLAPI GLuint APIENTRY glGetDebugMessageLog (GLuint count, GLsizei bufsize, GLenum *sources, GLenum *types, GLuint *ids, GLenum *severities, GLsizei *lengths, GLchar *messageLog); +GLAPI GLuint APIENTRY glGetDebugMessageLog (GLuint count, GLsizei bufSize, GLenum *sources, GLenum *types, GLuint *ids, GLenum *severities, GLsizei *lengths, GLchar *messageLog); GLAPI void APIENTRY glPushDebugGroup (GLenum source, GLuint id, GLsizei length, const GLchar *message); GLAPI void APIENTRY glPopDebugGroup (void); GLAPI void APIENTRY glObjectLabel (GLenum identifier, GLuint name, GLsizei length, const GLchar *label); @@ -2524,6 +2555,8 @@ GLAPI void APIENTRY glGetObjectPtrLabel (const void *ptr, GLsizei bufSize, GLsiz #ifndef GL_VERSION_4_4 #define GL_VERSION_4_4 1 #define GL_MAX_VERTEX_ATTRIB_STRIDE 0x82E5 +#define GL_PRIMITIVE_RESTART_FOR_PATCHES_SUPPORTED 0x8221 +#define GL_TEXTURE_BUFFER_BINDING 0x8C2A #define GL_MAP_PERSISTENT_BIT 0x0040 #define GL_MAP_COHERENT_BIT 0x0080 #define GL_DYNAMIC_STORAGE_BIT 0x0100 @@ -2562,10 +2595,297 @@ GLAPI void APIENTRY glBindVertexBuffers (GLuint first, GLsizei count, const GLui #endif #endif /* GL_VERSION_4_4 */ +#ifndef GL_VERSION_4_5 +#define GL_VERSION_4_5 1 +#define GL_CONTEXT_LOST 0x0507 +#define GL_NEGATIVE_ONE_TO_ONE 0x935E +#define GL_ZERO_TO_ONE 0x935F +#define GL_CLIP_ORIGIN 0x935C +#define GL_CLIP_DEPTH_MODE 0x935D +#define GL_QUERY_WAIT_INVERTED 0x8E17 +#define GL_QUERY_NO_WAIT_INVERTED 0x8E18 +#define GL_QUERY_BY_REGION_WAIT_INVERTED 0x8E19 +#define GL_QUERY_BY_REGION_NO_WAIT_INVERTED 0x8E1A +#define GL_MAX_CULL_DISTANCES 0x82F9 +#define GL_MAX_COMBINED_CLIP_AND_CULL_DISTANCES 0x82FA +#define GL_TEXTURE_TARGET 0x1006 +#define GL_QUERY_TARGET 0x82EA +#define GL_GUILTY_CONTEXT_RESET 0x8253 +#define GL_INNOCENT_CONTEXT_RESET 0x8254 +#define GL_UNKNOWN_CONTEXT_RESET 0x8255 +#define GL_RESET_NOTIFICATION_STRATEGY 0x8256 +#define GL_LOSE_CONTEXT_ON_RESET 0x8252 +#define GL_NO_RESET_NOTIFICATION 0x8261 +#define GL_CONTEXT_FLAG_ROBUST_ACCESS_BIT 0x00000004 +#define GL_CONTEXT_RELEASE_BEHAVIOR 0x82FB +#define GL_CONTEXT_RELEASE_BEHAVIOR_FLUSH 0x82FC +typedef void (APIENTRYP PFNGLCLIPCONTROLPROC) (GLenum origin, GLenum depth); +typedef void (APIENTRYP PFNGLCREATETRANSFORMFEEDBACKSPROC) (GLsizei n, GLuint *ids); +typedef void (APIENTRYP PFNGLTRANSFORMFEEDBACKBUFFERBASEPROC) (GLuint xfb, GLuint index, GLuint buffer); +typedef void (APIENTRYP PFNGLTRANSFORMFEEDBACKBUFFERRANGEPROC) (GLuint xfb, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size); +typedef void (APIENTRYP PFNGLGETTRANSFORMFEEDBACKIVPROC) (GLuint xfb, GLenum pname, GLint *param); +typedef void (APIENTRYP PFNGLGETTRANSFORMFEEDBACKI_VPROC) (GLuint xfb, GLenum pname, GLuint index, GLint *param); +typedef void (APIENTRYP PFNGLGETTRANSFORMFEEDBACKI64_VPROC) (GLuint xfb, GLenum pname, GLuint index, GLint64 *param); +typedef void (APIENTRYP PFNGLCREATEBUFFERSPROC) (GLsizei n, GLuint *buffers); +typedef void (APIENTRYP PFNGLNAMEDBUFFERSTORAGEPROC) (GLuint buffer, GLsizeiptr size, const void *data, GLbitfield flags); +typedef void (APIENTRYP PFNGLNAMEDBUFFERDATAPROC) (GLuint buffer, GLsizeiptr size, const void *data, GLenum usage); +typedef void (APIENTRYP PFNGLNAMEDBUFFERSUBDATAPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data); +typedef void (APIENTRYP PFNGLCOPYNAMEDBUFFERSUBDATAPROC) (GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); +typedef void (APIENTRYP PFNGLCLEARNAMEDBUFFERDATAPROC) (GLuint buffer, GLenum internalformat, GLenum format, GLenum type, const void *data); +typedef void (APIENTRYP PFNGLCLEARNAMEDBUFFERSUBDATAPROC) (GLuint buffer, GLenum internalformat, GLintptr offset, GLsizeiptr size, GLenum format, GLenum type, const void *data); +typedef void *(APIENTRYP PFNGLMAPNAMEDBUFFERPROC) (GLuint buffer, GLenum access); +typedef void *(APIENTRYP PFNGLMAPNAMEDBUFFERRANGEPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length, GLbitfield access); +typedef GLboolean (APIENTRYP PFNGLUNMAPNAMEDBUFFERPROC) (GLuint buffer); +typedef void (APIENTRYP PFNGLFLUSHMAPPEDNAMEDBUFFERRANGEPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length); +typedef void (APIENTRYP PFNGLGETNAMEDBUFFERPARAMETERIVPROC) (GLuint buffer, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETNAMEDBUFFERPARAMETERI64VPROC) (GLuint buffer, GLenum pname, GLint64 *params); +typedef void (APIENTRYP PFNGLGETNAMEDBUFFERPOINTERVPROC) (GLuint buffer, GLenum pname, void **params); +typedef void (APIENTRYP PFNGLGETNAMEDBUFFERSUBDATAPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, void *data); +typedef void (APIENTRYP PFNGLCREATEFRAMEBUFFERSPROC) (GLsizei n, GLuint *framebuffers); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERRENDERBUFFERPROC) (GLuint framebuffer, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERPARAMETERIPROC) (GLuint framebuffer, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERTEXTUREPROC) (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERTEXTURELAYERPROC) (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level, GLint layer); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERDRAWBUFFERPROC) (GLuint framebuffer, GLenum buf); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERDRAWBUFFERSPROC) (GLuint framebuffer, GLsizei n, const GLenum *bufs); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERREADBUFFERPROC) (GLuint framebuffer, GLenum src); +typedef void (APIENTRYP PFNGLINVALIDATENAMEDFRAMEBUFFERDATAPROC) (GLuint framebuffer, GLsizei numAttachments, const GLenum *attachments); +typedef void (APIENTRYP PFNGLINVALIDATENAMEDFRAMEBUFFERSUBDATAPROC) (GLuint framebuffer, GLsizei numAttachments, const GLenum *attachments, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLCLEARNAMEDFRAMEBUFFERIVPROC) (GLuint framebuffer, GLenum buffer, GLint drawbuffer, const GLint *value); +typedef void (APIENTRYP PFNGLCLEARNAMEDFRAMEBUFFERUIVPROC) (GLuint framebuffer, GLenum buffer, GLint drawbuffer, const GLuint *value); +typedef void (APIENTRYP PFNGLCLEARNAMEDFRAMEBUFFERFVPROC) (GLuint framebuffer, GLenum buffer, GLint drawbuffer, const GLfloat *value); +typedef void (APIENTRYP PFNGLCLEARNAMEDFRAMEBUFFERFIPROC) (GLuint framebuffer, GLenum buffer, const GLfloat depth, GLint stencil); +typedef void (APIENTRYP PFNGLBLITNAMEDFRAMEBUFFERPROC) (GLuint readFramebuffer, GLuint drawFramebuffer, GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); +typedef GLenum (APIENTRYP PFNGLCHECKNAMEDFRAMEBUFFERSTATUSPROC) (GLuint framebuffer, GLenum target); +typedef void (APIENTRYP PFNGLGETNAMEDFRAMEBUFFERPARAMETERIVPROC) (GLuint framebuffer, GLenum pname, GLint *param); +typedef void (APIENTRYP PFNGLGETNAMEDFRAMEBUFFERATTACHMENTPARAMETERIVPROC) (GLuint framebuffer, GLenum attachment, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLCREATERENDERBUFFERSPROC) (GLsizei n, GLuint *renderbuffers); +typedef void (APIENTRYP PFNGLNAMEDRENDERBUFFERSTORAGEPROC) (GLuint renderbuffer, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLNAMEDRENDERBUFFERSTORAGEMULTISAMPLEPROC) (GLuint renderbuffer, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLGETNAMEDRENDERBUFFERPARAMETERIVPROC) (GLuint renderbuffer, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLCREATETEXTURESPROC) (GLenum target, GLsizei n, GLuint *textures); +typedef void (APIENTRYP PFNGLTEXTUREBUFFERPROC) (GLuint texture, GLenum internalformat, GLuint buffer); +typedef void (APIENTRYP PFNGLTEXTUREBUFFERRANGEPROC) (GLuint texture, GLenum internalformat, GLuint buffer, GLintptr offset, GLsizeiptr size); +typedef void (APIENTRYP PFNGLTEXTURESTORAGE1DPROC) (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width); +typedef void (APIENTRYP PFNGLTEXTURESTORAGE2DPROC) (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLTEXTURESTORAGE3DPROC) (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth); +typedef void (APIENTRYP PFNGLTEXTURESTORAGE2DMULTISAMPLEPROC) (GLuint texture, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations); +typedef void (APIENTRYP PFNGLTEXTURESTORAGE3DMULTISAMPLEPROC) (GLuint texture, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations); +typedef void (APIENTRYP PFNGLTEXTURESUBIMAGE1DPROC) (GLuint texture, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXTURESUBIMAGE2DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXTURESUBIMAGE3DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTURESUBIMAGE1DPROC) (GLuint texture, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTURESUBIMAGE2DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTURESUBIMAGE3DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOPYTEXTURESUBIMAGE1DPROC) (GLuint texture, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); +typedef void (APIENTRYP PFNGLCOPYTEXTURESUBIMAGE2DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLCOPYTEXTURESUBIMAGE3DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERFPROC) (GLuint texture, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERFVPROC) (GLuint texture, GLenum pname, const GLfloat *param); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERIPROC) (GLuint texture, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERIIVPROC) (GLuint texture, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERIUIVPROC) (GLuint texture, GLenum pname, const GLuint *params); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERIVPROC) (GLuint texture, GLenum pname, const GLint *param); +typedef void (APIENTRYP PFNGLGENERATETEXTUREMIPMAPPROC) (GLuint texture); +typedef void (APIENTRYP PFNGLBINDTEXTUREUNITPROC) (GLuint unit, GLuint texture); +typedef void (APIENTRYP PFNGLGETTEXTUREIMAGEPROC) (GLuint texture, GLint level, GLenum format, GLenum type, GLsizei bufSize, void *pixels); +typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXTUREIMAGEPROC) (GLuint texture, GLint level, GLsizei bufSize, void *pixels); +typedef void (APIENTRYP PFNGLGETTEXTURELEVELPARAMETERFVPROC) (GLuint texture, GLint level, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETTEXTURELEVELPARAMETERIVPROC) (GLuint texture, GLint level, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETTEXTUREPARAMETERFVPROC) (GLuint texture, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETTEXTUREPARAMETERIIVPROC) (GLuint texture, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETTEXTUREPARAMETERIUIVPROC) (GLuint texture, GLenum pname, GLuint *params); +typedef void (APIENTRYP PFNGLGETTEXTUREPARAMETERIVPROC) (GLuint texture, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLCREATEVERTEXARRAYSPROC) (GLsizei n, GLuint *arrays); +typedef void (APIENTRYP PFNGLDISABLEVERTEXARRAYATTRIBPROC) (GLuint vaobj, GLuint index); +typedef void (APIENTRYP PFNGLENABLEVERTEXARRAYATTRIBPROC) (GLuint vaobj, GLuint index); +typedef void (APIENTRYP PFNGLVERTEXARRAYELEMENTBUFFERPROC) (GLuint vaobj, GLuint buffer); +typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXBUFFERPROC) (GLuint vaobj, GLuint bindingindex, GLuint buffer, GLintptr offset, GLsizei stride); +typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXBUFFERSPROC) (GLuint vaobj, GLuint first, GLsizei count, const GLuint *buffers, const GLintptr *offsets, const GLsizei *strides); +typedef void (APIENTRYP PFNGLVERTEXARRAYATTRIBBINDINGPROC) (GLuint vaobj, GLuint attribindex, GLuint bindingindex); +typedef void (APIENTRYP PFNGLVERTEXARRAYATTRIBFORMATPROC) (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLboolean normalized, GLuint relativeoffset); +typedef void (APIENTRYP PFNGLVERTEXARRAYATTRIBIFORMATPROC) (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset); +typedef void (APIENTRYP PFNGLVERTEXARRAYATTRIBLFORMATPROC) (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset); +typedef void (APIENTRYP PFNGLVERTEXARRAYBINDINGDIVISORPROC) (GLuint vaobj, GLuint bindingindex, GLuint divisor); +typedef void (APIENTRYP PFNGLGETVERTEXARRAYIVPROC) (GLuint vaobj, GLenum pname, GLint *param); +typedef void (APIENTRYP PFNGLGETVERTEXARRAYINDEXEDIVPROC) (GLuint vaobj, GLuint index, GLenum pname, GLint *param); +typedef void (APIENTRYP PFNGLGETVERTEXARRAYINDEXED64IVPROC) (GLuint vaobj, GLuint index, GLenum pname, GLint64 *param); +typedef void (APIENTRYP PFNGLCREATESAMPLERSPROC) (GLsizei n, GLuint *samplers); +typedef void (APIENTRYP PFNGLCREATEPROGRAMPIPELINESPROC) (GLsizei n, GLuint *pipelines); +typedef void (APIENTRYP PFNGLCREATEQUERIESPROC) (GLenum target, GLsizei n, GLuint *ids); +typedef void (APIENTRYP PFNGLGETQUERYBUFFEROBJECTI64VPROC) (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +typedef void (APIENTRYP PFNGLGETQUERYBUFFEROBJECTIVPROC) (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +typedef void (APIENTRYP PFNGLGETQUERYBUFFEROBJECTUI64VPROC) (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +typedef void (APIENTRYP PFNGLGETQUERYBUFFEROBJECTUIVPROC) (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +typedef void (APIENTRYP PFNGLMEMORYBARRIERBYREGIONPROC) (GLbitfield barriers); +typedef void (APIENTRYP PFNGLGETTEXTURESUBIMAGEPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, GLsizei bufSize, void *pixels); +typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXTURESUBIMAGEPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei bufSize, void *pixels); +typedef GLenum (APIENTRYP PFNGLGETGRAPHICSRESETSTATUSPROC) (void); +typedef void (APIENTRYP PFNGLGETNCOMPRESSEDTEXIMAGEPROC) (GLenum target, GLint lod, GLsizei bufSize, void *pixels); +typedef void (APIENTRYP PFNGLGETNTEXIMAGEPROC) (GLenum target, GLint level, GLenum format, GLenum type, GLsizei bufSize, void *pixels); +typedef void (APIENTRYP PFNGLGETNUNIFORMDVPROC) (GLuint program, GLint location, GLsizei bufSize, GLdouble *params); +typedef void (APIENTRYP PFNGLGETNUNIFORMFVPROC) (GLuint program, GLint location, GLsizei bufSize, GLfloat *params); +typedef void (APIENTRYP PFNGLGETNUNIFORMIVPROC) (GLuint program, GLint location, GLsizei bufSize, GLint *params); +typedef void (APIENTRYP PFNGLGETNUNIFORMUIVPROC) (GLuint program, GLint location, GLsizei bufSize, GLuint *params); +typedef void (APIENTRYP PFNGLREADNPIXELSPROC) (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, void *data); +typedef void (APIENTRYP PFNGLGETNMAPDVPROC) (GLenum target, GLenum query, GLsizei bufSize, GLdouble *v); +typedef void (APIENTRYP PFNGLGETNMAPFVPROC) (GLenum target, GLenum query, GLsizei bufSize, GLfloat *v); +typedef void (APIENTRYP PFNGLGETNMAPIVPROC) (GLenum target, GLenum query, GLsizei bufSize, GLint *v); +typedef void (APIENTRYP PFNGLGETNPIXELMAPFVPROC) (GLenum map, GLsizei bufSize, GLfloat *values); +typedef void (APIENTRYP PFNGLGETNPIXELMAPUIVPROC) (GLenum map, GLsizei bufSize, GLuint *values); +typedef void (APIENTRYP PFNGLGETNPIXELMAPUSVPROC) (GLenum map, GLsizei bufSize, GLushort *values); +typedef void (APIENTRYP PFNGLGETNPOLYGONSTIPPLEPROC) (GLsizei bufSize, GLubyte *pattern); +typedef void (APIENTRYP PFNGLGETNCOLORTABLEPROC) (GLenum target, GLenum format, GLenum type, GLsizei bufSize, void *table); +typedef void (APIENTRYP PFNGLGETNCONVOLUTIONFILTERPROC) (GLenum target, GLenum format, GLenum type, GLsizei bufSize, void *image); +typedef void (APIENTRYP PFNGLGETNSEPARABLEFILTERPROC) (GLenum target, GLenum format, GLenum type, GLsizei rowBufSize, void *row, GLsizei columnBufSize, void *column, void *span); +typedef void (APIENTRYP PFNGLGETNHISTOGRAMPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, void *values); +typedef void (APIENTRYP PFNGLGETNMINMAXPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, void *values); +typedef void (APIENTRYP PFNGLTEXTUREBARRIERPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glClipControl (GLenum origin, GLenum depth); +GLAPI void APIENTRY glCreateTransformFeedbacks (GLsizei n, GLuint *ids); +GLAPI void APIENTRY glTransformFeedbackBufferBase (GLuint xfb, GLuint index, GLuint buffer); +GLAPI void APIENTRY glTransformFeedbackBufferRange (GLuint xfb, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size); +GLAPI void APIENTRY glGetTransformFeedbackiv (GLuint xfb, GLenum pname, GLint *param); +GLAPI void APIENTRY glGetTransformFeedbacki_v (GLuint xfb, GLenum pname, GLuint index, GLint *param); +GLAPI void APIENTRY glGetTransformFeedbacki64_v (GLuint xfb, GLenum pname, GLuint index, GLint64 *param); +GLAPI void APIENTRY glCreateBuffers (GLsizei n, GLuint *buffers); +GLAPI void APIENTRY glNamedBufferStorage (GLuint buffer, GLsizeiptr size, const void *data, GLbitfield flags); +GLAPI void APIENTRY glNamedBufferData (GLuint buffer, GLsizeiptr size, const void *data, GLenum usage); +GLAPI void APIENTRY glNamedBufferSubData (GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data); +GLAPI void APIENTRY glCopyNamedBufferSubData (GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); +GLAPI void APIENTRY glClearNamedBufferData (GLuint buffer, GLenum internalformat, GLenum format, GLenum type, const void *data); +GLAPI void APIENTRY glClearNamedBufferSubData (GLuint buffer, GLenum internalformat, GLintptr offset, GLsizeiptr size, GLenum format, GLenum type, const void *data); +GLAPI void *APIENTRY glMapNamedBuffer (GLuint buffer, GLenum access); +GLAPI void *APIENTRY glMapNamedBufferRange (GLuint buffer, GLintptr offset, GLsizeiptr length, GLbitfield access); +GLAPI GLboolean APIENTRY glUnmapNamedBuffer (GLuint buffer); +GLAPI void APIENTRY glFlushMappedNamedBufferRange (GLuint buffer, GLintptr offset, GLsizeiptr length); +GLAPI void APIENTRY glGetNamedBufferParameteriv (GLuint buffer, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetNamedBufferParameteri64v (GLuint buffer, GLenum pname, GLint64 *params); +GLAPI void APIENTRY glGetNamedBufferPointerv (GLuint buffer, GLenum pname, void **params); +GLAPI void APIENTRY glGetNamedBufferSubData (GLuint buffer, GLintptr offset, GLsizeiptr size, void *data); +GLAPI void APIENTRY glCreateFramebuffers (GLsizei n, GLuint *framebuffers); +GLAPI void APIENTRY glNamedFramebufferRenderbuffer (GLuint framebuffer, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer); +GLAPI void APIENTRY glNamedFramebufferParameteri (GLuint framebuffer, GLenum pname, GLint param); +GLAPI void APIENTRY glNamedFramebufferTexture (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level); +GLAPI void APIENTRY glNamedFramebufferTextureLayer (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level, GLint layer); +GLAPI void APIENTRY glNamedFramebufferDrawBuffer (GLuint framebuffer, GLenum buf); +GLAPI void APIENTRY glNamedFramebufferDrawBuffers (GLuint framebuffer, GLsizei n, const GLenum *bufs); +GLAPI void APIENTRY glNamedFramebufferReadBuffer (GLuint framebuffer, GLenum src); +GLAPI void APIENTRY glInvalidateNamedFramebufferData (GLuint framebuffer, GLsizei numAttachments, const GLenum *attachments); +GLAPI void APIENTRY glInvalidateNamedFramebufferSubData (GLuint framebuffer, GLsizei numAttachments, const GLenum *attachments, GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glClearNamedFramebufferiv (GLuint framebuffer, GLenum buffer, GLint drawbuffer, const GLint *value); +GLAPI void APIENTRY glClearNamedFramebufferuiv (GLuint framebuffer, GLenum buffer, GLint drawbuffer, const GLuint *value); +GLAPI void APIENTRY glClearNamedFramebufferfv (GLuint framebuffer, GLenum buffer, GLint drawbuffer, const GLfloat *value); +GLAPI void APIENTRY glClearNamedFramebufferfi (GLuint framebuffer, GLenum buffer, const GLfloat depth, GLint stencil); +GLAPI void APIENTRY glBlitNamedFramebuffer (GLuint readFramebuffer, GLuint drawFramebuffer, GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); +GLAPI GLenum APIENTRY glCheckNamedFramebufferStatus (GLuint framebuffer, GLenum target); +GLAPI void APIENTRY glGetNamedFramebufferParameteriv (GLuint framebuffer, GLenum pname, GLint *param); +GLAPI void APIENTRY glGetNamedFramebufferAttachmentParameteriv (GLuint framebuffer, GLenum attachment, GLenum pname, GLint *params); +GLAPI void APIENTRY glCreateRenderbuffers (GLsizei n, GLuint *renderbuffers); +GLAPI void APIENTRY glNamedRenderbufferStorage (GLuint renderbuffer, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glNamedRenderbufferStorageMultisample (GLuint renderbuffer, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glGetNamedRenderbufferParameteriv (GLuint renderbuffer, GLenum pname, GLint *params); +GLAPI void APIENTRY glCreateTextures (GLenum target, GLsizei n, GLuint *textures); +GLAPI void APIENTRY glTextureBuffer (GLuint texture, GLenum internalformat, GLuint buffer); +GLAPI void APIENTRY glTextureBufferRange (GLuint texture, GLenum internalformat, GLuint buffer, GLintptr offset, GLsizeiptr size); +GLAPI void APIENTRY glTextureStorage1D (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width); +GLAPI void APIENTRY glTextureStorage2D (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glTextureStorage3D (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth); +GLAPI void APIENTRY glTextureStorage2DMultisample (GLuint texture, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations); +GLAPI void APIENTRY glTextureStorage3DMultisample (GLuint texture, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations); +GLAPI void APIENTRY glTextureSubImage1D (GLuint texture, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTextureSubImage2D (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTextureSubImage3D (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glCompressedTextureSubImage1D (GLuint texture, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTextureSubImage2D (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTextureSubImage3D (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCopyTextureSubImage1D (GLuint texture, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); +GLAPI void APIENTRY glCopyTextureSubImage2D (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glCopyTextureSubImage3D (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glTextureParameterf (GLuint texture, GLenum pname, GLfloat param); +GLAPI void APIENTRY glTextureParameterfv (GLuint texture, GLenum pname, const GLfloat *param); +GLAPI void APIENTRY glTextureParameteri (GLuint texture, GLenum pname, GLint param); +GLAPI void APIENTRY glTextureParameterIiv (GLuint texture, GLenum pname, const GLint *params); +GLAPI void APIENTRY glTextureParameterIuiv (GLuint texture, GLenum pname, const GLuint *params); +GLAPI void APIENTRY glTextureParameteriv (GLuint texture, GLenum pname, const GLint *param); +GLAPI void APIENTRY glGenerateTextureMipmap (GLuint texture); +GLAPI void APIENTRY glBindTextureUnit (GLuint unit, GLuint texture); +GLAPI void APIENTRY glGetTextureImage (GLuint texture, GLint level, GLenum format, GLenum type, GLsizei bufSize, void *pixels); +GLAPI void APIENTRY glGetCompressedTextureImage (GLuint texture, GLint level, GLsizei bufSize, void *pixels); +GLAPI void APIENTRY glGetTextureLevelParameterfv (GLuint texture, GLint level, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetTextureLevelParameteriv (GLuint texture, GLint level, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetTextureParameterfv (GLuint texture, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetTextureParameterIiv (GLuint texture, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetTextureParameterIuiv (GLuint texture, GLenum pname, GLuint *params); +GLAPI void APIENTRY glGetTextureParameteriv (GLuint texture, GLenum pname, GLint *params); +GLAPI void APIENTRY glCreateVertexArrays (GLsizei n, GLuint *arrays); +GLAPI void APIENTRY glDisableVertexArrayAttrib (GLuint vaobj, GLuint index); +GLAPI void APIENTRY glEnableVertexArrayAttrib (GLuint vaobj, GLuint index); +GLAPI void APIENTRY glVertexArrayElementBuffer (GLuint vaobj, GLuint buffer); +GLAPI void APIENTRY glVertexArrayVertexBuffer (GLuint vaobj, GLuint bindingindex, GLuint buffer, GLintptr offset, GLsizei stride); +GLAPI void APIENTRY glVertexArrayVertexBuffers (GLuint vaobj, GLuint first, GLsizei count, const GLuint *buffers, const GLintptr *offsets, const GLsizei *strides); +GLAPI void APIENTRY glVertexArrayAttribBinding (GLuint vaobj, GLuint attribindex, GLuint bindingindex); +GLAPI void APIENTRY glVertexArrayAttribFormat (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLboolean normalized, GLuint relativeoffset); +GLAPI void APIENTRY glVertexArrayAttribIFormat (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset); +GLAPI void APIENTRY glVertexArrayAttribLFormat (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset); +GLAPI void APIENTRY glVertexArrayBindingDivisor (GLuint vaobj, GLuint bindingindex, GLuint divisor); +GLAPI void APIENTRY glGetVertexArrayiv (GLuint vaobj, GLenum pname, GLint *param); +GLAPI void APIENTRY glGetVertexArrayIndexediv (GLuint vaobj, GLuint index, GLenum pname, GLint *param); +GLAPI void APIENTRY glGetVertexArrayIndexed64iv (GLuint vaobj, GLuint index, GLenum pname, GLint64 *param); +GLAPI void APIENTRY glCreateSamplers (GLsizei n, GLuint *samplers); +GLAPI void APIENTRY glCreateProgramPipelines (GLsizei n, GLuint *pipelines); +GLAPI void APIENTRY glCreateQueries (GLenum target, GLsizei n, GLuint *ids); +GLAPI void APIENTRY glGetQueryBufferObjecti64v (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +GLAPI void APIENTRY glGetQueryBufferObjectiv (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +GLAPI void APIENTRY glGetQueryBufferObjectui64v (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +GLAPI void APIENTRY glGetQueryBufferObjectuiv (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +GLAPI void APIENTRY glMemoryBarrierByRegion (GLbitfield barriers); +GLAPI void APIENTRY glGetTextureSubImage (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, GLsizei bufSize, void *pixels); +GLAPI void APIENTRY glGetCompressedTextureSubImage (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei bufSize, void *pixels); +GLAPI GLenum APIENTRY glGetGraphicsResetStatus (void); +GLAPI void APIENTRY glGetnCompressedTexImage (GLenum target, GLint lod, GLsizei bufSize, void *pixels); +GLAPI void APIENTRY glGetnTexImage (GLenum target, GLint level, GLenum format, GLenum type, GLsizei bufSize, void *pixels); +GLAPI void APIENTRY glGetnUniformdv (GLuint program, GLint location, GLsizei bufSize, GLdouble *params); +GLAPI void APIENTRY glGetnUniformfv (GLuint program, GLint location, GLsizei bufSize, GLfloat *params); +GLAPI void APIENTRY glGetnUniformiv (GLuint program, GLint location, GLsizei bufSize, GLint *params); +GLAPI void APIENTRY glGetnUniformuiv (GLuint program, GLint location, GLsizei bufSize, GLuint *params); +GLAPI void APIENTRY glReadnPixels (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, void *data); +GLAPI void APIENTRY glGetnMapdv (GLenum target, GLenum query, GLsizei bufSize, GLdouble *v); +GLAPI void APIENTRY glGetnMapfv (GLenum target, GLenum query, GLsizei bufSize, GLfloat *v); +GLAPI void APIENTRY glGetnMapiv (GLenum target, GLenum query, GLsizei bufSize, GLint *v); +GLAPI void APIENTRY glGetnPixelMapfv (GLenum map, GLsizei bufSize, GLfloat *values); +GLAPI void APIENTRY glGetnPixelMapuiv (GLenum map, GLsizei bufSize, GLuint *values); +GLAPI void APIENTRY glGetnPixelMapusv (GLenum map, GLsizei bufSize, GLushort *values); +GLAPI void APIENTRY glGetnPolygonStipple (GLsizei bufSize, GLubyte *pattern); +GLAPI void APIENTRY glGetnColorTable (GLenum target, GLenum format, GLenum type, GLsizei bufSize, void *table); +GLAPI void APIENTRY glGetnConvolutionFilter (GLenum target, GLenum format, GLenum type, GLsizei bufSize, void *image); +GLAPI void APIENTRY glGetnSeparableFilter (GLenum target, GLenum format, GLenum type, GLsizei rowBufSize, void *row, GLsizei columnBufSize, void *column, void *span); +GLAPI void APIENTRY glGetnHistogram (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, void *values); +GLAPI void APIENTRY glGetnMinmax (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, void *values); +GLAPI void APIENTRY glTextureBarrier (void); +#endif +#endif /* GL_VERSION_4_5 */ + #ifndef GL_ARB_ES2_compatibility #define GL_ARB_ES2_compatibility 1 #endif /* GL_ARB_ES2_compatibility */ +#ifndef GL_ARB_ES3_1_compatibility +#define GL_ARB_ES3_1_compatibility 1 +#endif /* GL_ARB_ES3_1_compatibility */ + +#ifndef GL_ARB_ES3_2_compatibility +#define GL_ARB_ES3_2_compatibility 1 +#define GL_PRIMITIVE_BOUNDING_BOX_ARB 0x92BE +#define GL_MULTISAMPLE_LINE_WIDTH_RANGE_ARB 0x9381 +#define GL_MULTISAMPLE_LINE_WIDTH_GRANULARITY_ARB 0x9382 +typedef void (APIENTRYP PFNGLPRIMITIVEBOUNDINGBOXARBPROC) (GLfloat minX, GLfloat minY, GLfloat minZ, GLfloat minW, GLfloat maxX, GLfloat maxY, GLfloat maxZ, GLfloat maxW); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPrimitiveBoundingBoxARB (GLfloat minX, GLfloat minY, GLfloat minZ, GLfloat minW, GLfloat maxX, GLfloat maxY, GLfloat maxZ, GLfloat maxW); +#endif +#endif /* GL_ARB_ES3_2_compatibility */ + #ifndef GL_ARB_ES3_compatibility #define GL_ARB_ES3_compatibility 1 #endif /* GL_ARB_ES3_compatibility */ @@ -2646,6 +2966,10 @@ GLAPI GLsync APIENTRY glCreateSyncFromCLeventARB (struct _cl_context *context, s #define GL_ARB_clear_texture 1 #endif /* GL_ARB_clear_texture */ +#ifndef GL_ARB_clip_control +#define GL_ARB_clip_control 1 +#endif /* GL_ARB_clip_control */ + #ifndef GL_ARB_color_buffer_float #define GL_ARB_color_buffer_float 1 #define GL_RGBA_FLOAT_MODE_ARB 0x8820 @@ -2669,7 +2993,6 @@ GLAPI void APIENTRY glClampColorARB (GLenum target, GLenum clamp); #ifndef GL_ARB_compute_shader #define GL_ARB_compute_shader 1 -#define GL_COMPUTE_SHADER_BIT 0x00000020 #endif /* GL_ARB_compute_shader */ #ifndef GL_ARB_compute_variable_group_size @@ -2684,20 +3007,26 @@ GLAPI void APIENTRY glDispatchComputeGroupSizeARB (GLuint num_groups_x, GLuint n #endif #endif /* GL_ARB_compute_variable_group_size */ +#ifndef GL_ARB_conditional_render_inverted +#define GL_ARB_conditional_render_inverted 1 +#endif /* GL_ARB_conditional_render_inverted */ + #ifndef GL_ARB_conservative_depth #define GL_ARB_conservative_depth 1 #endif /* GL_ARB_conservative_depth */ #ifndef GL_ARB_copy_buffer #define GL_ARB_copy_buffer 1 -#define GL_COPY_READ_BUFFER_BINDING 0x8F36 -#define GL_COPY_WRITE_BUFFER_BINDING 0x8F37 #endif /* GL_ARB_copy_buffer */ #ifndef GL_ARB_copy_image #define GL_ARB_copy_image 1 #endif /* GL_ARB_copy_image */ +#ifndef GL_ARB_cull_distance +#define GL_ARB_cull_distance 1 +#endif /* GL_ARB_cull_distance */ + #ifndef GL_ARB_debug_output #define GL_ARB_debug_output 1 typedef void (APIENTRY *GLDEBUGPROCARB)(GLenum source,GLenum type,GLuint id,GLenum severity,GLsizei length,const GLchar *message,const void *userParam); @@ -2726,12 +3055,12 @@ typedef void (APIENTRY *GLDEBUGPROCARB)(GLenum source,GLenum type,GLuint id,GLe typedef void (APIENTRYP PFNGLDEBUGMESSAGECONTROLARBPROC) (GLenum source, GLenum type, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled); typedef void (APIENTRYP PFNGLDEBUGMESSAGEINSERTARBPROC) (GLenum source, GLenum type, GLuint id, GLenum severity, GLsizei length, const GLchar *buf); typedef void (APIENTRYP PFNGLDEBUGMESSAGECALLBACKARBPROC) (GLDEBUGPROCARB callback, const void *userParam); -typedef GLuint (APIENTRYP PFNGLGETDEBUGMESSAGELOGARBPROC) (GLuint count, GLsizei bufsize, GLenum *sources, GLenum *types, GLuint *ids, GLenum *severities, GLsizei *lengths, GLchar *messageLog); +typedef GLuint (APIENTRYP PFNGLGETDEBUGMESSAGELOGARBPROC) (GLuint count, GLsizei bufSize, GLenum *sources, GLenum *types, GLuint *ids, GLenum *severities, GLsizei *lengths, GLchar *messageLog); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glDebugMessageControlARB (GLenum source, GLenum type, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled); GLAPI void APIENTRY glDebugMessageInsertARB (GLenum source, GLenum type, GLuint id, GLenum severity, GLsizei length, const GLchar *buf); GLAPI void APIENTRY glDebugMessageCallbackARB (GLDEBUGPROCARB callback, const void *userParam); -GLAPI GLuint APIENTRY glGetDebugMessageLogARB (GLuint count, GLsizei bufsize, GLenum *sources, GLenum *types, GLuint *ids, GLenum *severities, GLsizei *lengths, GLchar *messageLog); +GLAPI GLuint APIENTRY glGetDebugMessageLogARB (GLuint count, GLsizei bufSize, GLenum *sources, GLenum *types, GLuint *ids, GLenum *severities, GLsizei *lengths, GLchar *messageLog); #endif #endif /* GL_ARB_debug_output */ @@ -2752,6 +3081,14 @@ GLAPI GLuint APIENTRY glGetDebugMessageLogARB (GLuint count, GLsizei bufsize, GL #define GL_DEPTH_TEXTURE_MODE_ARB 0x884B #endif /* GL_ARB_depth_texture */ +#ifndef GL_ARB_derivative_control +#define GL_ARB_derivative_control 1 +#endif /* GL_ARB_derivative_control */ + +#ifndef GL_ARB_direct_state_access +#define GL_ARB_direct_state_access 1 +#endif /* GL_ARB_direct_state_access */ + #ifndef GL_ARB_draw_buffers #define GL_ARB_draw_buffers 1 #define GL_MAX_DRAW_BUFFERS_ARB 0x8824 @@ -2802,10 +3139,10 @@ GLAPI void APIENTRY glBlendFuncSeparateiARB (GLuint buf, GLenum srcRGB, GLenum d #ifndef GL_ARB_draw_instanced #define GL_ARB_draw_instanced 1 typedef void (APIENTRYP PFNGLDRAWARRAYSINSTANCEDARBPROC) (GLenum mode, GLint first, GLsizei count, GLsizei primcount); -typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDARBPROC) (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLsizei primcount); +typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDARBPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei primcount); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glDrawArraysInstancedARB (GLenum mode, GLint first, GLsizei count, GLsizei primcount); -GLAPI void APIENTRY glDrawElementsInstancedARB (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLsizei primcount); +GLAPI void APIENTRY glDrawElementsInstancedARB (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei primcount); #endif #endif /* GL_ARB_draw_instanced */ @@ -2909,7 +3246,7 @@ GLAPI void APIENTRY glDrawElementsInstancedARB (GLenum mode, GLsizei count, GLen #define GL_MATRIX29_ARB 0x88DD #define GL_MATRIX30_ARB 0x88DE #define GL_MATRIX31_ARB 0x88DF -typedef void (APIENTRYP PFNGLPROGRAMSTRINGARBPROC) (GLenum target, GLenum format, GLsizei len, const GLvoid *string); +typedef void (APIENTRYP PFNGLPROGRAMSTRINGARBPROC) (GLenum target, GLenum format, GLsizei len, const void *string); typedef void (APIENTRYP PFNGLBINDPROGRAMARBPROC) (GLenum target, GLuint program); typedef void (APIENTRYP PFNGLDELETEPROGRAMSARBPROC) (GLsizei n, const GLuint *programs); typedef void (APIENTRYP PFNGLGENPROGRAMSARBPROC) (GLsizei n, GLuint *programs); @@ -2926,10 +3263,10 @@ typedef void (APIENTRYP PFNGLGETPROGRAMENVPARAMETERFVARBPROC) (GLenum target, GL typedef void (APIENTRYP PFNGLGETPROGRAMLOCALPARAMETERDVARBPROC) (GLenum target, GLuint index, GLdouble *params); typedef void (APIENTRYP PFNGLGETPROGRAMLOCALPARAMETERFVARBPROC) (GLenum target, GLuint index, GLfloat *params); typedef void (APIENTRYP PFNGLGETPROGRAMIVARBPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETPROGRAMSTRINGARBPROC) (GLenum target, GLenum pname, GLvoid *string); +typedef void (APIENTRYP PFNGLGETPROGRAMSTRINGARBPROC) (GLenum target, GLenum pname, void *string); typedef GLboolean (APIENTRYP PFNGLISPROGRAMARBPROC) (GLuint program); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glProgramStringARB (GLenum target, GLenum format, GLsizei len, const GLvoid *string); +GLAPI void APIENTRY glProgramStringARB (GLenum target, GLenum format, GLsizei len, const void *string); GLAPI void APIENTRY glBindProgramARB (GLenum target, GLuint program); GLAPI void APIENTRY glDeleteProgramsARB (GLsizei n, const GLuint *programs); GLAPI void APIENTRY glGenProgramsARB (GLsizei n, GLuint *programs); @@ -2946,7 +3283,7 @@ GLAPI void APIENTRY glGetProgramEnvParameterfvARB (GLenum target, GLuint index, GLAPI void APIENTRY glGetProgramLocalParameterdvARB (GLenum target, GLuint index, GLdouble *params); GLAPI void APIENTRY glGetProgramLocalParameterfvARB (GLenum target, GLuint index, GLfloat *params); GLAPI void APIENTRY glGetProgramivARB (GLenum target, GLenum pname, GLint *params); -GLAPI void APIENTRY glGetProgramStringARB (GLenum target, GLenum pname, GLvoid *string); +GLAPI void APIENTRY glGetProgramStringARB (GLenum target, GLenum pname, void *string); GLAPI GLboolean APIENTRY glIsProgramARB (GLuint program); #endif #endif /* GL_ARB_fragment_program */ @@ -2962,6 +3299,10 @@ GLAPI GLboolean APIENTRY glIsProgramARB (GLuint program); #define GL_FRAGMENT_SHADER_DERIVATIVE_HINT_ARB 0x8B8B #endif /* GL_ARB_fragment_shader */ +#ifndef GL_ARB_fragment_shader_interlock +#define GL_ARB_fragment_shader_interlock 1 +#endif /* GL_ARB_fragment_shader_interlock */ + #ifndef GL_ARB_framebuffer_no_attachments #define GL_ARB_framebuffer_no_attachments 1 #endif /* GL_ARB_framebuffer_no_attachments */ @@ -3010,6 +3351,10 @@ GLAPI void APIENTRY glFramebufferTextureFaceARB (GLenum target, GLenum attachmen #define GL_ARB_get_program_binary 1 #endif /* GL_ARB_get_program_binary */ +#ifndef GL_ARB_get_texture_sub_image +#define GL_ARB_get_texture_sub_image 1 +#endif /* GL_ARB_get_texture_sub_image */ + #ifndef GL_ARB_gpu_shader5 #define GL_ARB_gpu_shader5 1 #endif /* GL_ARB_gpu_shader5 */ @@ -3018,6 +3363,91 @@ GLAPI void APIENTRY glFramebufferTextureFaceARB (GLenum target, GLenum attachmen #define GL_ARB_gpu_shader_fp64 1 #endif /* GL_ARB_gpu_shader_fp64 */ +#ifndef GL_ARB_gpu_shader_int64 +#define GL_ARB_gpu_shader_int64 1 +#define GL_INT64_ARB 0x140E +#define GL_INT64_VEC2_ARB 0x8FE9 +#define GL_INT64_VEC3_ARB 0x8FEA +#define GL_INT64_VEC4_ARB 0x8FEB +#define GL_UNSIGNED_INT64_VEC2_ARB 0x8FF5 +#define GL_UNSIGNED_INT64_VEC3_ARB 0x8FF6 +#define GL_UNSIGNED_INT64_VEC4_ARB 0x8FF7 +typedef void (APIENTRYP PFNGLUNIFORM1I64ARBPROC) (GLint location, GLint64 x); +typedef void (APIENTRYP PFNGLUNIFORM2I64ARBPROC) (GLint location, GLint64 x, GLint64 y); +typedef void (APIENTRYP PFNGLUNIFORM3I64ARBPROC) (GLint location, GLint64 x, GLint64 y, GLint64 z); +typedef void (APIENTRYP PFNGLUNIFORM4I64ARBPROC) (GLint location, GLint64 x, GLint64 y, GLint64 z, GLint64 w); +typedef void (APIENTRYP PFNGLUNIFORM1I64VARBPROC) (GLint location, GLsizei count, const GLint64 *value); +typedef void (APIENTRYP PFNGLUNIFORM2I64VARBPROC) (GLint location, GLsizei count, const GLint64 *value); +typedef void (APIENTRYP PFNGLUNIFORM3I64VARBPROC) (GLint location, GLsizei count, const GLint64 *value); +typedef void (APIENTRYP PFNGLUNIFORM4I64VARBPROC) (GLint location, GLsizei count, const GLint64 *value); +typedef void (APIENTRYP PFNGLUNIFORM1UI64ARBPROC) (GLint location, GLuint64 x); +typedef void (APIENTRYP PFNGLUNIFORM2UI64ARBPROC) (GLint location, GLuint64 x, GLuint64 y); +typedef void (APIENTRYP PFNGLUNIFORM3UI64ARBPROC) (GLint location, GLuint64 x, GLuint64 y, GLuint64 z); +typedef void (APIENTRYP PFNGLUNIFORM4UI64ARBPROC) (GLint location, GLuint64 x, GLuint64 y, GLuint64 z, GLuint64 w); +typedef void (APIENTRYP PFNGLUNIFORM1UI64VARBPROC) (GLint location, GLsizei count, const GLuint64 *value); +typedef void (APIENTRYP PFNGLUNIFORM2UI64VARBPROC) (GLint location, GLsizei count, const GLuint64 *value); +typedef void (APIENTRYP PFNGLUNIFORM3UI64VARBPROC) (GLint location, GLsizei count, const GLuint64 *value); +typedef void (APIENTRYP PFNGLUNIFORM4UI64VARBPROC) (GLint location, GLsizei count, const GLuint64 *value); +typedef void (APIENTRYP PFNGLGETUNIFORMI64VARBPROC) (GLuint program, GLint location, GLint64 *params); +typedef void (APIENTRYP PFNGLGETUNIFORMUI64VARBPROC) (GLuint program, GLint location, GLuint64 *params); +typedef void (APIENTRYP PFNGLGETNUNIFORMI64VARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLint64 *params); +typedef void (APIENTRYP PFNGLGETNUNIFORMUI64VARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLuint64 *params); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1I64ARBPROC) (GLuint program, GLint location, GLint64 x); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2I64ARBPROC) (GLuint program, GLint location, GLint64 x, GLint64 y); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3I64ARBPROC) (GLuint program, GLint location, GLint64 x, GLint64 y, GLint64 z); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4I64ARBPROC) (GLuint program, GLint location, GLint64 x, GLint64 y, GLint64 z, GLint64 w); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1I64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLint64 *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2I64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLint64 *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3I64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLint64 *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4I64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLint64 *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UI64ARBPROC) (GLuint program, GLint location, GLuint64 x); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UI64ARBPROC) (GLuint program, GLint location, GLuint64 x, GLuint64 y); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UI64ARBPROC) (GLuint program, GLint location, GLuint64 x, GLuint64 y, GLuint64 z); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UI64ARBPROC) (GLuint program, GLint location, GLuint64 x, GLuint64 y, GLuint64 z, GLuint64 w); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64 *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64 *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64 *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64 *value); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glUniform1i64ARB (GLint location, GLint64 x); +GLAPI void APIENTRY glUniform2i64ARB (GLint location, GLint64 x, GLint64 y); +GLAPI void APIENTRY glUniform3i64ARB (GLint location, GLint64 x, GLint64 y, GLint64 z); +GLAPI void APIENTRY glUniform4i64ARB (GLint location, GLint64 x, GLint64 y, GLint64 z, GLint64 w); +GLAPI void APIENTRY glUniform1i64vARB (GLint location, GLsizei count, const GLint64 *value); +GLAPI void APIENTRY glUniform2i64vARB (GLint location, GLsizei count, const GLint64 *value); +GLAPI void APIENTRY glUniform3i64vARB (GLint location, GLsizei count, const GLint64 *value); +GLAPI void APIENTRY glUniform4i64vARB (GLint location, GLsizei count, const GLint64 *value); +GLAPI void APIENTRY glUniform1ui64ARB (GLint location, GLuint64 x); +GLAPI void APIENTRY glUniform2ui64ARB (GLint location, GLuint64 x, GLuint64 y); +GLAPI void APIENTRY glUniform3ui64ARB (GLint location, GLuint64 x, GLuint64 y, GLuint64 z); +GLAPI void APIENTRY glUniform4ui64ARB (GLint location, GLuint64 x, GLuint64 y, GLuint64 z, GLuint64 w); +GLAPI void APIENTRY glUniform1ui64vARB (GLint location, GLsizei count, const GLuint64 *value); +GLAPI void APIENTRY glUniform2ui64vARB (GLint location, GLsizei count, const GLuint64 *value); +GLAPI void APIENTRY glUniform3ui64vARB (GLint location, GLsizei count, const GLuint64 *value); +GLAPI void APIENTRY glUniform4ui64vARB (GLint location, GLsizei count, const GLuint64 *value); +GLAPI void APIENTRY glGetUniformi64vARB (GLuint program, GLint location, GLint64 *params); +GLAPI void APIENTRY glGetUniformui64vARB (GLuint program, GLint location, GLuint64 *params); +GLAPI void APIENTRY glGetnUniformi64vARB (GLuint program, GLint location, GLsizei bufSize, GLint64 *params); +GLAPI void APIENTRY glGetnUniformui64vARB (GLuint program, GLint location, GLsizei bufSize, GLuint64 *params); +GLAPI void APIENTRY glProgramUniform1i64ARB (GLuint program, GLint location, GLint64 x); +GLAPI void APIENTRY glProgramUniform2i64ARB (GLuint program, GLint location, GLint64 x, GLint64 y); +GLAPI void APIENTRY glProgramUniform3i64ARB (GLuint program, GLint location, GLint64 x, GLint64 y, GLint64 z); +GLAPI void APIENTRY glProgramUniform4i64ARB (GLuint program, GLint location, GLint64 x, GLint64 y, GLint64 z, GLint64 w); +GLAPI void APIENTRY glProgramUniform1i64vARB (GLuint program, GLint location, GLsizei count, const GLint64 *value); +GLAPI void APIENTRY glProgramUniform2i64vARB (GLuint program, GLint location, GLsizei count, const GLint64 *value); +GLAPI void APIENTRY glProgramUniform3i64vARB (GLuint program, GLint location, GLsizei count, const GLint64 *value); +GLAPI void APIENTRY glProgramUniform4i64vARB (GLuint program, GLint location, GLsizei count, const GLint64 *value); +GLAPI void APIENTRY glProgramUniform1ui64ARB (GLuint program, GLint location, GLuint64 x); +GLAPI void APIENTRY glProgramUniform2ui64ARB (GLuint program, GLint location, GLuint64 x, GLuint64 y); +GLAPI void APIENTRY glProgramUniform3ui64ARB (GLuint program, GLint location, GLuint64 x, GLuint64 y, GLuint64 z); +GLAPI void APIENTRY glProgramUniform4ui64ARB (GLuint program, GLint location, GLuint64 x, GLuint64 y, GLuint64 z, GLuint64 w); +GLAPI void APIENTRY glProgramUniform1ui64vARB (GLuint program, GLint location, GLsizei count, const GLuint64 *value); +GLAPI void APIENTRY glProgramUniform2ui64vARB (GLuint program, GLint location, GLsizei count, const GLuint64 *value); +GLAPI void APIENTRY glProgramUniform3ui64vARB (GLuint program, GLint location, GLsizei count, const GLuint64 *value); +GLAPI void APIENTRY glProgramUniform4ui64vARB (GLuint program, GLint location, GLsizei count, const GLuint64 *value); +#endif +#endif /* GL_ARB_gpu_shader_int64 */ + #ifndef GL_ARB_half_float_pixel #define GL_ARB_half_float_pixel 1 typedef unsigned short GLhalfARB; @@ -3096,32 +3526,32 @@ typedef unsigned short GLhalfARB; #define GL_CONSTANT_BORDER 0x8151 #define GL_REPLICATE_BORDER 0x8153 #define GL_CONVOLUTION_BORDER_COLOR 0x8154 -typedef void (APIENTRYP PFNGLCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *table); +typedef void (APIENTRYP PFNGLCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const void *table); typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params); typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params); typedef void (APIENTRYP PFNGLCOPYCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); -typedef void (APIENTRYP PFNGLGETCOLORTABLEPROC) (GLenum target, GLenum format, GLenum type, GLvoid *table); +typedef void (APIENTRYP PFNGLGETCOLORTABLEPROC) (GLenum target, GLenum format, GLenum type, void *table); typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid *data); +typedef void (APIENTRYP PFNGLCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const void *data); typedef void (APIENTRYP PFNGLCOPYCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width); -typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *image); -typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *image); +typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const void *image); +typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *image); typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFPROC) (GLenum target, GLenum pname, GLfloat params); typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params); typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIPROC) (GLenum target, GLenum pname, GLint params); typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params); typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height); -typedef void (APIENTRYP PFNGLGETCONVOLUTIONFILTERPROC) (GLenum target, GLenum format, GLenum type, GLvoid *image); +typedef void (APIENTRYP PFNGLGETCONVOLUTIONFILTERPROC) (GLenum target, GLenum format, GLenum type, void *image); typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETSEPARABLEFILTERPROC) (GLenum target, GLenum format, GLenum type, GLvoid *row, GLvoid *column, GLvoid *span); -typedef void (APIENTRYP PFNGLSEPARABLEFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *row, const GLvoid *column); -typedef void (APIENTRYP PFNGLGETHISTOGRAMPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); +typedef void (APIENTRYP PFNGLGETSEPARABLEFILTERPROC) (GLenum target, GLenum format, GLenum type, void *row, void *column, void *span); +typedef void (APIENTRYP PFNGLSEPARABLEFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *row, const void *column); +typedef void (APIENTRYP PFNGLGETHISTOGRAMPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, void *values); typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETMINMAXPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); +typedef void (APIENTRYP PFNGLGETMINMAXPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, void *values); typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLHISTOGRAMPROC) (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink); @@ -3129,32 +3559,32 @@ typedef void (APIENTRYP PFNGLMINMAXPROC) (GLenum target, GLenum internalformat, typedef void (APIENTRYP PFNGLRESETHISTOGRAMPROC) (GLenum target); typedef void (APIENTRYP PFNGLRESETMINMAXPROC) (GLenum target); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glColorTable (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *table); +GLAPI void APIENTRY glColorTable (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const void *table); GLAPI void APIENTRY glColorTableParameterfv (GLenum target, GLenum pname, const GLfloat *params); GLAPI void APIENTRY glColorTableParameteriv (GLenum target, GLenum pname, const GLint *params); GLAPI void APIENTRY glCopyColorTable (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); -GLAPI void APIENTRY glGetColorTable (GLenum target, GLenum format, GLenum type, GLvoid *table); +GLAPI void APIENTRY glGetColorTable (GLenum target, GLenum format, GLenum type, void *table); GLAPI void APIENTRY glGetColorTableParameterfv (GLenum target, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetColorTableParameteriv (GLenum target, GLenum pname, GLint *params); -GLAPI void APIENTRY glColorSubTable (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid *data); +GLAPI void APIENTRY glColorSubTable (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const void *data); GLAPI void APIENTRY glCopyColorSubTable (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width); -GLAPI void APIENTRY glConvolutionFilter1D (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *image); -GLAPI void APIENTRY glConvolutionFilter2D (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *image); +GLAPI void APIENTRY glConvolutionFilter1D (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const void *image); +GLAPI void APIENTRY glConvolutionFilter2D (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *image); GLAPI void APIENTRY glConvolutionParameterf (GLenum target, GLenum pname, GLfloat params); GLAPI void APIENTRY glConvolutionParameterfv (GLenum target, GLenum pname, const GLfloat *params); GLAPI void APIENTRY glConvolutionParameteri (GLenum target, GLenum pname, GLint params); GLAPI void APIENTRY glConvolutionParameteriv (GLenum target, GLenum pname, const GLint *params); GLAPI void APIENTRY glCopyConvolutionFilter1D (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); GLAPI void APIENTRY glCopyConvolutionFilter2D (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height); -GLAPI void APIENTRY glGetConvolutionFilter (GLenum target, GLenum format, GLenum type, GLvoid *image); +GLAPI void APIENTRY glGetConvolutionFilter (GLenum target, GLenum format, GLenum type, void *image); GLAPI void APIENTRY glGetConvolutionParameterfv (GLenum target, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetConvolutionParameteriv (GLenum target, GLenum pname, GLint *params); -GLAPI void APIENTRY glGetSeparableFilter (GLenum target, GLenum format, GLenum type, GLvoid *row, GLvoid *column, GLvoid *span); -GLAPI void APIENTRY glSeparableFilter2D (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *row, const GLvoid *column); -GLAPI void APIENTRY glGetHistogram (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); +GLAPI void APIENTRY glGetSeparableFilter (GLenum target, GLenum format, GLenum type, void *row, void *column, void *span); +GLAPI void APIENTRY glSeparableFilter2D (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *row, const void *column); +GLAPI void APIENTRY glGetHistogram (GLenum target, GLboolean reset, GLenum format, GLenum type, void *values); GLAPI void APIENTRY glGetHistogramParameterfv (GLenum target, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetHistogramParameteriv (GLenum target, GLenum pname, GLint *params); -GLAPI void APIENTRY glGetMinmax (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); +GLAPI void APIENTRY glGetMinmax (GLenum target, GLboolean reset, GLenum format, GLenum type, void *values); GLAPI void APIENTRY glGetMinmaxParameterfv (GLenum target, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetMinmaxParameteriv (GLenum target, GLenum pname, GLint *params); GLAPI void APIENTRY glHistogram (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink); @@ -3187,10 +3617,6 @@ GLAPI void APIENTRY glVertexAttribDivisorARB (GLuint index, GLuint divisor); #ifndef GL_ARB_internalformat_query #define GL_ARB_internalformat_query 1 -typedef void (APIENTRYP PFNGLGETINTERNALFORMATIVPROC) (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint *params); -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glGetInternalformativ (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint *params); -#endif #endif /* GL_ARB_internalformat_query */ #ifndef GL_ARB_internalformat_query2 @@ -3226,13 +3652,13 @@ typedef void (APIENTRYP PFNGLCURRENTPALETTEMATRIXARBPROC) (GLint index); typedef void (APIENTRYP PFNGLMATRIXINDEXUBVARBPROC) (GLint size, const GLubyte *indices); typedef void (APIENTRYP PFNGLMATRIXINDEXUSVARBPROC) (GLint size, const GLushort *indices); typedef void (APIENTRYP PFNGLMATRIXINDEXUIVARBPROC) (GLint size, const GLuint *indices); -typedef void (APIENTRYP PFNGLMATRIXINDEXPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLMATRIXINDEXPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, const void *pointer); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glCurrentPaletteMatrixARB (GLint index); GLAPI void APIENTRY glMatrixIndexubvARB (GLint size, const GLubyte *indices); GLAPI void APIENTRY glMatrixIndexusvARB (GLint size, const GLushort *indices); GLAPI void APIENTRY glMatrixIndexuivARB (GLint size, const GLuint *indices); -GLAPI void APIENTRY glMatrixIndexPointerARB (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glMatrixIndexPointerARB (GLint size, GLenum type, GLsizei stride, const void *pointer); #endif #endif /* GL_ARB_matrix_palette */ @@ -3401,6 +3827,30 @@ GLAPI void APIENTRY glGetQueryObjectuivARB (GLuint id, GLenum pname, GLuint *par #define GL_ARB_occlusion_query2 1 #endif /* GL_ARB_occlusion_query2 */ +#ifndef GL_ARB_parallel_shader_compile +#define GL_ARB_parallel_shader_compile 1 +#define GL_MAX_SHADER_COMPILER_THREADS_ARB 0x91B0 +#define GL_COMPLETION_STATUS_ARB 0x91B1 +typedef void (APIENTRYP PFNGLMAXSHADERCOMPILERTHREADSARBPROC) (GLuint count); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMaxShaderCompilerThreadsARB (GLuint count); +#endif +#endif /* GL_ARB_parallel_shader_compile */ + +#ifndef GL_ARB_pipeline_statistics_query +#define GL_ARB_pipeline_statistics_query 1 +#define GL_VERTICES_SUBMITTED_ARB 0x82EE +#define GL_PRIMITIVES_SUBMITTED_ARB 0x82EF +#define GL_VERTEX_SHADER_INVOCATIONS_ARB 0x82F0 +#define GL_TESS_CONTROL_SHADER_PATCHES_ARB 0x82F1 +#define GL_TESS_EVALUATION_SHADER_INVOCATIONS_ARB 0x82F2 +#define GL_GEOMETRY_SHADER_PRIMITIVES_EMITTED_ARB 0x82F3 +#define GL_FRAGMENT_SHADER_INVOCATIONS_ARB 0x82F4 +#define GL_COMPUTE_SHADER_INVOCATIONS_ARB 0x82F5 +#define GL_CLIPPING_INPUT_PRIMITIVES_ARB 0x82F6 +#define GL_CLIPPING_OUTPUT_PRIMITIVES_ARB 0x82F7 +#endif /* GL_ARB_pipeline_statistics_query */ + #ifndef GL_ARB_pixel_buffer_object #define GL_ARB_pixel_buffer_object 1 #define GL_PIXEL_PACK_BUFFER_ARB 0x88EB @@ -3429,6 +3879,10 @@ GLAPI void APIENTRY glPointParameterfvARB (GLenum pname, const GLfloat *params); #define GL_COORD_REPLACE_ARB 0x8862 #endif /* GL_ARB_point_sprite */ +#ifndef GL_ARB_post_depth_coverage +#define GL_ARB_post_depth_coverage 1 +#endif /* GL_ARB_post_depth_coverage */ + #ifndef GL_ARB_program_interface_query #define GL_ARB_program_interface_query 1 #endif /* GL_ARB_program_interface_query */ @@ -3455,9 +3909,9 @@ GLAPI void APIENTRY glPointParameterfvARB (GLenum pname, const GLfloat *params); #define GL_RESET_NOTIFICATION_STRATEGY_ARB 0x8256 #define GL_NO_RESET_NOTIFICATION_ARB 0x8261 typedef GLenum (APIENTRYP PFNGLGETGRAPHICSRESETSTATUSARBPROC) (void); -typedef void (APIENTRYP PFNGLGETNTEXIMAGEARBPROC) (GLenum target, GLint level, GLenum format, GLenum type, GLsizei bufSize, GLvoid *img); -typedef void (APIENTRYP PFNGLREADNPIXELSARBPROC) (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, GLvoid *data); -typedef void (APIENTRYP PFNGLGETNCOMPRESSEDTEXIMAGEARBPROC) (GLenum target, GLint lod, GLsizei bufSize, GLvoid *img); +typedef void (APIENTRYP PFNGLGETNTEXIMAGEARBPROC) (GLenum target, GLint level, GLenum format, GLenum type, GLsizei bufSize, void *img); +typedef void (APIENTRYP PFNGLREADNPIXELSARBPROC) (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, void *data); +typedef void (APIENTRYP PFNGLGETNCOMPRESSEDTEXIMAGEARBPROC) (GLenum target, GLint lod, GLsizei bufSize, void *img); typedef void (APIENTRYP PFNGLGETNUNIFORMFVARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLfloat *params); typedef void (APIENTRYP PFNGLGETNUNIFORMIVARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLint *params); typedef void (APIENTRYP PFNGLGETNUNIFORMUIVARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLuint *params); @@ -3469,16 +3923,16 @@ typedef void (APIENTRYP PFNGLGETNPIXELMAPFVARBPROC) (GLenum map, GLsizei bufSize typedef void (APIENTRYP PFNGLGETNPIXELMAPUIVARBPROC) (GLenum map, GLsizei bufSize, GLuint *values); typedef void (APIENTRYP PFNGLGETNPIXELMAPUSVARBPROC) (GLenum map, GLsizei bufSize, GLushort *values); typedef void (APIENTRYP PFNGLGETNPOLYGONSTIPPLEARBPROC) (GLsizei bufSize, GLubyte *pattern); -typedef void (APIENTRYP PFNGLGETNCOLORTABLEARBPROC) (GLenum target, GLenum format, GLenum type, GLsizei bufSize, GLvoid *table); -typedef void (APIENTRYP PFNGLGETNCONVOLUTIONFILTERARBPROC) (GLenum target, GLenum format, GLenum type, GLsizei bufSize, GLvoid *image); -typedef void (APIENTRYP PFNGLGETNSEPARABLEFILTERARBPROC) (GLenum target, GLenum format, GLenum type, GLsizei rowBufSize, GLvoid *row, GLsizei columnBufSize, GLvoid *column, GLvoid *span); -typedef void (APIENTRYP PFNGLGETNHISTOGRAMARBPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, GLvoid *values); -typedef void (APIENTRYP PFNGLGETNMINMAXARBPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, GLvoid *values); +typedef void (APIENTRYP PFNGLGETNCOLORTABLEARBPROC) (GLenum target, GLenum format, GLenum type, GLsizei bufSize, void *table); +typedef void (APIENTRYP PFNGLGETNCONVOLUTIONFILTERARBPROC) (GLenum target, GLenum format, GLenum type, GLsizei bufSize, void *image); +typedef void (APIENTRYP PFNGLGETNSEPARABLEFILTERARBPROC) (GLenum target, GLenum format, GLenum type, GLsizei rowBufSize, void *row, GLsizei columnBufSize, void *column, void *span); +typedef void (APIENTRYP PFNGLGETNHISTOGRAMARBPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, void *values); +typedef void (APIENTRYP PFNGLGETNMINMAXARBPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, void *values); #ifdef GL_GLEXT_PROTOTYPES GLAPI GLenum APIENTRY glGetGraphicsResetStatusARB (void); -GLAPI void APIENTRY glGetnTexImageARB (GLenum target, GLint level, GLenum format, GLenum type, GLsizei bufSize, GLvoid *img); -GLAPI void APIENTRY glReadnPixelsARB (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, GLvoid *data); -GLAPI void APIENTRY glGetnCompressedTexImageARB (GLenum target, GLint lod, GLsizei bufSize, GLvoid *img); +GLAPI void APIENTRY glGetnTexImageARB (GLenum target, GLint level, GLenum format, GLenum type, GLsizei bufSize, void *img); +GLAPI void APIENTRY glReadnPixelsARB (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, void *data); +GLAPI void APIENTRY glGetnCompressedTexImageARB (GLenum target, GLint lod, GLsizei bufSize, void *img); GLAPI void APIENTRY glGetnUniformfvARB (GLuint program, GLint location, GLsizei bufSize, GLfloat *params); GLAPI void APIENTRY glGetnUniformivARB (GLuint program, GLint location, GLsizei bufSize, GLint *params); GLAPI void APIENTRY glGetnUniformuivARB (GLuint program, GLint location, GLsizei bufSize, GLuint *params); @@ -3490,11 +3944,11 @@ GLAPI void APIENTRY glGetnPixelMapfvARB (GLenum map, GLsizei bufSize, GLfloat *v GLAPI void APIENTRY glGetnPixelMapuivARB (GLenum map, GLsizei bufSize, GLuint *values); GLAPI void APIENTRY glGetnPixelMapusvARB (GLenum map, GLsizei bufSize, GLushort *values); GLAPI void APIENTRY glGetnPolygonStippleARB (GLsizei bufSize, GLubyte *pattern); -GLAPI void APIENTRY glGetnColorTableARB (GLenum target, GLenum format, GLenum type, GLsizei bufSize, GLvoid *table); -GLAPI void APIENTRY glGetnConvolutionFilterARB (GLenum target, GLenum format, GLenum type, GLsizei bufSize, GLvoid *image); -GLAPI void APIENTRY glGetnSeparableFilterARB (GLenum target, GLenum format, GLenum type, GLsizei rowBufSize, GLvoid *row, GLsizei columnBufSize, GLvoid *column, GLvoid *span); -GLAPI void APIENTRY glGetnHistogramARB (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, GLvoid *values); -GLAPI void APIENTRY glGetnMinmaxARB (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, GLvoid *values); +GLAPI void APIENTRY glGetnColorTableARB (GLenum target, GLenum format, GLenum type, GLsizei bufSize, void *table); +GLAPI void APIENTRY glGetnConvolutionFilterARB (GLenum target, GLenum format, GLenum type, GLsizei bufSize, void *image); +GLAPI void APIENTRY glGetnSeparableFilterARB (GLenum target, GLenum format, GLenum type, GLsizei rowBufSize, void *row, GLsizei columnBufSize, void *column, void *span); +GLAPI void APIENTRY glGetnHistogramARB (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, void *values); +GLAPI void APIENTRY glGetnMinmaxARB (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, void *values); #endif #endif /* GL_ARB_robustness */ @@ -3502,6 +3956,26 @@ GLAPI void APIENTRY glGetnMinmaxARB (GLenum target, GLboolean reset, GLenum form #define GL_ARB_robustness_isolation 1 #endif /* GL_ARB_robustness_isolation */ +#ifndef GL_ARB_sample_locations +#define GL_ARB_sample_locations 1 +#define GL_SAMPLE_LOCATION_SUBPIXEL_BITS_ARB 0x933D +#define GL_SAMPLE_LOCATION_PIXEL_GRID_WIDTH_ARB 0x933E +#define GL_SAMPLE_LOCATION_PIXEL_GRID_HEIGHT_ARB 0x933F +#define GL_PROGRAMMABLE_SAMPLE_LOCATION_TABLE_SIZE_ARB 0x9340 +#define GL_SAMPLE_LOCATION_ARB 0x8E50 +#define GL_PROGRAMMABLE_SAMPLE_LOCATION_ARB 0x9341 +#define GL_FRAMEBUFFER_PROGRAMMABLE_SAMPLE_LOCATIONS_ARB 0x9342 +#define GL_FRAMEBUFFER_SAMPLE_LOCATION_PIXEL_GRID_ARB 0x9343 +typedef void (APIENTRYP PFNGLFRAMEBUFFERSAMPLELOCATIONSFVARBPROC) (GLenum target, GLuint start, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERSAMPLELOCATIONSFVARBPROC) (GLuint framebuffer, GLuint start, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLEVALUATEDEPTHVALUESARBPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFramebufferSampleLocationsfvARB (GLenum target, GLuint start, GLsizei count, const GLfloat *v); +GLAPI void APIENTRY glNamedFramebufferSampleLocationsfvARB (GLuint framebuffer, GLuint start, GLsizei count, const GLfloat *v); +GLAPI void APIENTRY glEvaluateDepthValuesARB (void); +#endif +#endif /* GL_ARB_sample_locations */ + #ifndef GL_ARB_sample_shading #define GL_ARB_sample_shading 1 #define GL_SAMPLE_SHADING_ARB 0x8C36 @@ -3528,14 +4002,26 @@ GLAPI void APIENTRY glMinSampleShadingARB (GLfloat value); #define GL_ARB_separate_shader_objects 1 #endif /* GL_ARB_separate_shader_objects */ +#ifndef GL_ARB_shader_atomic_counter_ops +#define GL_ARB_shader_atomic_counter_ops 1 +#endif /* GL_ARB_shader_atomic_counter_ops */ + #ifndef GL_ARB_shader_atomic_counters #define GL_ARB_shader_atomic_counters 1 #endif /* GL_ARB_shader_atomic_counters */ +#ifndef GL_ARB_shader_ballot +#define GL_ARB_shader_ballot 1 +#endif /* GL_ARB_shader_ballot */ + #ifndef GL_ARB_shader_bit_encoding #define GL_ARB_shader_bit_encoding 1 #endif /* GL_ARB_shader_bit_encoding */ +#ifndef GL_ARB_shader_clock +#define GL_ARB_shader_clock 1 +#endif /* GL_ARB_shader_clock */ + #ifndef GL_ARB_shader_draw_parameters #define GL_ARB_shader_draw_parameters 1 #endif /* GL_ARB_shader_draw_parameters */ @@ -3692,10 +4178,18 @@ GLAPI void APIENTRY glGetShaderSourceARB (GLhandleARB obj, GLsizei maxLength, GL #define GL_ARB_shader_subroutine 1 #endif /* GL_ARB_shader_subroutine */ +#ifndef GL_ARB_shader_texture_image_samples +#define GL_ARB_shader_texture_image_samples 1 +#endif /* GL_ARB_shader_texture_image_samples */ + #ifndef GL_ARB_shader_texture_lod #define GL_ARB_shader_texture_lod 1 #endif /* GL_ARB_shader_texture_lod */ +#ifndef GL_ARB_shader_viewport_layer_array +#define GL_ARB_shader_viewport_layer_array 1 +#endif /* GL_ARB_shader_viewport_layer_array */ + #ifndef GL_ARB_shading_language_100 #define GL_ARB_shading_language_100 1 #define GL_SHADING_LANGUAGE_VERSION_ARB 0x8B8C @@ -3742,11 +4236,25 @@ GLAPI void APIENTRY glGetNamedStringivARB (GLint namelen, const GLchar *name, GL #define GL_TEXTURE_COMPARE_FAIL_VALUE_ARB 0x80BF #endif /* GL_ARB_shadow_ambient */ +#ifndef GL_ARB_sparse_buffer +#define GL_ARB_sparse_buffer 1 +#define GL_SPARSE_STORAGE_BIT_ARB 0x0400 +#define GL_SPARSE_BUFFER_PAGE_SIZE_ARB 0x82F8 +typedef void (APIENTRYP PFNGLBUFFERPAGECOMMITMENTARBPROC) (GLenum target, GLintptr offset, GLsizeiptr size, GLboolean commit); +typedef void (APIENTRYP PFNGLNAMEDBUFFERPAGECOMMITMENTEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, GLboolean commit); +typedef void (APIENTRYP PFNGLNAMEDBUFFERPAGECOMMITMENTARBPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, GLboolean commit); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBufferPageCommitmentARB (GLenum target, GLintptr offset, GLsizeiptr size, GLboolean commit); +GLAPI void APIENTRY glNamedBufferPageCommitmentEXT (GLuint buffer, GLintptr offset, GLsizeiptr size, GLboolean commit); +GLAPI void APIENTRY glNamedBufferPageCommitmentARB (GLuint buffer, GLintptr offset, GLsizeiptr size, GLboolean commit); +#endif +#endif /* GL_ARB_sparse_buffer */ + #ifndef GL_ARB_sparse_texture #define GL_ARB_sparse_texture 1 #define GL_TEXTURE_SPARSE_ARB 0x91A6 #define GL_VIRTUAL_PAGE_SIZE_INDEX_ARB 0x91A7 -#define GL_MIN_SPARSE_LEVEL_ARB 0x919B +#define GL_NUM_SPARSE_LEVELS_ARB 0x91AA #define GL_NUM_VIRTUAL_PAGE_SIZES_ARB 0x91A8 #define GL_VIRTUAL_PAGE_SIZE_X_ARB 0x9195 #define GL_VIRTUAL_PAGE_SIZE_Y_ARB 0x9196 @@ -3755,12 +4263,20 @@ GLAPI void APIENTRY glGetNamedStringivARB (GLint namelen, const GLchar *name, GL #define GL_MAX_SPARSE_3D_TEXTURE_SIZE_ARB 0x9199 #define GL_MAX_SPARSE_ARRAY_TEXTURE_LAYERS_ARB 0x919A #define GL_SPARSE_TEXTURE_FULL_ARRAY_CUBE_MIPMAPS_ARB 0x91A9 -typedef void (APIENTRYP PFNGLTEXPAGECOMMITMENTARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean resident); +typedef void (APIENTRYP PFNGLTEXPAGECOMMITMENTARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean commit); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glTexPageCommitmentARB (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean resident); +GLAPI void APIENTRY glTexPageCommitmentARB (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean commit); #endif #endif /* GL_ARB_sparse_texture */ +#ifndef GL_ARB_sparse_texture2 +#define GL_ARB_sparse_texture2 1 +#endif /* GL_ARB_sparse_texture2 */ + +#ifndef GL_ARB_sparse_texture_clamp +#define GL_ARB_sparse_texture_clamp 1 +#endif /* GL_ARB_sparse_texture_clamp */ + #ifndef GL_ARB_stencil_texturing #define GL_ARB_stencil_texturing 1 #endif /* GL_ARB_stencil_texturing */ @@ -3773,6 +4289,10 @@ GLAPI void APIENTRY glTexPageCommitmentARB (GLenum target, GLint level, GLint xo #define GL_ARB_tessellation_shader 1 #endif /* GL_ARB_tessellation_shader */ +#ifndef GL_ARB_texture_barrier +#define GL_ARB_texture_barrier 1 +#endif /* GL_ARB_texture_barrier */ + #ifndef GL_ARB_texture_border_clamp #define GL_ARB_texture_border_clamp 1 #define GL_CLAMP_TO_BORDER_ARB 0x812D @@ -3812,21 +4332,21 @@ GLAPI void APIENTRY glTexBufferARB (GLenum target, GLenum internalformat, GLuint #define GL_TEXTURE_COMPRESSED_ARB 0x86A1 #define GL_NUM_COMPRESSED_TEXTURE_FORMATS_ARB 0x86A2 #define GL_COMPRESSED_TEXTURE_FORMATS_ARB 0x86A3 -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE3DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE2DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE1DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE3DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE2DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE1DARBPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXIMAGEARBPROC) (GLenum target, GLint level, GLvoid *img); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE3DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE2DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE1DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE3DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE2DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE1DARBPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXIMAGEARBPROC) (GLenum target, GLint level, void *img); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glCompressedTexImage3DARB (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data); -GLAPI void APIENTRY glCompressedTexImage2DARB (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data); -GLAPI void APIENTRY glCompressedTexImage1DARB (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data); -GLAPI void APIENTRY glCompressedTexSubImage3DARB (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data); -GLAPI void APIENTRY glCompressedTexSubImage2DARB (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data); -GLAPI void APIENTRY glCompressedTexSubImage1DARB (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data); -GLAPI void APIENTRY glGetCompressedTexImageARB (GLenum target, GLint level, GLvoid *img); +GLAPI void APIENTRY glCompressedTexImage3DARB (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexImage2DARB (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexImage1DARB (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexSubImage3DARB (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexSubImage2DARB (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexSubImage1DARB (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glGetCompressedTexImageARB (GLenum target, GLint level, void *img); #endif #endif /* GL_ARB_texture_compression */ @@ -3909,6 +4429,12 @@ GLAPI void APIENTRY glGetCompressedTexImageARB (GLenum target, GLint level, GLvo #define GL_DOT3_RGBA_ARB 0x86AF #endif /* GL_ARB_texture_env_dot3 */ +#ifndef GL_ARB_texture_filter_minmax +#define GL_ARB_texture_filter_minmax 1 +#define GL_TEXTURE_REDUCTION_MODE_ARB 0x9366 +#define GL_WEIGHTED_AVERAGE_ARB 0x9367 +#endif /* GL_ARB_texture_filter_minmax */ + #ifndef GL_ARB_texture_float #define GL_ARB_texture_float 1 #define GL_TEXTURE_RED_TYPE_ARB 0x8C10 @@ -4007,8 +4533,6 @@ GLAPI void APIENTRY glGetCompressedTexImageARB (GLenum target, GLint level, GLvo #ifndef GL_ARB_transform_feedback2 #define GL_ARB_transform_feedback2 1 -#define GL_TRANSFORM_FEEDBACK_PAUSED 0x8E23 -#define GL_TRANSFORM_FEEDBACK_ACTIVE 0x8E24 #endif /* GL_ARB_transform_feedback2 */ #ifndef GL_ARB_transform_feedback3 @@ -4019,6 +4543,12 @@ GLAPI void APIENTRY glGetCompressedTexImageARB (GLenum target, GLint level, GLvo #define GL_ARB_transform_feedback_instanced 1 #endif /* GL_ARB_transform_feedback_instanced */ +#ifndef GL_ARB_transform_feedback_overflow_query +#define GL_ARB_transform_feedback_overflow_query 1 +#define GL_TRANSFORM_FEEDBACK_OVERFLOW_ARB 0x82EC +#define GL_TRANSFORM_FEEDBACK_STREAM_OVERFLOW_ARB 0x82ED +#endif /* GL_ARB_transform_feedback_overflow_query */ + #ifndef GL_ARB_transpose_matrix #define GL_ARB_transpose_matrix 1 #define GL_TRANSPOSE_MODELVIEW_MATRIX_ARB 0x84E3 @@ -4039,9 +4569,6 @@ GLAPI void APIENTRY glMultTransposeMatrixdARB (const GLdouble *m); #ifndef GL_ARB_uniform_buffer_object #define GL_ARB_uniform_buffer_object 1 -#define GL_MAX_GEOMETRY_UNIFORM_BLOCKS 0x8A2C -#define GL_MAX_COMBINED_GEOMETRY_UNIFORM_COMPONENTS 0x8A32 -#define GL_UNIFORM_BLOCK_REFERENCED_BY_GEOMETRY_SHADER 0x8A45 #endif /* GL_ARB_uniform_buffer_object */ #ifndef GL_ARB_vertex_array_bgra @@ -4112,7 +4639,7 @@ typedef void (APIENTRYP PFNGLWEIGHTDVARBPROC) (GLint size, const GLdouble *weigh typedef void (APIENTRYP PFNGLWEIGHTUBVARBPROC) (GLint size, const GLubyte *weights); typedef void (APIENTRYP PFNGLWEIGHTUSVARBPROC) (GLint size, const GLushort *weights); typedef void (APIENTRYP PFNGLWEIGHTUIVARBPROC) (GLint size, const GLuint *weights); -typedef void (APIENTRYP PFNGLWEIGHTPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLWEIGHTPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, const void *pointer); typedef void (APIENTRYP PFNGLVERTEXBLENDARBPROC) (GLint count); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glWeightbvARB (GLint size, const GLbyte *weights); @@ -4123,7 +4650,7 @@ GLAPI void APIENTRY glWeightdvARB (GLint size, const GLdouble *weights); GLAPI void APIENTRY glWeightubvARB (GLint size, const GLubyte *weights); GLAPI void APIENTRY glWeightusvARB (GLint size, const GLushort *weights); GLAPI void APIENTRY glWeightuivARB (GLint size, const GLuint *weights); -GLAPI void APIENTRY glWeightPointerARB (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glWeightPointerARB (GLint size, GLenum type, GLsizei stride, const void *pointer); GLAPI void APIENTRY glVertexBlendARB (GLint count); #endif #endif /* GL_ARB_vertex_blend */ @@ -4167,25 +4694,25 @@ typedef void (APIENTRYP PFNGLBINDBUFFERARBPROC) (GLenum target, GLuint buffer); typedef void (APIENTRYP PFNGLDELETEBUFFERSARBPROC) (GLsizei n, const GLuint *buffers); typedef void (APIENTRYP PFNGLGENBUFFERSARBPROC) (GLsizei n, GLuint *buffers); typedef GLboolean (APIENTRYP PFNGLISBUFFERARBPROC) (GLuint buffer); -typedef void (APIENTRYP PFNGLBUFFERDATAARBPROC) (GLenum target, GLsizeiptrARB size, const GLvoid *data, GLenum usage); -typedef void (APIENTRYP PFNGLBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, const GLvoid *data); -typedef void (APIENTRYP PFNGLGETBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, GLvoid *data); +typedef void (APIENTRYP PFNGLBUFFERDATAARBPROC) (GLenum target, GLsizeiptrARB size, const void *data, GLenum usage); +typedef void (APIENTRYP PFNGLBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, const void *data); +typedef void (APIENTRYP PFNGLGETBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, void *data); typedef void *(APIENTRYP PFNGLMAPBUFFERARBPROC) (GLenum target, GLenum access); typedef GLboolean (APIENTRYP PFNGLUNMAPBUFFERARBPROC) (GLenum target); typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERIVARBPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETBUFFERPOINTERVARBPROC) (GLenum target, GLenum pname, GLvoid **params); +typedef void (APIENTRYP PFNGLGETBUFFERPOINTERVARBPROC) (GLenum target, GLenum pname, void **params); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glBindBufferARB (GLenum target, GLuint buffer); GLAPI void APIENTRY glDeleteBuffersARB (GLsizei n, const GLuint *buffers); GLAPI void APIENTRY glGenBuffersARB (GLsizei n, GLuint *buffers); GLAPI GLboolean APIENTRY glIsBufferARB (GLuint buffer); -GLAPI void APIENTRY glBufferDataARB (GLenum target, GLsizeiptrARB size, const GLvoid *data, GLenum usage); -GLAPI void APIENTRY glBufferSubDataARB (GLenum target, GLintptrARB offset, GLsizeiptrARB size, const GLvoid *data); -GLAPI void APIENTRY glGetBufferSubDataARB (GLenum target, GLintptrARB offset, GLsizeiptrARB size, GLvoid *data); +GLAPI void APIENTRY glBufferDataARB (GLenum target, GLsizeiptrARB size, const void *data, GLenum usage); +GLAPI void APIENTRY glBufferSubDataARB (GLenum target, GLintptrARB offset, GLsizeiptrARB size, const void *data); +GLAPI void APIENTRY glGetBufferSubDataARB (GLenum target, GLintptrARB offset, GLsizeiptrARB size, void *data); GLAPI void *APIENTRY glMapBufferARB (GLenum target, GLenum access); GLAPI GLboolean APIENTRY glUnmapBufferARB (GLenum target); GLAPI void APIENTRY glGetBufferParameterivARB (GLenum target, GLenum pname, GLint *params); -GLAPI void APIENTRY glGetBufferPointervARB (GLenum target, GLenum pname, GLvoid **params); +GLAPI void APIENTRY glGetBufferPointervARB (GLenum target, GLenum pname, void **params); #endif #endif /* GL_ARB_vertex_buffer_object */ @@ -4243,13 +4770,13 @@ typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVARBPROC) (GLuint index, const GLshor typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVARBPROC) (GLuint index, const GLubyte *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4UIVARBPROC) (GLuint index, const GLuint *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4USVARBPROC) (GLuint index, const GLushort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERARBPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERARBPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const void *pointer); typedef void (APIENTRYP PFNGLENABLEVERTEXATTRIBARRAYARBPROC) (GLuint index); typedef void (APIENTRYP PFNGLDISABLEVERTEXATTRIBARRAYARBPROC) (GLuint index); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVARBPROC) (GLuint index, GLenum pname, GLdouble *params); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVARBPROC) (GLuint index, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVARBPROC) (GLuint index, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVARBPROC) (GLuint index, GLenum pname, GLvoid **pointer); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVARBPROC) (GLuint index, GLenum pname, void **pointer); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glVertexAttrib1dARB (GLuint index, GLdouble x); GLAPI void APIENTRY glVertexAttrib1dvARB (GLuint index, const GLdouble *v); @@ -4287,13 +4814,13 @@ GLAPI void APIENTRY glVertexAttrib4svARB (GLuint index, const GLshort *v); GLAPI void APIENTRY glVertexAttrib4ubvARB (GLuint index, const GLubyte *v); GLAPI void APIENTRY glVertexAttrib4uivARB (GLuint index, const GLuint *v); GLAPI void APIENTRY glVertexAttrib4usvARB (GLuint index, const GLushort *v); -GLAPI void APIENTRY glVertexAttribPointerARB (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glVertexAttribPointerARB (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const void *pointer); GLAPI void APIENTRY glEnableVertexAttribArrayARB (GLuint index); GLAPI void APIENTRY glDisableVertexAttribArrayARB (GLuint index); GLAPI void APIENTRY glGetVertexAttribdvARB (GLuint index, GLenum pname, GLdouble *params); GLAPI void APIENTRY glGetVertexAttribfvARB (GLuint index, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetVertexAttribivARB (GLuint index, GLenum pname, GLint *params); -GLAPI void APIENTRY glGetVertexAttribPointervARB (GLuint index, GLenum pname, GLvoid **pointer); +GLAPI void APIENTRY glGetVertexAttribPointervARB (GLuint index, GLenum pname, void **pointer); #endif #endif /* GL_ARB_vertex_program */ @@ -4366,12 +4893,58 @@ GLAPI void APIENTRY glWindowPos3svARB (const GLshort *v); #endif #endif /* GL_ARB_window_pos */ +#ifndef GL_KHR_blend_equation_advanced +#define GL_KHR_blend_equation_advanced 1 +#define GL_MULTIPLY_KHR 0x9294 +#define GL_SCREEN_KHR 0x9295 +#define GL_OVERLAY_KHR 0x9296 +#define GL_DARKEN_KHR 0x9297 +#define GL_LIGHTEN_KHR 0x9298 +#define GL_COLORDODGE_KHR 0x9299 +#define GL_COLORBURN_KHR 0x929A +#define GL_HARDLIGHT_KHR 0x929B +#define GL_SOFTLIGHT_KHR 0x929C +#define GL_DIFFERENCE_KHR 0x929E +#define GL_EXCLUSION_KHR 0x92A0 +#define GL_HSL_HUE_KHR 0x92AD +#define GL_HSL_SATURATION_KHR 0x92AE +#define GL_HSL_COLOR_KHR 0x92AF +#define GL_HSL_LUMINOSITY_KHR 0x92B0 +typedef void (APIENTRYP PFNGLBLENDBARRIERKHRPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendBarrierKHR (void); +#endif +#endif /* GL_KHR_blend_equation_advanced */ + +#ifndef GL_KHR_blend_equation_advanced_coherent +#define GL_KHR_blend_equation_advanced_coherent 1 +#define GL_BLEND_ADVANCED_COHERENT_KHR 0x9285 +#endif /* GL_KHR_blend_equation_advanced_coherent */ + +#ifndef GL_KHR_context_flush_control +#define GL_KHR_context_flush_control 1 +#endif /* GL_KHR_context_flush_control */ + #ifndef GL_KHR_debug #define GL_KHR_debug 1 #endif /* GL_KHR_debug */ -#ifndef GL_KHR_texture_compression_astc_ldr -#define GL_KHR_texture_compression_astc_ldr 1 +#ifndef GL_KHR_no_error +#define GL_KHR_no_error 1 +#define GL_CONTEXT_FLAG_NO_ERROR_BIT_KHR 0x00000008 +#endif /* GL_KHR_no_error */ + +#ifndef GL_KHR_robust_buffer_access_behavior +#define GL_KHR_robust_buffer_access_behavior 1 +#endif /* GL_KHR_robust_buffer_access_behavior */ + +#ifndef GL_KHR_robustness +#define GL_KHR_robustness 1 +#define GL_CONTEXT_ROBUST_ACCESS 0x90F3 +#endif /* GL_KHR_robustness */ + +#ifndef GL_KHR_texture_compression_astc_hdr +#define GL_KHR_texture_compression_astc_hdr 1 #define GL_COMPRESSED_RGBA_ASTC_4x4_KHR 0x93B0 #define GL_COMPRESSED_RGBA_ASTC_5x4_KHR 0x93B1 #define GL_COMPRESSED_RGBA_ASTC_5x5_KHR 0x93B2 @@ -4400,6 +4973,10 @@ GLAPI void APIENTRY glWindowPos3svARB (const GLshort *v); #define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_10x10_KHR 0x93DB #define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_12x10_KHR 0x93DC #define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_12x12_KHR 0x93DD +#endif /* GL_KHR_texture_compression_astc_hdr */ + +#ifndef GL_KHR_texture_compression_astc_ldr +#define GL_KHR_texture_compression_astc_ldr 1 #endif /* GL_KHR_texture_compression_astc_ldr */ #ifndef GL_OES_byte_coordinates @@ -4420,11 +4997,11 @@ typedef void (APIENTRYP PFNGLTEXCOORD3BOESPROC) (GLbyte s, GLbyte t, GLbyte r); typedef void (APIENTRYP PFNGLTEXCOORD3BVOESPROC) (const GLbyte *coords); typedef void (APIENTRYP PFNGLTEXCOORD4BOESPROC) (GLbyte s, GLbyte t, GLbyte r, GLbyte q); typedef void (APIENTRYP PFNGLTEXCOORD4BVOESPROC) (const GLbyte *coords); -typedef void (APIENTRYP PFNGLVERTEX2BOESPROC) (GLbyte x); +typedef void (APIENTRYP PFNGLVERTEX2BOESPROC) (GLbyte x, GLbyte y); typedef void (APIENTRYP PFNGLVERTEX2BVOESPROC) (const GLbyte *coords); -typedef void (APIENTRYP PFNGLVERTEX3BOESPROC) (GLbyte x, GLbyte y); +typedef void (APIENTRYP PFNGLVERTEX3BOESPROC) (GLbyte x, GLbyte y, GLbyte z); typedef void (APIENTRYP PFNGLVERTEX3BVOESPROC) (const GLbyte *coords); -typedef void (APIENTRYP PFNGLVERTEX4BOESPROC) (GLbyte x, GLbyte y, GLbyte z); +typedef void (APIENTRYP PFNGLVERTEX4BOESPROC) (GLbyte x, GLbyte y, GLbyte z, GLbyte w); typedef void (APIENTRYP PFNGLVERTEX4BVOESPROC) (const GLbyte *coords); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glMultiTexCoord1bOES (GLenum texture, GLbyte s); @@ -4443,11 +5020,11 @@ GLAPI void APIENTRY glTexCoord3bOES (GLbyte s, GLbyte t, GLbyte r); GLAPI void APIENTRY glTexCoord3bvOES (const GLbyte *coords); GLAPI void APIENTRY glTexCoord4bOES (GLbyte s, GLbyte t, GLbyte r, GLbyte q); GLAPI void APIENTRY glTexCoord4bvOES (const GLbyte *coords); -GLAPI void APIENTRY glVertex2bOES (GLbyte x); +GLAPI void APIENTRY glVertex2bOES (GLbyte x, GLbyte y); GLAPI void APIENTRY glVertex2bvOES (const GLbyte *coords); -GLAPI void APIENTRY glVertex3bOES (GLbyte x, GLbyte y); +GLAPI void APIENTRY glVertex3bOES (GLbyte x, GLbyte y, GLbyte z); GLAPI void APIENTRY glVertex3bvOES (const GLbyte *coords); -GLAPI void APIENTRY glVertex4bOES (GLbyte x, GLbyte y, GLbyte z); +GLAPI void APIENTRY glVertex4bOES (GLbyte x, GLbyte y, GLbyte z, GLbyte w); GLAPI void APIENTRY glVertex4bvOES (const GLbyte *coords); #endif #endif /* GL_OES_byte_coordinates */ @@ -4499,7 +5076,6 @@ typedef void (APIENTRYP PFNGLPOINTPARAMETERXVOESPROC) (GLenum pname, const GLfix typedef void (APIENTRYP PFNGLPOINTSIZEXOESPROC) (GLfixed size); typedef void (APIENTRYP PFNGLPOLYGONOFFSETXOESPROC) (GLfixed factor, GLfixed units); typedef void (APIENTRYP PFNGLROTATEXOESPROC) (GLfixed angle, GLfixed x, GLfixed y, GLfixed z); -typedef void (APIENTRYP PFNGLSAMPLECOVERAGEOESPROC) (GLfixed value, GLboolean invert); typedef void (APIENTRYP PFNGLSCALEXOESPROC) (GLfixed x, GLfixed y, GLfixed z); typedef void (APIENTRYP PFNGLTEXENVXOESPROC) (GLenum target, GLenum pname, GLfixed param); typedef void (APIENTRYP PFNGLTEXENVXVOESPROC) (GLenum target, GLenum pname, const GLfixed *params); @@ -4604,7 +5180,6 @@ GLAPI void APIENTRY glPointParameterxvOES (GLenum pname, const GLfixed *params); GLAPI void APIENTRY glPointSizexOES (GLfixed size); GLAPI void APIENTRY glPolygonOffsetxOES (GLfixed factor, GLfixed units); GLAPI void APIENTRY glRotatexOES (GLfixed angle, GLfixed x, GLfixed y, GLfixed z); -GLAPI void APIENTRY glSampleCoverageOES (GLfixed value, GLboolean invert); GLAPI void APIENTRY glScalexOES (GLfixed x, GLfixed y, GLfixed z); GLAPI void APIENTRY glTexEnvxOES (GLenum target, GLenum pname, GLfixed param); GLAPI void APIENTRY glTexEnvxvOES (GLenum target, GLenum pname, const GLfixed *params); @@ -4795,6 +5370,113 @@ GLAPI void APIENTRY glBlendEquationSeparateIndexedAMD (GLuint buf, GLenum modeRG #endif #endif /* GL_AMD_draw_buffers_blend */ +#ifndef GL_AMD_gcn_shader +#define GL_AMD_gcn_shader 1 +#endif /* GL_AMD_gcn_shader */ + +#ifndef GL_AMD_gpu_shader_int64 +#define GL_AMD_gpu_shader_int64 1 +typedef int64_t GLint64EXT; +#define GL_INT64_NV 0x140E +#define GL_UNSIGNED_INT64_NV 0x140F +#define GL_INT8_NV 0x8FE0 +#define GL_INT8_VEC2_NV 0x8FE1 +#define GL_INT8_VEC3_NV 0x8FE2 +#define GL_INT8_VEC4_NV 0x8FE3 +#define GL_INT16_NV 0x8FE4 +#define GL_INT16_VEC2_NV 0x8FE5 +#define GL_INT16_VEC3_NV 0x8FE6 +#define GL_INT16_VEC4_NV 0x8FE7 +#define GL_INT64_VEC2_NV 0x8FE9 +#define GL_INT64_VEC3_NV 0x8FEA +#define GL_INT64_VEC4_NV 0x8FEB +#define GL_UNSIGNED_INT8_NV 0x8FEC +#define GL_UNSIGNED_INT8_VEC2_NV 0x8FED +#define GL_UNSIGNED_INT8_VEC3_NV 0x8FEE +#define GL_UNSIGNED_INT8_VEC4_NV 0x8FEF +#define GL_UNSIGNED_INT16_NV 0x8FF0 +#define GL_UNSIGNED_INT16_VEC2_NV 0x8FF1 +#define GL_UNSIGNED_INT16_VEC3_NV 0x8FF2 +#define GL_UNSIGNED_INT16_VEC4_NV 0x8FF3 +#define GL_UNSIGNED_INT64_VEC2_NV 0x8FF5 +#define GL_UNSIGNED_INT64_VEC3_NV 0x8FF6 +#define GL_UNSIGNED_INT64_VEC4_NV 0x8FF7 +#define GL_FLOAT16_NV 0x8FF8 +#define GL_FLOAT16_VEC2_NV 0x8FF9 +#define GL_FLOAT16_VEC3_NV 0x8FFA +#define GL_FLOAT16_VEC4_NV 0x8FFB +typedef void (APIENTRYP PFNGLUNIFORM1I64NVPROC) (GLint location, GLint64EXT x); +typedef void (APIENTRYP PFNGLUNIFORM2I64NVPROC) (GLint location, GLint64EXT x, GLint64EXT y); +typedef void (APIENTRYP PFNGLUNIFORM3I64NVPROC) (GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z); +typedef void (APIENTRYP PFNGLUNIFORM4I64NVPROC) (GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z, GLint64EXT w); +typedef void (APIENTRYP PFNGLUNIFORM1I64VNVPROC) (GLint location, GLsizei count, const GLint64EXT *value); +typedef void (APIENTRYP PFNGLUNIFORM2I64VNVPROC) (GLint location, GLsizei count, const GLint64EXT *value); +typedef void (APIENTRYP PFNGLUNIFORM3I64VNVPROC) (GLint location, GLsizei count, const GLint64EXT *value); +typedef void (APIENTRYP PFNGLUNIFORM4I64VNVPROC) (GLint location, GLsizei count, const GLint64EXT *value); +typedef void (APIENTRYP PFNGLUNIFORM1UI64NVPROC) (GLint location, GLuint64EXT x); +typedef void (APIENTRYP PFNGLUNIFORM2UI64NVPROC) (GLint location, GLuint64EXT x, GLuint64EXT y); +typedef void (APIENTRYP PFNGLUNIFORM3UI64NVPROC) (GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z); +typedef void (APIENTRYP PFNGLUNIFORM4UI64NVPROC) (GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z, GLuint64EXT w); +typedef void (APIENTRYP PFNGLUNIFORM1UI64VNVPROC) (GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (APIENTRYP PFNGLUNIFORM2UI64VNVPROC) (GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (APIENTRYP PFNGLUNIFORM3UI64VNVPROC) (GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (APIENTRYP PFNGLUNIFORM4UI64VNVPROC) (GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (APIENTRYP PFNGLGETUNIFORMI64VNVPROC) (GLuint program, GLint location, GLint64EXT *params); +typedef void (APIENTRYP PFNGLGETUNIFORMUI64VNVPROC) (GLuint program, GLint location, GLuint64EXT *params); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1I64NVPROC) (GLuint program, GLint location, GLint64EXT x); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2I64NVPROC) (GLuint program, GLint location, GLint64EXT x, GLint64EXT y); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3I64NVPROC) (GLuint program, GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4I64NVPROC) (GLuint program, GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z, GLint64EXT w); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1I64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2I64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3I64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4I64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UI64NVPROC) (GLuint program, GLint location, GLuint64EXT x); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UI64NVPROC) (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UI64NVPROC) (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UI64NVPROC) (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z, GLuint64EXT w); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UI64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UI64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UI64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UI64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glUniform1i64NV (GLint location, GLint64EXT x); +GLAPI void APIENTRY glUniform2i64NV (GLint location, GLint64EXT x, GLint64EXT y); +GLAPI void APIENTRY glUniform3i64NV (GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z); +GLAPI void APIENTRY glUniform4i64NV (GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z, GLint64EXT w); +GLAPI void APIENTRY glUniform1i64vNV (GLint location, GLsizei count, const GLint64EXT *value); +GLAPI void APIENTRY glUniform2i64vNV (GLint location, GLsizei count, const GLint64EXT *value); +GLAPI void APIENTRY glUniform3i64vNV (GLint location, GLsizei count, const GLint64EXT *value); +GLAPI void APIENTRY glUniform4i64vNV (GLint location, GLsizei count, const GLint64EXT *value); +GLAPI void APIENTRY glUniform1ui64NV (GLint location, GLuint64EXT x); +GLAPI void APIENTRY glUniform2ui64NV (GLint location, GLuint64EXT x, GLuint64EXT y); +GLAPI void APIENTRY glUniform3ui64NV (GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z); +GLAPI void APIENTRY glUniform4ui64NV (GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z, GLuint64EXT w); +GLAPI void APIENTRY glUniform1ui64vNV (GLint location, GLsizei count, const GLuint64EXT *value); +GLAPI void APIENTRY glUniform2ui64vNV (GLint location, GLsizei count, const GLuint64EXT *value); +GLAPI void APIENTRY glUniform3ui64vNV (GLint location, GLsizei count, const GLuint64EXT *value); +GLAPI void APIENTRY glUniform4ui64vNV (GLint location, GLsizei count, const GLuint64EXT *value); +GLAPI void APIENTRY glGetUniformi64vNV (GLuint program, GLint location, GLint64EXT *params); +GLAPI void APIENTRY glGetUniformui64vNV (GLuint program, GLint location, GLuint64EXT *params); +GLAPI void APIENTRY glProgramUniform1i64NV (GLuint program, GLint location, GLint64EXT x); +GLAPI void APIENTRY glProgramUniform2i64NV (GLuint program, GLint location, GLint64EXT x, GLint64EXT y); +GLAPI void APIENTRY glProgramUniform3i64NV (GLuint program, GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z); +GLAPI void APIENTRY glProgramUniform4i64NV (GLuint program, GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z, GLint64EXT w); +GLAPI void APIENTRY glProgramUniform1i64vNV (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +GLAPI void APIENTRY glProgramUniform2i64vNV (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +GLAPI void APIENTRY glProgramUniform3i64vNV (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +GLAPI void APIENTRY glProgramUniform4i64vNV (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +GLAPI void APIENTRY glProgramUniform1ui64NV (GLuint program, GLint location, GLuint64EXT x); +GLAPI void APIENTRY glProgramUniform2ui64NV (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y); +GLAPI void APIENTRY glProgramUniform3ui64NV (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z); +GLAPI void APIENTRY glProgramUniform4ui64NV (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z, GLuint64EXT w); +GLAPI void APIENTRY glProgramUniform1ui64vNV (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +GLAPI void APIENTRY glProgramUniform2ui64vNV (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +GLAPI void APIENTRY glProgramUniform3ui64vNV (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +GLAPI void APIENTRY glProgramUniform4ui64vNV (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +#endif +#endif /* GL_AMD_gpu_shader_int64 */ + #ifndef GL_AMD_interleaved_elements #define GL_AMD_interleaved_elements 1 #define GL_VERTEX_ELEMENT_SWIZZLE_AMD 0x91A4 @@ -4807,11 +5489,11 @@ GLAPI void APIENTRY glVertexAttribParameteriAMD (GLuint index, GLenum pname, GLi #ifndef GL_AMD_multi_draw_indirect #define GL_AMD_multi_draw_indirect 1 -typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSINDIRECTAMDPROC) (GLenum mode, const GLvoid *indirect, GLsizei primcount, GLsizei stride); -typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTAMDPROC) (GLenum mode, GLenum type, const GLvoid *indirect, GLsizei primcount, GLsizei stride); +typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSINDIRECTAMDPROC) (GLenum mode, const void *indirect, GLsizei primcount, GLsizei stride); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTAMDPROC) (GLenum mode, GLenum type, const void *indirect, GLsizei primcount, GLsizei stride); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glMultiDrawArraysIndirectAMD (GLenum mode, const GLvoid *indirect, GLsizei primcount, GLsizei stride); -GLAPI void APIENTRY glMultiDrawElementsIndirectAMD (GLenum mode, GLenum type, const GLvoid *indirect, GLsizei primcount, GLsizei stride); +GLAPI void APIENTRY glMultiDrawArraysIndirectAMD (GLenum mode, const void *indirect, GLsizei primcount, GLsizei stride); +GLAPI void APIENTRY glMultiDrawElementsIndirectAMD (GLenum mode, GLenum type, const void *indirect, GLsizei primcount, GLsizei stride); #endif #endif /* GL_AMD_multi_draw_indirect */ @@ -4832,6 +5514,20 @@ GLAPI GLboolean APIENTRY glIsNameAMD (GLenum identifier, GLuint name); #endif #endif /* GL_AMD_name_gen_delete */ +#ifndef GL_AMD_occlusion_query_event +#define GL_AMD_occlusion_query_event 1 +#define GL_OCCLUSION_QUERY_EVENT_MASK_AMD 0x874F +#define GL_QUERY_DEPTH_PASS_EVENT_BIT_AMD 0x00000001 +#define GL_QUERY_DEPTH_FAIL_EVENT_BIT_AMD 0x00000002 +#define GL_QUERY_STENCIL_FAIL_EVENT_BIT_AMD 0x00000004 +#define GL_QUERY_DEPTH_BOUNDS_FAIL_EVENT_BIT_AMD 0x00000008 +#define GL_QUERY_ALL_EVENT_BITS_AMD 0xFFFFFFFF +typedef void (APIENTRYP PFNGLQUERYOBJECTPARAMETERUIAMDPROC) (GLenum target, GLuint id, GLenum pname, GLuint param); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glQueryObjectParameteruiAMD (GLenum target, GLuint id, GLenum pname, GLuint param); +#endif +#endif /* GL_AMD_occlusion_query_event */ + #ifndef GL_AMD_performance_monitor #define GL_AMD_performance_monitor 1 #define GL_COUNTER_TYPE_AMD 0x8BC0 @@ -4845,7 +5541,7 @@ typedef void (APIENTRYP PFNGLGETPERFMONITORGROUPSAMDPROC) (GLint *numGroups, GLs typedef void (APIENTRYP PFNGLGETPERFMONITORCOUNTERSAMDPROC) (GLuint group, GLint *numCounters, GLint *maxActiveCounters, GLsizei counterSize, GLuint *counters); typedef void (APIENTRYP PFNGLGETPERFMONITORGROUPSTRINGAMDPROC) (GLuint group, GLsizei bufSize, GLsizei *length, GLchar *groupString); typedef void (APIENTRYP PFNGLGETPERFMONITORCOUNTERSTRINGAMDPROC) (GLuint group, GLuint counter, GLsizei bufSize, GLsizei *length, GLchar *counterString); -typedef void (APIENTRYP PFNGLGETPERFMONITORCOUNTERINFOAMDPROC) (GLuint group, GLuint counter, GLenum pname, GLvoid *data); +typedef void (APIENTRYP PFNGLGETPERFMONITORCOUNTERINFOAMDPROC) (GLuint group, GLuint counter, GLenum pname, void *data); typedef void (APIENTRYP PFNGLGENPERFMONITORSAMDPROC) (GLsizei n, GLuint *monitors); typedef void (APIENTRYP PFNGLDELETEPERFMONITORSAMDPROC) (GLsizei n, GLuint *monitors); typedef void (APIENTRYP PFNGLSELECTPERFMONITORCOUNTERSAMDPROC) (GLuint monitor, GLboolean enable, GLuint group, GLint numCounters, GLuint *counterList); @@ -4857,7 +5553,7 @@ GLAPI void APIENTRY glGetPerfMonitorGroupsAMD (GLint *numGroups, GLsizei groupsS GLAPI void APIENTRY glGetPerfMonitorCountersAMD (GLuint group, GLint *numCounters, GLint *maxActiveCounters, GLsizei counterSize, GLuint *counters); GLAPI void APIENTRY glGetPerfMonitorGroupStringAMD (GLuint group, GLsizei bufSize, GLsizei *length, GLchar *groupString); GLAPI void APIENTRY glGetPerfMonitorCounterStringAMD (GLuint group, GLuint counter, GLsizei bufSize, GLsizei *length, GLchar *counterString); -GLAPI void APIENTRY glGetPerfMonitorCounterInfoAMD (GLuint group, GLuint counter, GLenum pname, GLvoid *data); +GLAPI void APIENTRY glGetPerfMonitorCounterInfoAMD (GLuint group, GLuint counter, GLenum pname, void *data); GLAPI void APIENTRY glGenPerfMonitorsAMD (GLsizei n, GLuint *monitors); GLAPI void APIENTRY glDeletePerfMonitorsAMD (GLsizei n, GLuint *monitors); GLAPI void APIENTRY glSelectPerfMonitorCountersAMD (GLuint monitor, GLboolean enable, GLuint group, GLint numCounters, GLuint *counterList); @@ -4943,6 +5639,11 @@ GLAPI void APIENTRY glStencilOpValueAMD (GLenum face, GLuint value); #define GL_AMD_transform_feedback3_lines_triangles 1 #endif /* GL_AMD_transform_feedback3_lines_triangles */ +#ifndef GL_AMD_transform_feedback4 +#define GL_AMD_transform_feedback4 1 +#define GL_STREAM_RASTERIZATION_AMD 0x91A0 +#endif /* GL_AMD_transform_feedback4 */ + #ifndef GL_AMD_vertex_shader_layer #define GL_AMD_vertex_shader_layer 1 #endif /* GL_AMD_vertex_shader_layer */ @@ -4983,13 +5684,13 @@ GLAPI void APIENTRY glTessellationModeAMD (GLenum mode); #define GL_ELEMENT_ARRAY_APPLE 0x8A0C #define GL_ELEMENT_ARRAY_TYPE_APPLE 0x8A0D #define GL_ELEMENT_ARRAY_POINTER_APPLE 0x8A0E -typedef void (APIENTRYP PFNGLELEMENTPOINTERAPPLEPROC) (GLenum type, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLELEMENTPOINTERAPPLEPROC) (GLenum type, const void *pointer); typedef void (APIENTRYP PFNGLDRAWELEMENTARRAYAPPLEPROC) (GLenum mode, GLint first, GLsizei count); typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTARRAYAPPLEPROC) (GLenum mode, GLuint start, GLuint end, GLint first, GLsizei count); typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTARRAYAPPLEPROC) (GLenum mode, const GLint *first, const GLsizei *count, GLsizei primcount); typedef void (APIENTRYP PFNGLMULTIDRAWRANGEELEMENTARRAYAPPLEPROC) (GLenum mode, GLuint start, GLuint end, const GLint *first, const GLsizei *count, GLsizei primcount); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glElementPointerAPPLE (GLenum type, const GLvoid *pointer); +GLAPI void APIENTRY glElementPointerAPPLE (GLenum type, const void *pointer); GLAPI void APIENTRY glDrawElementArrayAPPLE (GLenum mode, GLint first, GLsizei count); GLAPI void APIENTRY glDrawRangeElementArrayAPPLE (GLenum mode, GLuint start, GLuint end, GLint first, GLsizei count); GLAPI void APIENTRY glMultiDrawElementArrayAPPLE (GLenum mode, const GLint *first, const GLsizei *count, GLsizei primcount); @@ -5074,6 +5775,7 @@ GLAPI void APIENTRY glGetObjectParameterivAPPLE (GLenum objectType, GLuint name, #define GL_RGB_422_APPLE 0x8A1F #define GL_UNSIGNED_SHORT_8_8_APPLE 0x85BA #define GL_UNSIGNED_SHORT_8_8_REV_APPLE 0x85BB +#define GL_RGB_RAW_422_APPLE 0x8A51 #endif /* GL_APPLE_rgb_422 */ #ifndef GL_APPLE_row_bytes @@ -5095,11 +5797,11 @@ GLAPI void APIENTRY glGetObjectParameterivAPPLE (GLenum objectType, GLuint name, #define GL_STORAGE_PRIVATE_APPLE 0x85BD #define GL_STORAGE_CACHED_APPLE 0x85BE #define GL_STORAGE_SHARED_APPLE 0x85BF -typedef void (APIENTRYP PFNGLTEXTURERANGEAPPLEPROC) (GLenum target, GLsizei length, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLGETTEXPARAMETERPOINTERVAPPLEPROC) (GLenum target, GLenum pname, GLvoid **params); +typedef void (APIENTRYP PFNGLTEXTURERANGEAPPLEPROC) (GLenum target, GLsizei length, const void *pointer); +typedef void (APIENTRYP PFNGLGETTEXPARAMETERPOINTERVAPPLEPROC) (GLenum target, GLenum pname, void **params); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glTextureRangeAPPLE (GLenum target, GLsizei length, const GLvoid *pointer); -GLAPI void APIENTRY glGetTexParameterPointervAPPLE (GLenum target, GLenum pname, GLvoid **params); +GLAPI void APIENTRY glTextureRangeAPPLE (GLenum target, GLsizei length, const void *pointer); +GLAPI void APIENTRY glGetTexParameterPointervAPPLE (GLenum target, GLenum pname, void **params); #endif #endif /* GL_APPLE_texture_range */ @@ -5130,12 +5832,12 @@ GLAPI GLboolean APIENTRY glIsVertexArrayAPPLE (GLuint array); #define GL_VERTEX_ARRAY_STORAGE_HINT_APPLE 0x851F #define GL_VERTEX_ARRAY_RANGE_POINTER_APPLE 0x8521 #define GL_STORAGE_CLIENT_APPLE 0x85B4 -typedef void (APIENTRYP PFNGLVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, GLvoid *pointer); -typedef void (APIENTRYP PFNGLFLUSHVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, GLvoid *pointer); +typedef void (APIENTRYP PFNGLVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, void *pointer); +typedef void (APIENTRYP PFNGLFLUSHVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, void *pointer); typedef void (APIENTRYP PFNGLVERTEXARRAYPARAMETERIAPPLEPROC) (GLenum pname, GLint param); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glVertexArrayRangeAPPLE (GLsizei length, GLvoid *pointer); -GLAPI void APIENTRY glFlushVertexArrayRangeAPPLE (GLsizei length, GLvoid *pointer); +GLAPI void APIENTRY glVertexArrayRangeAPPLE (GLsizei length, void *pointer); +GLAPI void APIENTRY glFlushVertexArrayRangeAPPLE (GLsizei length, void *pointer); GLAPI void APIENTRY glVertexArrayParameteriAPPLE (GLenum pname, GLint param); #endif #endif /* GL_APPLE_vertex_array_range */ @@ -5205,11 +5907,11 @@ GLAPI void APIENTRY glDrawBuffersATI (GLsizei n, const GLenum *bufs); #define GL_ELEMENT_ARRAY_ATI 0x8768 #define GL_ELEMENT_ARRAY_TYPE_ATI 0x8769 #define GL_ELEMENT_ARRAY_POINTER_ATI 0x876A -typedef void (APIENTRYP PFNGLELEMENTPOINTERATIPROC) (GLenum type, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLELEMENTPOINTERATIPROC) (GLenum type, const void *pointer); typedef void (APIENTRYP PFNGLDRAWELEMENTARRAYATIPROC) (GLenum mode, GLsizei count); typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTARRAYATIPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glElementPointerATI (GLenum type, const GLvoid *pointer); +GLAPI void APIENTRY glElementPointerATI (GLenum type, const void *pointer); GLAPI void APIENTRY glDrawElementArrayATI (GLenum mode, GLsizei count); GLAPI void APIENTRY glDrawRangeElementArrayATI (GLenum mode, GLuint start, GLuint end, GLsizei count); #endif @@ -5475,9 +6177,9 @@ GLAPI void APIENTRY glStencilFuncSeparateATI (GLenum frontfunc, GLenum backfunc, #define GL_OBJECT_BUFFER_USAGE_ATI 0x8765 #define GL_ARRAY_OBJECT_BUFFER_ATI 0x8766 #define GL_ARRAY_OBJECT_OFFSET_ATI 0x8767 -typedef GLuint (APIENTRYP PFNGLNEWOBJECTBUFFERATIPROC) (GLsizei size, const GLvoid *pointer, GLenum usage); +typedef GLuint (APIENTRYP PFNGLNEWOBJECTBUFFERATIPROC) (GLsizei size, const void *pointer, GLenum usage); typedef GLboolean (APIENTRYP PFNGLISOBJECTBUFFERATIPROC) (GLuint buffer); -typedef void (APIENTRYP PFNGLUPDATEOBJECTBUFFERATIPROC) (GLuint buffer, GLuint offset, GLsizei size, const GLvoid *pointer, GLenum preserve); +typedef void (APIENTRYP PFNGLUPDATEOBJECTBUFFERATIPROC) (GLuint buffer, GLuint offset, GLsizei size, const void *pointer, GLenum preserve); typedef void (APIENTRYP PFNGLGETOBJECTBUFFERFVATIPROC) (GLuint buffer, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETOBJECTBUFFERIVATIPROC) (GLuint buffer, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLFREEOBJECTBUFFERATIPROC) (GLuint buffer); @@ -5488,9 +6190,9 @@ typedef void (APIENTRYP PFNGLVARIANTARRAYOBJECTATIPROC) (GLuint id, GLenum type, typedef void (APIENTRYP PFNGLGETVARIANTARRAYOBJECTFVATIPROC) (GLuint id, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETVARIANTARRAYOBJECTIVATIPROC) (GLuint id, GLenum pname, GLint *params); #ifdef GL_GLEXT_PROTOTYPES -GLAPI GLuint APIENTRY glNewObjectBufferATI (GLsizei size, const GLvoid *pointer, GLenum usage); +GLAPI GLuint APIENTRY glNewObjectBufferATI (GLsizei size, const void *pointer, GLenum usage); GLAPI GLboolean APIENTRY glIsObjectBufferATI (GLuint buffer); -GLAPI void APIENTRY glUpdateObjectBufferATI (GLuint buffer, GLuint offset, GLsizei size, const GLvoid *pointer, GLenum preserve); +GLAPI void APIENTRY glUpdateObjectBufferATI (GLuint buffer, GLuint offset, GLsizei size, const void *pointer, GLenum preserve); GLAPI void APIENTRY glGetObjectBufferfvATI (GLuint buffer, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetObjectBufferivATI (GLuint buffer, GLenum pname, GLint *params); GLAPI void APIENTRY glFreeObjectBufferATI (GLuint buffer); @@ -5730,10 +6432,10 @@ GLAPI void APIENTRY glBlendEquationEXT (GLenum mode); #ifndef GL_EXT_color_subtable #define GL_EXT_color_subtable 1 -typedef void (APIENTRYP PFNGLCOLORSUBTABLEEXTPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid *data); +typedef void (APIENTRYP PFNGLCOLORSUBTABLEEXTPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const void *data); typedef void (APIENTRYP PFNGLCOPYCOLORSUBTABLEEXTPROC) (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glColorSubTableEXT (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid *data); +GLAPI void APIENTRY glColorSubTableEXT (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const void *data); GLAPI void APIENTRY glCopyColorSubTableEXT (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width); #endif #endif /* GL_EXT_color_subtable */ @@ -5772,33 +6474,33 @@ GLAPI void APIENTRY glUnlockArraysEXT (void); #define GL_POST_CONVOLUTION_GREEN_BIAS_EXT 0x8021 #define GL_POST_CONVOLUTION_BLUE_BIAS_EXT 0x8022 #define GL_POST_CONVOLUTION_ALPHA_BIAS_EXT 0x8023 -typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER1DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *image); -typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *image); +typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER1DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const void *image); +typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *image); typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFEXTPROC) (GLenum target, GLenum pname, GLfloat params); typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFVEXTPROC) (GLenum target, GLenum pname, const GLfloat *params); typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIEXTPROC) (GLenum target, GLenum pname, GLint params); typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIVEXTPROC) (GLenum target, GLenum pname, const GLint *params); typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER1DEXTPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height); -typedef void (APIENTRYP PFNGLGETCONVOLUTIONFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *image); +typedef void (APIENTRYP PFNGLGETCONVOLUTIONFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, void *image); typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETSEPARABLEFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *row, GLvoid *column, GLvoid *span); -typedef void (APIENTRYP PFNGLSEPARABLEFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *row, const GLvoid *column); +typedef void (APIENTRYP PFNGLGETSEPARABLEFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, void *row, void *column, void *span); +typedef void (APIENTRYP PFNGLSEPARABLEFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *row, const void *column); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glConvolutionFilter1DEXT (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *image); -GLAPI void APIENTRY glConvolutionFilter2DEXT (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *image); +GLAPI void APIENTRY glConvolutionFilter1DEXT (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const void *image); +GLAPI void APIENTRY glConvolutionFilter2DEXT (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *image); GLAPI void APIENTRY glConvolutionParameterfEXT (GLenum target, GLenum pname, GLfloat params); GLAPI void APIENTRY glConvolutionParameterfvEXT (GLenum target, GLenum pname, const GLfloat *params); GLAPI void APIENTRY glConvolutionParameteriEXT (GLenum target, GLenum pname, GLint params); GLAPI void APIENTRY glConvolutionParameterivEXT (GLenum target, GLenum pname, const GLint *params); GLAPI void APIENTRY glCopyConvolutionFilter1DEXT (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); GLAPI void APIENTRY glCopyConvolutionFilter2DEXT (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height); -GLAPI void APIENTRY glGetConvolutionFilterEXT (GLenum target, GLenum format, GLenum type, GLvoid *image); +GLAPI void APIENTRY glGetConvolutionFilterEXT (GLenum target, GLenum format, GLenum type, void *image); GLAPI void APIENTRY glGetConvolutionParameterfvEXT (GLenum target, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetConvolutionParameterivEXT (GLenum target, GLenum pname, GLint *params); -GLAPI void APIENTRY glGetSeparableFilterEXT (GLenum target, GLenum format, GLenum type, GLvoid *row, GLvoid *column, GLvoid *span); -GLAPI void APIENTRY glSeparableFilter2DEXT (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *row, const GLvoid *column); +GLAPI void APIENTRY glGetSeparableFilterEXT (GLenum target, GLenum format, GLenum type, void *row, void *column, void *span); +GLAPI void APIENTRY glSeparableFilter2DEXT (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *row, const void *column); #endif #endif /* GL_EXT_convolution */ @@ -5838,8 +6540,8 @@ typedef void (APIENTRYP PFNGLBINORMAL3IEXTPROC) (GLint bx, GLint by, GLint bz); typedef void (APIENTRYP PFNGLBINORMAL3IVEXTPROC) (const GLint *v); typedef void (APIENTRYP PFNGLBINORMAL3SEXTPROC) (GLshort bx, GLshort by, GLshort bz); typedef void (APIENTRYP PFNGLBINORMAL3SVEXTPROC) (const GLshort *v); -typedef void (APIENTRYP PFNGLTANGENTPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLBINORMALPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLTANGENTPOINTEREXTPROC) (GLenum type, GLsizei stride, const void *pointer); +typedef void (APIENTRYP PFNGLBINORMALPOINTEREXTPROC) (GLenum type, GLsizei stride, const void *pointer); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glTangent3bEXT (GLbyte tx, GLbyte ty, GLbyte tz); GLAPI void APIENTRY glTangent3bvEXT (const GLbyte *v); @@ -5861,8 +6563,8 @@ GLAPI void APIENTRY glBinormal3iEXT (GLint bx, GLint by, GLint bz); GLAPI void APIENTRY glBinormal3ivEXT (const GLint *v); GLAPI void APIENTRY glBinormal3sEXT (GLshort bx, GLshort by, GLshort bz); GLAPI void APIENTRY glBinormal3svEXT (const GLshort *v); -GLAPI void APIENTRY glTangentPointerEXT (GLenum type, GLsizei stride, const GLvoid *pointer); -GLAPI void APIENTRY glBinormalPointerEXT (GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glTangentPointerEXT (GLenum type, GLsizei stride, const void *pointer); +GLAPI void APIENTRY glBinormalPointerEXT (GLenum type, GLsizei stride, const void *pointer); #endif #endif /* GL_EXT_coordinate_frame */ @@ -5895,6 +6597,34 @@ GLAPI void APIENTRY glCullParameterfvEXT (GLenum pname, GLfloat *params); #endif #endif /* GL_EXT_cull_vertex */ +#ifndef GL_EXT_debug_label +#define GL_EXT_debug_label 1 +#define GL_PROGRAM_PIPELINE_OBJECT_EXT 0x8A4F +#define GL_PROGRAM_OBJECT_EXT 0x8B40 +#define GL_SHADER_OBJECT_EXT 0x8B48 +#define GL_BUFFER_OBJECT_EXT 0x9151 +#define GL_QUERY_OBJECT_EXT 0x9153 +#define GL_VERTEX_ARRAY_OBJECT_EXT 0x9154 +typedef void (APIENTRYP PFNGLLABELOBJECTEXTPROC) (GLenum type, GLuint object, GLsizei length, const GLchar *label); +typedef void (APIENTRYP PFNGLGETOBJECTLABELEXTPROC) (GLenum type, GLuint object, GLsizei bufSize, GLsizei *length, GLchar *label); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glLabelObjectEXT (GLenum type, GLuint object, GLsizei length, const GLchar *label); +GLAPI void APIENTRY glGetObjectLabelEXT (GLenum type, GLuint object, GLsizei bufSize, GLsizei *length, GLchar *label); +#endif +#endif /* GL_EXT_debug_label */ + +#ifndef GL_EXT_debug_marker +#define GL_EXT_debug_marker 1 +typedef void (APIENTRYP PFNGLINSERTEVENTMARKEREXTPROC) (GLsizei length, const GLchar *marker); +typedef void (APIENTRYP PFNGLPUSHGROUPMARKEREXTPROC) (GLsizei length, const GLchar *marker); +typedef void (APIENTRYP PFNGLPOPGROUPMARKEREXTPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glInsertEventMarkerEXT (GLsizei length, const GLchar *marker); +GLAPI void APIENTRY glPushGroupMarkerEXT (GLsizei length, const GLchar *marker); +GLAPI void APIENTRY glPopGroupMarkerEXT (void); +#endif +#endif /* GL_EXT_debug_marker */ + #ifndef GL_EXT_depth_bounds_test #define GL_EXT_depth_bounds_test 1 #define GL_DEPTH_BOUNDS_TEST_EXT 0x8890 @@ -5931,24 +6661,24 @@ typedef void (APIENTRYP PFNGLTEXTUREPARAMETERFEXTPROC) (GLuint texture, GLenum t typedef void (APIENTRYP PFNGLTEXTUREPARAMETERFVEXTPROC) (GLuint texture, GLenum target, GLenum pname, const GLfloat *params); typedef void (APIENTRYP PFNGLTEXTUREPARAMETERIEXTPROC) (GLuint texture, GLenum target, GLenum pname, GLint param); typedef void (APIENTRYP PFNGLTEXTUREPARAMETERIVEXTPROC) (GLuint texture, GLenum target, GLenum pname, const GLint *params); -typedef void (APIENTRYP PFNGLTEXTUREIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLTEXTUREIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLTEXTURESUBIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLTEXTURESUBIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLTEXTUREIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXTUREIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXTURESUBIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXTURESUBIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); typedef void (APIENTRYP PFNGLCOPYTEXTUREIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border); typedef void (APIENTRYP PFNGLCOPYTEXTUREIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); typedef void (APIENTRYP PFNGLCOPYTEXTURESUBIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); typedef void (APIENTRYP PFNGLCOPYTEXTURESUBIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); -typedef void (APIENTRYP PFNGLGETTEXTUREIMAGEEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum format, GLenum type, GLvoid *pixels); +typedef void (APIENTRYP PFNGLGETTEXTUREIMAGEEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum format, GLenum type, void *pixels); typedef void (APIENTRYP PFNGLGETTEXTUREPARAMETERFVEXTPROC) (GLuint texture, GLenum target, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETTEXTUREPARAMETERIVEXTPROC) (GLuint texture, GLenum target, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETTEXTURELEVELPARAMETERFVEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETTEXTURELEVELPARAMETERIVEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLTEXTUREIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLTEXTURESUBIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLTEXTUREIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXTURESUBIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); typedef void (APIENTRYP PFNGLCOPYTEXTURESUBIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); typedef void (APIENTRYP PFNGLBINDMULTITEXTUREEXTPROC) (GLenum texunit, GLenum target, GLuint texture); -typedef void (APIENTRYP PFNGLMULTITEXCOORDPOINTEREXTPROC) (GLenum texunit, GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLMULTITEXCOORDPOINTEREXTPROC) (GLenum texunit, GLint size, GLenum type, GLsizei stride, const void *pointer); typedef void (APIENTRYP PFNGLMULTITEXENVFEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLfloat param); typedef void (APIENTRYP PFNGLMULTITEXENVFVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, const GLfloat *params); typedef void (APIENTRYP PFNGLMULTITEXENVIEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLint param); @@ -5968,57 +6698,57 @@ typedef void (APIENTRYP PFNGLMULTITEXPARAMETERIEXTPROC) (GLenum texunit, GLenum typedef void (APIENTRYP PFNGLMULTITEXPARAMETERIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, const GLint *params); typedef void (APIENTRYP PFNGLMULTITEXPARAMETERFEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLfloat param); typedef void (APIENTRYP PFNGLMULTITEXPARAMETERFVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLMULTITEXIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLMULTITEXIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLMULTITEXSUBIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLMULTITEXSUBIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLMULTITEXIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLMULTITEXIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLMULTITEXSUBIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLMULTITEXSUBIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); typedef void (APIENTRYP PFNGLCOPYMULTITEXIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border); typedef void (APIENTRYP PFNGLCOPYMULTITEXIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); typedef void (APIENTRYP PFNGLCOPYMULTITEXSUBIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); typedef void (APIENTRYP PFNGLCOPYMULTITEXSUBIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); -typedef void (APIENTRYP PFNGLGETMULTITEXIMAGEEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum format, GLenum type, GLvoid *pixels); +typedef void (APIENTRYP PFNGLGETMULTITEXIMAGEEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum format, GLenum type, void *pixels); typedef void (APIENTRYP PFNGLGETMULTITEXPARAMETERFVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETMULTITEXPARAMETERIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETMULTITEXLEVELPARAMETERFVEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETMULTITEXLEVELPARAMETERIVEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLMULTITEXIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLMULTITEXSUBIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLMULTITEXIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLMULTITEXSUBIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); typedef void (APIENTRYP PFNGLCOPYMULTITEXSUBIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); typedef void (APIENTRYP PFNGLENABLECLIENTSTATEINDEXEDEXTPROC) (GLenum array, GLuint index); typedef void (APIENTRYP PFNGLDISABLECLIENTSTATEINDEXEDEXTPROC) (GLenum array, GLuint index); typedef void (APIENTRYP PFNGLGETFLOATINDEXEDVEXTPROC) (GLenum target, GLuint index, GLfloat *data); typedef void (APIENTRYP PFNGLGETDOUBLEINDEXEDVEXTPROC) (GLenum target, GLuint index, GLdouble *data); -typedef void (APIENTRYP PFNGLGETPOINTERINDEXEDVEXTPROC) (GLenum target, GLuint index, GLvoid **data); +typedef void (APIENTRYP PFNGLGETPOINTERINDEXEDVEXTPROC) (GLenum target, GLuint index, void **data); typedef void (APIENTRYP PFNGLENABLEINDEXEDEXTPROC) (GLenum target, GLuint index); typedef void (APIENTRYP PFNGLDISABLEINDEXEDEXTPROC) (GLenum target, GLuint index); typedef GLboolean (APIENTRYP PFNGLISENABLEDINDEXEDEXTPROC) (GLenum target, GLuint index); typedef void (APIENTRYP PFNGLGETINTEGERINDEXEDVEXTPROC) (GLenum target, GLuint index, GLint *data); typedef void (APIENTRYP PFNGLGETBOOLEANINDEXEDVEXTPROC) (GLenum target, GLuint index, GLboolean *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTUREIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *bits); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTUREIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *bits); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTUREIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *bits); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTURESUBIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *bits); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTURESUBIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *bits); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTURESUBIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *bits); -typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXTUREIMAGEEXTPROC) (GLuint texture, GLenum target, GLint lod, GLvoid *img); -typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *bits); -typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *bits); -typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *bits); -typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXSUBIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *bits); -typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXSUBIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *bits); -typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXSUBIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *bits); -typedef void (APIENTRYP PFNGLGETCOMPRESSEDMULTITEXIMAGEEXTPROC) (GLenum texunit, GLenum target, GLint lod, GLvoid *img); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTUREIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTUREIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTUREIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTURESUBIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTURESUBIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTURESUBIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXTUREIMAGEEXTPROC) (GLuint texture, GLenum target, GLint lod, void *img); +typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXSUBIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXSUBIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXSUBIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLGETCOMPRESSEDMULTITEXIMAGEEXTPROC) (GLenum texunit, GLenum target, GLint lod, void *img); typedef void (APIENTRYP PFNGLMATRIXLOADTRANSPOSEFEXTPROC) (GLenum mode, const GLfloat *m); typedef void (APIENTRYP PFNGLMATRIXLOADTRANSPOSEDEXTPROC) (GLenum mode, const GLdouble *m); typedef void (APIENTRYP PFNGLMATRIXMULTTRANSPOSEFEXTPROC) (GLenum mode, const GLfloat *m); typedef void (APIENTRYP PFNGLMATRIXMULTTRANSPOSEDEXTPROC) (GLenum mode, const GLdouble *m); -typedef void (APIENTRYP PFNGLNAMEDBUFFERDATAEXTPROC) (GLuint buffer, GLsizeiptr size, const GLvoid *data, GLenum usage); -typedef void (APIENTRYP PFNGLNAMEDBUFFERSUBDATAEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, const GLvoid *data); +typedef void (APIENTRYP PFNGLNAMEDBUFFERDATAEXTPROC) (GLuint buffer, GLsizeiptr size, const void *data, GLenum usage); +typedef void (APIENTRYP PFNGLNAMEDBUFFERSUBDATAEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data); typedef void *(APIENTRYP PFNGLMAPNAMEDBUFFEREXTPROC) (GLuint buffer, GLenum access); typedef GLboolean (APIENTRYP PFNGLUNMAPNAMEDBUFFEREXTPROC) (GLuint buffer); typedef void (APIENTRYP PFNGLGETNAMEDBUFFERPARAMETERIVEXTPROC) (GLuint buffer, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETNAMEDBUFFERPOINTERVEXTPROC) (GLuint buffer, GLenum pname, GLvoid **params); -typedef void (APIENTRYP PFNGLGETNAMEDBUFFERSUBDATAEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, GLvoid *data); +typedef void (APIENTRYP PFNGLGETNAMEDBUFFERPOINTERVEXTPROC) (GLuint buffer, GLenum pname, void **params); +typedef void (APIENTRYP PFNGLGETNAMEDBUFFERSUBDATAEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, void *data); typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1FEXTPROC) (GLuint program, GLint location, GLfloat v0); typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2FEXTPROC) (GLuint program, GLint location, GLfloat v0, GLfloat v1); typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3FEXTPROC) (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2); @@ -6075,8 +6805,8 @@ typedef void (APIENTRYP PFNGLENABLECLIENTSTATEIEXTPROC) (GLenum array, GLuint in typedef void (APIENTRYP PFNGLDISABLECLIENTSTATEIEXTPROC) (GLenum array, GLuint index); typedef void (APIENTRYP PFNGLGETFLOATI_VEXTPROC) (GLenum pname, GLuint index, GLfloat *params); typedef void (APIENTRYP PFNGLGETDOUBLEI_VEXTPROC) (GLenum pname, GLuint index, GLdouble *params); -typedef void (APIENTRYP PFNGLGETPOINTERI_VEXTPROC) (GLenum pname, GLuint index, GLvoid **params); -typedef void (APIENTRYP PFNGLNAMEDPROGRAMSTRINGEXTPROC) (GLuint program, GLenum target, GLenum format, GLsizei len, const GLvoid *string); +typedef void (APIENTRYP PFNGLGETPOINTERI_VEXTPROC) (GLenum pname, GLuint index, void **params); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMSTRINGEXTPROC) (GLuint program, GLenum target, GLenum format, GLsizei len, const void *string); typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETER4DEXTPROC) (GLuint program, GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETER4DVEXTPROC) (GLuint program, GLenum target, GLuint index, const GLdouble *params); typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETER4FEXTPROC) (GLuint program, GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); @@ -6084,7 +6814,7 @@ typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETER4FVEXTPROC) (GLuint progr typedef void (APIENTRYP PFNGLGETNAMEDPROGRAMLOCALPARAMETERDVEXTPROC) (GLuint program, GLenum target, GLuint index, GLdouble *params); typedef void (APIENTRYP PFNGLGETNAMEDPROGRAMLOCALPARAMETERFVEXTPROC) (GLuint program, GLenum target, GLuint index, GLfloat *params); typedef void (APIENTRYP PFNGLGETNAMEDPROGRAMIVEXTPROC) (GLuint program, GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETNAMEDPROGRAMSTRINGEXTPROC) (GLuint program, GLenum target, GLenum pname, GLvoid *string); +typedef void (APIENTRYP PFNGLGETNAMEDPROGRAMSTRINGEXTPROC) (GLuint program, GLenum target, GLenum pname, void *string); typedef void (APIENTRYP PFNGLNAMEDRENDERBUFFERSTORAGEEXTPROC) (GLuint renderbuffer, GLenum internalformat, GLsizei width, GLsizei height); typedef void (APIENTRYP PFNGLGETNAMEDRENDERBUFFERPARAMETERIVEXTPROC) (GLuint renderbuffer, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLNAMEDRENDERBUFFERSTORAGEMULTISAMPLEEXTPROC) (GLuint renderbuffer, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); @@ -6123,13 +6853,14 @@ typedef void (APIENTRYP PFNGLDISABLEVERTEXARRAYEXTPROC) (GLuint vaobj, GLenum ar typedef void (APIENTRYP PFNGLENABLEVERTEXARRAYATTRIBEXTPROC) (GLuint vaobj, GLuint index); typedef void (APIENTRYP PFNGLDISABLEVERTEXARRAYATTRIBEXTPROC) (GLuint vaobj, GLuint index); typedef void (APIENTRYP PFNGLGETVERTEXARRAYINTEGERVEXTPROC) (GLuint vaobj, GLenum pname, GLint *param); -typedef void (APIENTRYP PFNGLGETVERTEXARRAYPOINTERVEXTPROC) (GLuint vaobj, GLenum pname, GLvoid **param); +typedef void (APIENTRYP PFNGLGETVERTEXARRAYPOINTERVEXTPROC) (GLuint vaobj, GLenum pname, void **param); typedef void (APIENTRYP PFNGLGETVERTEXARRAYINTEGERI_VEXTPROC) (GLuint vaobj, GLuint index, GLenum pname, GLint *param); -typedef void (APIENTRYP PFNGLGETVERTEXARRAYPOINTERI_VEXTPROC) (GLuint vaobj, GLuint index, GLenum pname, GLvoid **param); +typedef void (APIENTRYP PFNGLGETVERTEXARRAYPOINTERI_VEXTPROC) (GLuint vaobj, GLuint index, GLenum pname, void **param); typedef void *(APIENTRYP PFNGLMAPNAMEDBUFFERRANGEEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length, GLbitfield access); typedef void (APIENTRYP PFNGLFLUSHMAPPEDNAMEDBUFFERRANGEEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length); +typedef void (APIENTRYP PFNGLNAMEDBUFFERSTORAGEEXTPROC) (GLuint buffer, GLsizeiptr size, const void *data, GLbitfield flags); typedef void (APIENTRYP PFNGLCLEARNAMEDBUFFERDATAEXTPROC) (GLuint buffer, GLenum internalformat, GLenum format, GLenum type, const void *data); -typedef void (APIENTRYP PFNGLCLEARNAMEDBUFFERSUBDATAEXTPROC) (GLuint buffer, GLenum internalformat, GLenum format, GLenum type, GLsizeiptr offset, GLsizeiptr size, const void *data); +typedef void (APIENTRYP PFNGLCLEARNAMEDBUFFERSUBDATAEXTPROC) (GLuint buffer, GLenum internalformat, GLsizeiptr offset, GLsizeiptr size, GLenum format, GLenum type, const void *data); typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERPARAMETERIEXTPROC) (GLuint framebuffer, GLenum pname, GLint param); typedef void (APIENTRYP PFNGLGETNAMEDFRAMEBUFFERPARAMETERIVEXTPROC) (GLuint framebuffer, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1DEXTPROC) (GLuint program, GLint location, GLdouble x); @@ -6162,7 +6893,8 @@ typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBLFORMATEXTPROC) (GLuint vaob typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBBINDINGEXTPROC) (GLuint vaobj, GLuint attribindex, GLuint bindingindex); typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXBINDINGDIVISOREXTPROC) (GLuint vaobj, GLuint bindingindex, GLuint divisor); typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBLOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLuint index, GLint size, GLenum type, GLsizei stride, GLintptr offset); -typedef void (APIENTRYP PFNGLTEXTUREPAGECOMMITMENTEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean resident); +typedef void (APIENTRYP PFNGLTEXTUREPAGECOMMITMENTEXTPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean commit); +typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBDIVISOREXTPROC) (GLuint vaobj, GLuint index, GLuint divisor); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glMatrixLoadfEXT (GLenum mode, const GLfloat *m); GLAPI void APIENTRY glMatrixLoaddEXT (GLenum mode, const GLdouble *m); @@ -6185,24 +6917,24 @@ GLAPI void APIENTRY glTextureParameterfEXT (GLuint texture, GLenum target, GLenu GLAPI void APIENTRY glTextureParameterfvEXT (GLuint texture, GLenum target, GLenum pname, const GLfloat *params); GLAPI void APIENTRY glTextureParameteriEXT (GLuint texture, GLenum target, GLenum pname, GLint param); GLAPI void APIENTRY glTextureParameterivEXT (GLuint texture, GLenum target, GLenum pname, const GLint *params); -GLAPI void APIENTRY glTextureImage1DEXT (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -GLAPI void APIENTRY glTextureImage2DEXT (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -GLAPI void APIENTRY glTextureSubImage1DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const GLvoid *pixels); -GLAPI void APIENTRY glTextureSubImage2DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *pixels); +GLAPI void APIENTRY glTextureImage1DEXT (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTextureImage2DEXT (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTextureSubImage1DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTextureSubImage2DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); GLAPI void APIENTRY glCopyTextureImage1DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border); GLAPI void APIENTRY glCopyTextureImage2DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); GLAPI void APIENTRY glCopyTextureSubImage1DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); GLAPI void APIENTRY glCopyTextureSubImage2DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); -GLAPI void APIENTRY glGetTextureImageEXT (GLuint texture, GLenum target, GLint level, GLenum format, GLenum type, GLvoid *pixels); +GLAPI void APIENTRY glGetTextureImageEXT (GLuint texture, GLenum target, GLint level, GLenum format, GLenum type, void *pixels); GLAPI void APIENTRY glGetTextureParameterfvEXT (GLuint texture, GLenum target, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetTextureParameterivEXT (GLuint texture, GLenum target, GLenum pname, GLint *params); GLAPI void APIENTRY glGetTextureLevelParameterfvEXT (GLuint texture, GLenum target, GLint level, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetTextureLevelParameterivEXT (GLuint texture, GLenum target, GLint level, GLenum pname, GLint *params); -GLAPI void APIENTRY glTextureImage3DEXT (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -GLAPI void APIENTRY glTextureSubImage3DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); +GLAPI void APIENTRY glTextureImage3DEXT (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTextureSubImage3DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); GLAPI void APIENTRY glCopyTextureSubImage3DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); GLAPI void APIENTRY glBindMultiTextureEXT (GLenum texunit, GLenum target, GLuint texture); -GLAPI void APIENTRY glMultiTexCoordPointerEXT (GLenum texunit, GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glMultiTexCoordPointerEXT (GLenum texunit, GLint size, GLenum type, GLsizei stride, const void *pointer); GLAPI void APIENTRY glMultiTexEnvfEXT (GLenum texunit, GLenum target, GLenum pname, GLfloat param); GLAPI void APIENTRY glMultiTexEnvfvEXT (GLenum texunit, GLenum target, GLenum pname, const GLfloat *params); GLAPI void APIENTRY glMultiTexEnviEXT (GLenum texunit, GLenum target, GLenum pname, GLint param); @@ -6222,57 +6954,57 @@ GLAPI void APIENTRY glMultiTexParameteriEXT (GLenum texunit, GLenum target, GLen GLAPI void APIENTRY glMultiTexParameterivEXT (GLenum texunit, GLenum target, GLenum pname, const GLint *params); GLAPI void APIENTRY glMultiTexParameterfEXT (GLenum texunit, GLenum target, GLenum pname, GLfloat param); GLAPI void APIENTRY glMultiTexParameterfvEXT (GLenum texunit, GLenum target, GLenum pname, const GLfloat *params); -GLAPI void APIENTRY glMultiTexImage1DEXT (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -GLAPI void APIENTRY glMultiTexImage2DEXT (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -GLAPI void APIENTRY glMultiTexSubImage1DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const GLvoid *pixels); -GLAPI void APIENTRY glMultiTexSubImage2DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *pixels); +GLAPI void APIENTRY glMultiTexImage1DEXT (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glMultiTexImage2DEXT (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glMultiTexSubImage1DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glMultiTexSubImage2DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); GLAPI void APIENTRY glCopyMultiTexImage1DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border); GLAPI void APIENTRY glCopyMultiTexImage2DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); GLAPI void APIENTRY glCopyMultiTexSubImage1DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); GLAPI void APIENTRY glCopyMultiTexSubImage2DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); -GLAPI void APIENTRY glGetMultiTexImageEXT (GLenum texunit, GLenum target, GLint level, GLenum format, GLenum type, GLvoid *pixels); +GLAPI void APIENTRY glGetMultiTexImageEXT (GLenum texunit, GLenum target, GLint level, GLenum format, GLenum type, void *pixels); GLAPI void APIENTRY glGetMultiTexParameterfvEXT (GLenum texunit, GLenum target, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetMultiTexParameterivEXT (GLenum texunit, GLenum target, GLenum pname, GLint *params); GLAPI void APIENTRY glGetMultiTexLevelParameterfvEXT (GLenum texunit, GLenum target, GLint level, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetMultiTexLevelParameterivEXT (GLenum texunit, GLenum target, GLint level, GLenum pname, GLint *params); -GLAPI void APIENTRY glMultiTexImage3DEXT (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -GLAPI void APIENTRY glMultiTexSubImage3DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); +GLAPI void APIENTRY glMultiTexImage3DEXT (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glMultiTexSubImage3DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); GLAPI void APIENTRY glCopyMultiTexSubImage3DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); GLAPI void APIENTRY glEnableClientStateIndexedEXT (GLenum array, GLuint index); GLAPI void APIENTRY glDisableClientStateIndexedEXT (GLenum array, GLuint index); GLAPI void APIENTRY glGetFloatIndexedvEXT (GLenum target, GLuint index, GLfloat *data); GLAPI void APIENTRY glGetDoubleIndexedvEXT (GLenum target, GLuint index, GLdouble *data); -GLAPI void APIENTRY glGetPointerIndexedvEXT (GLenum target, GLuint index, GLvoid **data); +GLAPI void APIENTRY glGetPointerIndexedvEXT (GLenum target, GLuint index, void **data); GLAPI void APIENTRY glEnableIndexedEXT (GLenum target, GLuint index); GLAPI void APIENTRY glDisableIndexedEXT (GLenum target, GLuint index); GLAPI GLboolean APIENTRY glIsEnabledIndexedEXT (GLenum target, GLuint index); GLAPI void APIENTRY glGetIntegerIndexedvEXT (GLenum target, GLuint index, GLint *data); GLAPI void APIENTRY glGetBooleanIndexedvEXT (GLenum target, GLuint index, GLboolean *data); -GLAPI void APIENTRY glCompressedTextureImage3DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *bits); -GLAPI void APIENTRY glCompressedTextureImage2DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *bits); -GLAPI void APIENTRY glCompressedTextureImage1DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *bits); -GLAPI void APIENTRY glCompressedTextureSubImage3DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *bits); -GLAPI void APIENTRY glCompressedTextureSubImage2DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *bits); -GLAPI void APIENTRY glCompressedTextureSubImage1DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *bits); -GLAPI void APIENTRY glGetCompressedTextureImageEXT (GLuint texture, GLenum target, GLint lod, GLvoid *img); -GLAPI void APIENTRY glCompressedMultiTexImage3DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *bits); -GLAPI void APIENTRY glCompressedMultiTexImage2DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *bits); -GLAPI void APIENTRY glCompressedMultiTexImage1DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *bits); -GLAPI void APIENTRY glCompressedMultiTexSubImage3DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *bits); -GLAPI void APIENTRY glCompressedMultiTexSubImage2DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *bits); -GLAPI void APIENTRY glCompressedMultiTexSubImage1DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *bits); -GLAPI void APIENTRY glGetCompressedMultiTexImageEXT (GLenum texunit, GLenum target, GLint lod, GLvoid *img); +GLAPI void APIENTRY glCompressedTextureImage3DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedTextureImage2DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedTextureImage1DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedTextureSubImage3DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedTextureSubImage2DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedTextureSubImage1DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glGetCompressedTextureImageEXT (GLuint texture, GLenum target, GLint lod, void *img); +GLAPI void APIENTRY glCompressedMultiTexImage3DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedMultiTexImage2DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedMultiTexImage1DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedMultiTexSubImage3DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedMultiTexSubImage2DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedMultiTexSubImage1DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glGetCompressedMultiTexImageEXT (GLenum texunit, GLenum target, GLint lod, void *img); GLAPI void APIENTRY glMatrixLoadTransposefEXT (GLenum mode, const GLfloat *m); GLAPI void APIENTRY glMatrixLoadTransposedEXT (GLenum mode, const GLdouble *m); GLAPI void APIENTRY glMatrixMultTransposefEXT (GLenum mode, const GLfloat *m); GLAPI void APIENTRY glMatrixMultTransposedEXT (GLenum mode, const GLdouble *m); -GLAPI void APIENTRY glNamedBufferDataEXT (GLuint buffer, GLsizeiptr size, const GLvoid *data, GLenum usage); -GLAPI void APIENTRY glNamedBufferSubDataEXT (GLuint buffer, GLintptr offset, GLsizeiptr size, const GLvoid *data); +GLAPI void APIENTRY glNamedBufferDataEXT (GLuint buffer, GLsizeiptr size, const void *data, GLenum usage); +GLAPI void APIENTRY glNamedBufferSubDataEXT (GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data); GLAPI void *APIENTRY glMapNamedBufferEXT (GLuint buffer, GLenum access); GLAPI GLboolean APIENTRY glUnmapNamedBufferEXT (GLuint buffer); GLAPI void APIENTRY glGetNamedBufferParameterivEXT (GLuint buffer, GLenum pname, GLint *params); -GLAPI void APIENTRY glGetNamedBufferPointervEXT (GLuint buffer, GLenum pname, GLvoid **params); -GLAPI void APIENTRY glGetNamedBufferSubDataEXT (GLuint buffer, GLintptr offset, GLsizeiptr size, GLvoid *data); +GLAPI void APIENTRY glGetNamedBufferPointervEXT (GLuint buffer, GLenum pname, void **params); +GLAPI void APIENTRY glGetNamedBufferSubDataEXT (GLuint buffer, GLintptr offset, GLsizeiptr size, void *data); GLAPI void APIENTRY glProgramUniform1fEXT (GLuint program, GLint location, GLfloat v0); GLAPI void APIENTRY glProgramUniform2fEXT (GLuint program, GLint location, GLfloat v0, GLfloat v1); GLAPI void APIENTRY glProgramUniform3fEXT (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2); @@ -6329,8 +7061,8 @@ GLAPI void APIENTRY glEnableClientStateiEXT (GLenum array, GLuint index); GLAPI void APIENTRY glDisableClientStateiEXT (GLenum array, GLuint index); GLAPI void APIENTRY glGetFloati_vEXT (GLenum pname, GLuint index, GLfloat *params); GLAPI void APIENTRY glGetDoublei_vEXT (GLenum pname, GLuint index, GLdouble *params); -GLAPI void APIENTRY glGetPointeri_vEXT (GLenum pname, GLuint index, GLvoid **params); -GLAPI void APIENTRY glNamedProgramStringEXT (GLuint program, GLenum target, GLenum format, GLsizei len, const GLvoid *string); +GLAPI void APIENTRY glGetPointeri_vEXT (GLenum pname, GLuint index, void **params); +GLAPI void APIENTRY glNamedProgramStringEXT (GLuint program, GLenum target, GLenum format, GLsizei len, const void *string); GLAPI void APIENTRY glNamedProgramLocalParameter4dEXT (GLuint program, GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); GLAPI void APIENTRY glNamedProgramLocalParameter4dvEXT (GLuint program, GLenum target, GLuint index, const GLdouble *params); GLAPI void APIENTRY glNamedProgramLocalParameter4fEXT (GLuint program, GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); @@ -6338,7 +7070,7 @@ GLAPI void APIENTRY glNamedProgramLocalParameter4fvEXT (GLuint program, GLenum t GLAPI void APIENTRY glGetNamedProgramLocalParameterdvEXT (GLuint program, GLenum target, GLuint index, GLdouble *params); GLAPI void APIENTRY glGetNamedProgramLocalParameterfvEXT (GLuint program, GLenum target, GLuint index, GLfloat *params); GLAPI void APIENTRY glGetNamedProgramivEXT (GLuint program, GLenum target, GLenum pname, GLint *params); -GLAPI void APIENTRY glGetNamedProgramStringEXT (GLuint program, GLenum target, GLenum pname, GLvoid *string); +GLAPI void APIENTRY glGetNamedProgramStringEXT (GLuint program, GLenum target, GLenum pname, void *string); GLAPI void APIENTRY glNamedRenderbufferStorageEXT (GLuint renderbuffer, GLenum internalformat, GLsizei width, GLsizei height); GLAPI void APIENTRY glGetNamedRenderbufferParameterivEXT (GLuint renderbuffer, GLenum pname, GLint *params); GLAPI void APIENTRY glNamedRenderbufferStorageMultisampleEXT (GLuint renderbuffer, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); @@ -6377,13 +7109,14 @@ GLAPI void APIENTRY glDisableVertexArrayEXT (GLuint vaobj, GLenum array); GLAPI void APIENTRY glEnableVertexArrayAttribEXT (GLuint vaobj, GLuint index); GLAPI void APIENTRY glDisableVertexArrayAttribEXT (GLuint vaobj, GLuint index); GLAPI void APIENTRY glGetVertexArrayIntegervEXT (GLuint vaobj, GLenum pname, GLint *param); -GLAPI void APIENTRY glGetVertexArrayPointervEXT (GLuint vaobj, GLenum pname, GLvoid **param); +GLAPI void APIENTRY glGetVertexArrayPointervEXT (GLuint vaobj, GLenum pname, void **param); GLAPI void APIENTRY glGetVertexArrayIntegeri_vEXT (GLuint vaobj, GLuint index, GLenum pname, GLint *param); -GLAPI void APIENTRY glGetVertexArrayPointeri_vEXT (GLuint vaobj, GLuint index, GLenum pname, GLvoid **param); +GLAPI void APIENTRY glGetVertexArrayPointeri_vEXT (GLuint vaobj, GLuint index, GLenum pname, void **param); GLAPI void *APIENTRY glMapNamedBufferRangeEXT (GLuint buffer, GLintptr offset, GLsizeiptr length, GLbitfield access); GLAPI void APIENTRY glFlushMappedNamedBufferRangeEXT (GLuint buffer, GLintptr offset, GLsizeiptr length); +GLAPI void APIENTRY glNamedBufferStorageEXT (GLuint buffer, GLsizeiptr size, const void *data, GLbitfield flags); GLAPI void APIENTRY glClearNamedBufferDataEXT (GLuint buffer, GLenum internalformat, GLenum format, GLenum type, const void *data); -GLAPI void APIENTRY glClearNamedBufferSubDataEXT (GLuint buffer, GLenum internalformat, GLenum format, GLenum type, GLsizeiptr offset, GLsizeiptr size, const void *data); +GLAPI void APIENTRY glClearNamedBufferSubDataEXT (GLuint buffer, GLenum internalformat, GLsizeiptr offset, GLsizeiptr size, GLenum format, GLenum type, const void *data); GLAPI void APIENTRY glNamedFramebufferParameteriEXT (GLuint framebuffer, GLenum pname, GLint param); GLAPI void APIENTRY glGetNamedFramebufferParameterivEXT (GLuint framebuffer, GLenum pname, GLint *params); GLAPI void APIENTRY glProgramUniform1dEXT (GLuint program, GLint location, GLdouble x); @@ -6416,7 +7149,8 @@ GLAPI void APIENTRY glVertexArrayVertexAttribLFormatEXT (GLuint vaobj, GLuint at GLAPI void APIENTRY glVertexArrayVertexAttribBindingEXT (GLuint vaobj, GLuint attribindex, GLuint bindingindex); GLAPI void APIENTRY glVertexArrayVertexBindingDivisorEXT (GLuint vaobj, GLuint bindingindex, GLuint divisor); GLAPI void APIENTRY glVertexArrayVertexAttribLOffsetEXT (GLuint vaobj, GLuint buffer, GLuint index, GLint size, GLenum type, GLsizei stride, GLintptr offset); -GLAPI void APIENTRY glTexturePageCommitmentEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean resident); +GLAPI void APIENTRY glTexturePageCommitmentEXT (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean commit); +GLAPI void APIENTRY glVertexArrayVertexAttribDivisorEXT (GLuint vaobj, GLuint index, GLuint divisor); #endif #endif /* GL_EXT_direct_state_access */ @@ -6431,10 +7165,10 @@ GLAPI void APIENTRY glColorMaskIndexedEXT (GLuint index, GLboolean r, GLboolean #ifndef GL_EXT_draw_instanced #define GL_EXT_draw_instanced 1 typedef void (APIENTRYP PFNGLDRAWARRAYSINSTANCEDEXTPROC) (GLenum mode, GLint start, GLsizei count, GLsizei primcount); -typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDEXTPROC) (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLsizei primcount); +typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDEXTPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei primcount); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glDrawArraysInstancedEXT (GLenum mode, GLint start, GLsizei count, GLsizei primcount); -GLAPI void APIENTRY glDrawElementsInstancedEXT (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLsizei primcount); +GLAPI void APIENTRY glDrawElementsInstancedEXT (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei primcount); #endif #endif /* GL_EXT_draw_instanced */ @@ -6442,9 +7176,9 @@ GLAPI void APIENTRY glDrawElementsInstancedEXT (GLenum mode, GLsizei count, GLen #define GL_EXT_draw_range_elements 1 #define GL_MAX_ELEMENTS_VERTICES_EXT 0x80E8 #define GL_MAX_ELEMENTS_INDICES_EXT 0x80E9 -typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSEXTPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices); +typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSEXTPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glDrawRangeElementsEXT (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices); +GLAPI void APIENTRY glDrawRangeElementsEXT (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices); #endif #endif /* GL_EXT_draw_range_elements */ @@ -6462,13 +7196,13 @@ typedef void (APIENTRYP PFNGLFOGCOORDFEXTPROC) (GLfloat coord); typedef void (APIENTRYP PFNGLFOGCOORDFVEXTPROC) (const GLfloat *coord); typedef void (APIENTRYP PFNGLFOGCOORDDEXTPROC) (GLdouble coord); typedef void (APIENTRYP PFNGLFOGCOORDDVEXTPROC) (const GLdouble *coord); -typedef void (APIENTRYP PFNGLFOGCOORDPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLFOGCOORDPOINTEREXTPROC) (GLenum type, GLsizei stride, const void *pointer); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glFogCoordfEXT (GLfloat coord); GLAPI void APIENTRY glFogCoordfvEXT (const GLfloat *coord); GLAPI void APIENTRY glFogCoorddEXT (GLdouble coord); GLAPI void APIENTRY glFogCoorddvEXT (const GLdouble *coord); -GLAPI void APIENTRY glFogCoordPointerEXT (GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glFogCoordPointerEXT (GLenum type, GLsizei stride, const void *pointer); #endif #endif /* GL_EXT_fog_coord */ @@ -6708,10 +7442,10 @@ GLAPI void APIENTRY glUniform4uivEXT (GLint location, GLsizei count, const GLuin #define GL_MINMAX_FORMAT_EXT 0x802F #define GL_MINMAX_SINK_EXT 0x8030 #define GL_TABLE_TOO_LARGE_EXT 0x8031 -typedef void (APIENTRYP PFNGLGETHISTOGRAMEXTPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); +typedef void (APIENTRYP PFNGLGETHISTOGRAMEXTPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, void *values); typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETMINMAXEXTPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); +typedef void (APIENTRYP PFNGLGETMINMAXEXTPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, void *values); typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLHISTOGRAMEXTPROC) (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink); @@ -6719,10 +7453,10 @@ typedef void (APIENTRYP PFNGLMINMAXEXTPROC) (GLenum target, GLenum internalforma typedef void (APIENTRYP PFNGLRESETHISTOGRAMEXTPROC) (GLenum target); typedef void (APIENTRYP PFNGLRESETMINMAXEXTPROC) (GLenum target); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glGetHistogramEXT (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); +GLAPI void APIENTRY glGetHistogramEXT (GLenum target, GLboolean reset, GLenum format, GLenum type, void *values); GLAPI void APIENTRY glGetHistogramParameterfvEXT (GLenum target, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetHistogramParameterivEXT (GLenum target, GLenum pname, GLint *params); -GLAPI void APIENTRY glGetMinmaxEXT (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); +GLAPI void APIENTRY glGetMinmaxEXT (GLenum target, GLboolean reset, GLenum format, GLenum type, void *values); GLAPI void APIENTRY glGetMinmaxParameterfvEXT (GLenum target, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetMinmaxParameterivEXT (GLenum target, GLenum pname, GLint *params); GLAPI void APIENTRY glHistogramEXT (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink); @@ -6798,10 +7532,10 @@ GLAPI void APIENTRY glTextureMaterialEXT (GLenum face, GLenum mode); #ifndef GL_EXT_multi_draw_arrays #define GL_EXT_multi_draw_arrays 1 typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSEXTPROC) (GLenum mode, const GLint *first, const GLsizei *count, GLsizei primcount); -typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSEXTPROC) (GLenum mode, const GLsizei *count, GLenum type, const GLvoid *const*indices, GLsizei primcount); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSEXTPROC) (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei primcount); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glMultiDrawArraysEXT (GLenum mode, const GLint *first, const GLsizei *count, GLsizei primcount); -GLAPI void APIENTRY glMultiDrawElementsEXT (GLenum mode, const GLsizei *count, GLenum type, const GLvoid *const*indices, GLsizei primcount); +GLAPI void APIENTRY glMultiDrawElementsEXT (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei primcount); #endif #endif /* GL_EXT_multi_draw_arrays */ @@ -6865,13 +7599,13 @@ GLAPI void APIENTRY glSamplePatternEXT (GLenum pattern); #define GL_COLOR_INDEX12_EXT 0x80E6 #define GL_COLOR_INDEX16_EXT 0x80E7 #define GL_TEXTURE_INDEX_SIZE_EXT 0x80ED -typedef void (APIENTRYP PFNGLCOLORTABLEEXTPROC) (GLenum target, GLenum internalFormat, GLsizei width, GLenum format, GLenum type, const GLvoid *table); -typedef void (APIENTRYP PFNGLGETCOLORTABLEEXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *data); +typedef void (APIENTRYP PFNGLCOLORTABLEEXTPROC) (GLenum target, GLenum internalFormat, GLsizei width, GLenum format, GLenum type, const void *table); +typedef void (APIENTRYP PFNGLGETCOLORTABLEEXTPROC) (GLenum target, GLenum format, GLenum type, void *data); typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glColorTableEXT (GLenum target, GLenum internalFormat, GLsizei width, GLenum format, GLenum type, const GLvoid *table); -GLAPI void APIENTRY glGetColorTableEXT (GLenum target, GLenum format, GLenum type, GLvoid *data); +GLAPI void APIENTRY glColorTableEXT (GLenum target, GLenum internalFormat, GLsizei width, GLenum format, GLenum type, const void *table); +GLAPI void APIENTRY glGetColorTableEXT (GLenum target, GLenum format, GLenum type, void *data); GLAPI void APIENTRY glGetColorTableParameterivEXT (GLenum target, GLenum pname, GLint *params); GLAPI void APIENTRY glGetColorTableParameterfvEXT (GLenum target, GLenum pname, GLfloat *params); #endif @@ -6941,6 +7675,19 @@ GLAPI void APIENTRY glPolygonOffsetEXT (GLfloat factor, GLfloat bias); #endif #endif /* GL_EXT_polygon_offset */ +#ifndef GL_EXT_polygon_offset_clamp +#define GL_EXT_polygon_offset_clamp 1 +#define GL_POLYGON_OFFSET_CLAMP_EXT 0x8E1B +typedef void (APIENTRYP PFNGLPOLYGONOFFSETCLAMPEXTPROC) (GLfloat factor, GLfloat units, GLfloat clamp); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPolygonOffsetClampEXT (GLfloat factor, GLfloat units, GLfloat clamp); +#endif +#endif /* GL_EXT_polygon_offset_clamp */ + +#ifndef GL_EXT_post_depth_coverage +#define GL_EXT_post_depth_coverage 1 +#endif /* GL_EXT_post_depth_coverage */ + #ifndef GL_EXT_provoking_vertex #define GL_EXT_provoking_vertex 1 #define GL_QUADS_FOLLOW_PROVOKING_VERTEX_CONVENTION_EXT 0x8E4C @@ -6953,6 +7700,20 @@ GLAPI void APIENTRY glProvokingVertexEXT (GLenum mode); #endif #endif /* GL_EXT_provoking_vertex */ +#ifndef GL_EXT_raster_multisample +#define GL_EXT_raster_multisample 1 +#define GL_RASTER_MULTISAMPLE_EXT 0x9327 +#define GL_RASTER_SAMPLES_EXT 0x9328 +#define GL_MAX_RASTER_SAMPLES_EXT 0x9329 +#define GL_RASTER_FIXED_SAMPLE_LOCATIONS_EXT 0x932A +#define GL_MULTISAMPLE_RASTERIZATION_ALLOWED_EXT 0x932B +#define GL_EFFECTIVE_RASTER_SAMPLES_EXT 0x932C +typedef void (APIENTRYP PFNGLRASTERSAMPLESEXTPROC) (GLuint samples, GLboolean fixedsamplelocations); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glRasterSamplesEXT (GLuint samples, GLboolean fixedsamplelocations); +#endif +#endif /* GL_EXT_raster_multisample */ + #ifndef GL_EXT_rescale_normal #define GL_EXT_rescale_normal 1 #define GL_RESCALE_NORMAL_EXT 0x803A @@ -6983,7 +7744,7 @@ typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIEXTPROC) (GLuint red, GLuint green typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIVEXTPROC) (const GLuint *v); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USEXTPROC) (GLushort red, GLushort green, GLushort blue); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USVEXTPROC) (const GLushort *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, const void *pointer); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glSecondaryColor3bEXT (GLbyte red, GLbyte green, GLbyte blue); GLAPI void APIENTRY glSecondaryColor3bvEXT (const GLbyte *v); @@ -7001,7 +7762,7 @@ GLAPI void APIENTRY glSecondaryColor3uiEXT (GLuint red, GLuint green, GLuint blu GLAPI void APIENTRY glSecondaryColor3uivEXT (const GLuint *v); GLAPI void APIENTRY glSecondaryColor3usEXT (GLushort red, GLushort green, GLushort blue); GLAPI void APIENTRY glSecondaryColor3usvEXT (const GLushort *v); -GLAPI void APIENTRY glSecondaryColorPointerEXT (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glSecondaryColorPointerEXT (GLint size, GLenum type, GLsizei stride, const void *pointer); #endif #endif /* GL_EXT_secondary_color */ @@ -7025,6 +7786,10 @@ GLAPI GLuint APIENTRY glCreateShaderProgramEXT (GLenum type, const GLchar *strin #define GL_SEPARATE_SPECULAR_COLOR_EXT 0x81FA #endif /* GL_EXT_separate_specular_color */ +#ifndef GL_EXT_shader_image_load_formatted +#define GL_EXT_shader_image_load_formatted 1 +#endif /* GL_EXT_shader_image_load_formatted */ + #ifndef GL_EXT_shader_image_load_store #define GL_EXT_shader_image_load_store 1 #define GL_MAX_IMAGE_UNITS_EXT 0x8F38 @@ -7090,6 +7855,10 @@ GLAPI void APIENTRY glMemoryBarrierEXT (GLbitfield barriers); #endif #endif /* GL_EXT_shader_image_load_store */ +#ifndef GL_EXT_shader_integer_mix +#define GL_EXT_shader_integer_mix 1 +#endif /* GL_EXT_shader_integer_mix */ + #ifndef GL_EXT_shadow_funcs #define GL_EXT_shadow_funcs 1 #endif /* GL_EXT_shadow_funcs */ @@ -7099,6 +7868,10 @@ GLAPI void APIENTRY glMemoryBarrierEXT (GLbitfield barriers); #define GL_SHARED_TEXTURE_PALETTE_EXT 0x81FB #endif /* GL_EXT_shared_texture_palette */ +#ifndef GL_EXT_sparse_texture2 +#define GL_EXT_sparse_texture2 1 +#endif /* GL_EXT_sparse_texture2 */ + #ifndef GL_EXT_stencil_clear_tag #define GL_EXT_stencil_clear_tag 1 #define GL_STENCIL_TAG_BITS_EXT 0x88F2 @@ -7127,11 +7900,11 @@ GLAPI void APIENTRY glActiveStencilFaceEXT (GLenum face); #ifndef GL_EXT_subtexture #define GL_EXT_subtexture 1 -typedef void (APIENTRYP PFNGLTEXSUBIMAGE1DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLTEXSUBIMAGE2DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLTEXSUBIMAGE1DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXSUBIMAGE2DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glTexSubImage1DEXT (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const GLvoid *pixels); -GLAPI void APIENTRY glTexSubImage2DEXT (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *pixels); +GLAPI void APIENTRY glTexSubImage1DEXT (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTexSubImage2DEXT (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); #endif #endif /* GL_EXT_subtexture */ @@ -7193,11 +7966,11 @@ GLAPI void APIENTRY glTexSubImage2DEXT (GLenum target, GLint level, GLint xoffse #define GL_TEXTURE_DEPTH_EXT 0x8071 #define GL_TEXTURE_WRAP_R_EXT 0x8072 #define GL_MAX_3D_TEXTURE_SIZE_EXT 0x8073 -typedef void (APIENTRYP PFNGLTEXIMAGE3DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLTEXSUBIMAGE3DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLTEXIMAGE3DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXSUBIMAGE3DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glTexImage3DEXT (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -GLAPI void APIENTRY glTexSubImage3DEXT (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); +GLAPI void APIENTRY glTexImage3DEXT (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTexSubImage3DEXT (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); #endif #endif /* GL_EXT_texture3D */ @@ -7211,6 +7984,10 @@ GLAPI void APIENTRY glTexSubImage3DEXT (GLenum target, GLint level, GLint xoffse #define GL_TEXTURE_BINDING_2D_ARRAY_EXT 0x8C1D #define GL_MAX_ARRAY_TEXTURE_LAYERS_EXT 0x88FF #define GL_COMPARE_REF_DEPTH_TO_TEXTURE_EXT 0x884E +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURELAYEREXTPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint layer); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFramebufferTextureLayerEXT (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint layer); +#endif #endif /* GL_EXT_texture_array */ #ifndef GL_EXT_texture_buffer_object @@ -7307,6 +8084,10 @@ GLAPI void APIENTRY glTexBufferEXT (GLenum target, GLenum internalformat, GLuint #define GL_MAX_TEXTURE_MAX_ANISOTROPY_EXT 0x84FF #endif /* GL_EXT_texture_filter_anisotropic */ +#ifndef GL_EXT_texture_filter_minmax +#define GL_EXT_texture_filter_minmax 1 +#endif /* GL_EXT_texture_filter_minmax */ + #ifndef GL_EXT_texture_integer #define GL_EXT_texture_integer 1 #define GL_RGBA32UI_EXT 0x8D70 @@ -7563,24 +8344,24 @@ GLAPI void APIENTRY glGetTransformFeedbackVaryingEXT (GLuint program, GLuint ind #define GL_TEXTURE_COORD_ARRAY_POINTER_EXT 0x8092 #define GL_EDGE_FLAG_ARRAY_POINTER_EXT 0x8093 typedef void (APIENTRYP PFNGLARRAYELEMENTEXTPROC) (GLint i); -typedef void (APIENTRYP PFNGLCOLORPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLCOLORPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const void *pointer); typedef void (APIENTRYP PFNGLDRAWARRAYSEXTPROC) (GLenum mode, GLint first, GLsizei count); typedef void (APIENTRYP PFNGLEDGEFLAGPOINTEREXTPROC) (GLsizei stride, GLsizei count, const GLboolean *pointer); -typedef void (APIENTRYP PFNGLGETPOINTERVEXTPROC) (GLenum pname, GLvoid **params); -typedef void (APIENTRYP PFNGLINDEXPOINTEREXTPROC) (GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLNORMALPOINTEREXTPROC) (GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLTEXCOORDPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLVERTEXPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLGETPOINTERVEXTPROC) (GLenum pname, void **params); +typedef void (APIENTRYP PFNGLINDEXPOINTEREXTPROC) (GLenum type, GLsizei stride, GLsizei count, const void *pointer); +typedef void (APIENTRYP PFNGLNORMALPOINTEREXTPROC) (GLenum type, GLsizei stride, GLsizei count, const void *pointer); +typedef void (APIENTRYP PFNGLTEXCOORDPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const void *pointer); +typedef void (APIENTRYP PFNGLVERTEXPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const void *pointer); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glArrayElementEXT (GLint i); -GLAPI void APIENTRY glColorPointerEXT (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); +GLAPI void APIENTRY glColorPointerEXT (GLint size, GLenum type, GLsizei stride, GLsizei count, const void *pointer); GLAPI void APIENTRY glDrawArraysEXT (GLenum mode, GLint first, GLsizei count); GLAPI void APIENTRY glEdgeFlagPointerEXT (GLsizei stride, GLsizei count, const GLboolean *pointer); -GLAPI void APIENTRY glGetPointervEXT (GLenum pname, GLvoid **params); -GLAPI void APIENTRY glIndexPointerEXT (GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); -GLAPI void APIENTRY glNormalPointerEXT (GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); -GLAPI void APIENTRY glTexCoordPointerEXT (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); -GLAPI void APIENTRY glVertexPointerEXT (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); +GLAPI void APIENTRY glGetPointervEXT (GLenum pname, void **params); +GLAPI void APIENTRY glIndexPointerEXT (GLenum type, GLsizei stride, GLsizei count, const void *pointer); +GLAPI void APIENTRY glNormalPointerEXT (GLenum type, GLsizei stride, GLsizei count, const void *pointer); +GLAPI void APIENTRY glTexCoordPointerEXT (GLint size, GLenum type, GLsizei stride, GLsizei count, const void *pointer); +GLAPI void APIENTRY glVertexPointerEXT (GLint size, GLenum type, GLsizei stride, GLsizei count, const void *pointer); #endif #endif /* GL_EXT_vertex_array */ @@ -7610,7 +8391,7 @@ typedef void (APIENTRYP PFNGLVERTEXATTRIBL1DVEXTPROC) (GLuint index, const GLdou typedef void (APIENTRYP PFNGLVERTEXATTRIBL2DVEXTPROC) (GLuint index, const GLdouble *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBL3DVEXTPROC) (GLuint index, const GLdouble *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBL4DVEXTPROC) (GLuint index, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBLPOINTEREXTPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLVERTEXATTRIBLPOINTEREXTPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const void *pointer); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBLDVEXTPROC) (GLuint index, GLenum pname, GLdouble *params); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glVertexAttribL1dEXT (GLuint index, GLdouble x); @@ -7621,7 +8402,7 @@ GLAPI void APIENTRY glVertexAttribL1dvEXT (GLuint index, const GLdouble *v); GLAPI void APIENTRY glVertexAttribL2dvEXT (GLuint index, const GLdouble *v); GLAPI void APIENTRY glVertexAttribL3dvEXT (GLuint index, const GLdouble *v); GLAPI void APIENTRY glVertexAttribL4dvEXT (GLuint index, const GLdouble *v); -GLAPI void APIENTRY glVertexAttribLPointerEXT (GLuint index, GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glVertexAttribLPointerEXT (GLuint index, GLint size, GLenum type, GLsizei stride, const void *pointer); GLAPI void APIENTRY glGetVertexAttribLdvEXT (GLuint index, GLenum pname, GLdouble *params); #endif #endif /* GL_EXT_vertex_attrib_64bit */ @@ -7751,8 +8532,8 @@ typedef void (APIENTRYP PFNGLWRITEMASKEXTPROC) (GLuint res, GLuint in, GLenum ou typedef void (APIENTRYP PFNGLINSERTCOMPONENTEXTPROC) (GLuint res, GLuint src, GLuint num); typedef void (APIENTRYP PFNGLEXTRACTCOMPONENTEXTPROC) (GLuint res, GLuint src, GLuint num); typedef GLuint (APIENTRYP PFNGLGENSYMBOLSEXTPROC) (GLenum datatype, GLenum storagetype, GLenum range, GLuint components); -typedef void (APIENTRYP PFNGLSETINVARIANTEXTPROC) (GLuint id, GLenum type, const GLvoid *addr); -typedef void (APIENTRYP PFNGLSETLOCALCONSTANTEXTPROC) (GLuint id, GLenum type, const GLvoid *addr); +typedef void (APIENTRYP PFNGLSETINVARIANTEXTPROC) (GLuint id, GLenum type, const void *addr); +typedef void (APIENTRYP PFNGLSETLOCALCONSTANTEXTPROC) (GLuint id, GLenum type, const void *addr); typedef void (APIENTRYP PFNGLVARIANTBVEXTPROC) (GLuint id, const GLbyte *addr); typedef void (APIENTRYP PFNGLVARIANTSVEXTPROC) (GLuint id, const GLshort *addr); typedef void (APIENTRYP PFNGLVARIANTIVEXTPROC) (GLuint id, const GLint *addr); @@ -7761,7 +8542,7 @@ typedef void (APIENTRYP PFNGLVARIANTDVEXTPROC) (GLuint id, const GLdouble *addr) typedef void (APIENTRYP PFNGLVARIANTUBVEXTPROC) (GLuint id, const GLubyte *addr); typedef void (APIENTRYP PFNGLVARIANTUSVEXTPROC) (GLuint id, const GLushort *addr); typedef void (APIENTRYP PFNGLVARIANTUIVEXTPROC) (GLuint id, const GLuint *addr); -typedef void (APIENTRYP PFNGLVARIANTPOINTEREXTPROC) (GLuint id, GLenum type, GLuint stride, const GLvoid *addr); +typedef void (APIENTRYP PFNGLVARIANTPOINTEREXTPROC) (GLuint id, GLenum type, GLuint stride, const void *addr); typedef void (APIENTRYP PFNGLENABLEVARIANTCLIENTSTATEEXTPROC) (GLuint id); typedef void (APIENTRYP PFNGLDISABLEVARIANTCLIENTSTATEEXTPROC) (GLuint id); typedef GLuint (APIENTRYP PFNGLBINDLIGHTPARAMETEREXTPROC) (GLenum light, GLenum value); @@ -7773,7 +8554,7 @@ typedef GLboolean (APIENTRYP PFNGLISVARIANTENABLEDEXTPROC) (GLuint id, GLenum ca typedef void (APIENTRYP PFNGLGETVARIANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data); typedef void (APIENTRYP PFNGLGETVARIANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data); typedef void (APIENTRYP PFNGLGETVARIANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data); -typedef void (APIENTRYP PFNGLGETVARIANTPOINTERVEXTPROC) (GLuint id, GLenum value, GLvoid **data); +typedef void (APIENTRYP PFNGLGETVARIANTPOINTERVEXTPROC) (GLuint id, GLenum value, void **data); typedef void (APIENTRYP PFNGLGETINVARIANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data); typedef void (APIENTRYP PFNGLGETINVARIANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data); typedef void (APIENTRYP PFNGLGETINVARIANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data); @@ -7794,8 +8575,8 @@ GLAPI void APIENTRY glWriteMaskEXT (GLuint res, GLuint in, GLenum outX, GLenum o GLAPI void APIENTRY glInsertComponentEXT (GLuint res, GLuint src, GLuint num); GLAPI void APIENTRY glExtractComponentEXT (GLuint res, GLuint src, GLuint num); GLAPI GLuint APIENTRY glGenSymbolsEXT (GLenum datatype, GLenum storagetype, GLenum range, GLuint components); -GLAPI void APIENTRY glSetInvariantEXT (GLuint id, GLenum type, const GLvoid *addr); -GLAPI void APIENTRY glSetLocalConstantEXT (GLuint id, GLenum type, const GLvoid *addr); +GLAPI void APIENTRY glSetInvariantEXT (GLuint id, GLenum type, const void *addr); +GLAPI void APIENTRY glSetLocalConstantEXT (GLuint id, GLenum type, const void *addr); GLAPI void APIENTRY glVariantbvEXT (GLuint id, const GLbyte *addr); GLAPI void APIENTRY glVariantsvEXT (GLuint id, const GLshort *addr); GLAPI void APIENTRY glVariantivEXT (GLuint id, const GLint *addr); @@ -7804,7 +8585,7 @@ GLAPI void APIENTRY glVariantdvEXT (GLuint id, const GLdouble *addr); GLAPI void APIENTRY glVariantubvEXT (GLuint id, const GLubyte *addr); GLAPI void APIENTRY glVariantusvEXT (GLuint id, const GLushort *addr); GLAPI void APIENTRY glVariantuivEXT (GLuint id, const GLuint *addr); -GLAPI void APIENTRY glVariantPointerEXT (GLuint id, GLenum type, GLuint stride, const GLvoid *addr); +GLAPI void APIENTRY glVariantPointerEXT (GLuint id, GLenum type, GLuint stride, const void *addr); GLAPI void APIENTRY glEnableVariantClientStateEXT (GLuint id); GLAPI void APIENTRY glDisableVariantClientStateEXT (GLuint id); GLAPI GLuint APIENTRY glBindLightParameterEXT (GLenum light, GLenum value); @@ -7816,7 +8597,7 @@ GLAPI GLboolean APIENTRY glIsVariantEnabledEXT (GLuint id, GLenum cap); GLAPI void APIENTRY glGetVariantBooleanvEXT (GLuint id, GLenum value, GLboolean *data); GLAPI void APIENTRY glGetVariantIntegervEXT (GLuint id, GLenum value, GLint *data); GLAPI void APIENTRY glGetVariantFloatvEXT (GLuint id, GLenum value, GLfloat *data); -GLAPI void APIENTRY glGetVariantPointervEXT (GLuint id, GLenum value, GLvoid **data); +GLAPI void APIENTRY glGetVariantPointervEXT (GLuint id, GLenum value, void **data); GLAPI void APIENTRY glGetInvariantBooleanvEXT (GLuint id, GLenum value, GLboolean *data); GLAPI void APIENTRY glGetInvariantIntegervEXT (GLuint id, GLenum value, GLint *data); GLAPI void APIENTRY glGetInvariantFloatvEXT (GLuint id, GLenum value, GLfloat *data); @@ -7843,11 +8624,11 @@ GLAPI void APIENTRY glGetLocalConstantFloatvEXT (GLuint id, GLenum value, GLfloa #define GL_VERTEX_WEIGHT_ARRAY_POINTER_EXT 0x8510 typedef void (APIENTRYP PFNGLVERTEXWEIGHTFEXTPROC) (GLfloat weight); typedef void (APIENTRYP PFNGLVERTEXWEIGHTFVEXTPROC) (const GLfloat *weight); -typedef void (APIENTRYP PFNGLVERTEXWEIGHTPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLVERTEXWEIGHTPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, const void *pointer); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glVertexWeightfEXT (GLfloat weight); GLAPI void APIENTRY glVertexWeightfvEXT (const GLfloat *weight); -GLAPI void APIENTRY glVertexWeightPointerEXT (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glVertexWeightPointerEXT (GLint size, GLenum type, GLsizei stride, const void *pointer); #endif #endif /* GL_EXT_vertex_weighting */ @@ -7870,9 +8651,9 @@ GLAPI void APIENTRY glFrameTerminatorGREMEDY (void); #ifndef GL_GREMEDY_string_marker #define GL_GREMEDY_string_marker 1 -typedef void (APIENTRYP PFNGLSTRINGMARKERGREMEDYPROC) (GLsizei len, const GLvoid *string); +typedef void (APIENTRYP PFNGLSTRINGMARKERGREMEDYPROC) (GLsizei len, const void *string); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glStringMarkerGREMEDY (GLsizei len, const GLvoid *string); +GLAPI void APIENTRY glStringMarkerGREMEDY (GLsizei len, const void *string); #endif #endif /* GL_GREMEDY_string_marker */ @@ -7938,10 +8719,10 @@ GLAPI void APIENTRY glGetImageTransformParameterfvHP (GLenum target, GLenum pnam #ifndef GL_IBM_multimode_draw_arrays #define GL_IBM_multimode_draw_arrays 1 typedef void (APIENTRYP PFNGLMULTIMODEDRAWARRAYSIBMPROC) (const GLenum *mode, const GLint *first, const GLsizei *count, GLsizei primcount, GLint modestride); -typedef void (APIENTRYP PFNGLMULTIMODEDRAWELEMENTSIBMPROC) (const GLenum *mode, const GLsizei *count, GLenum type, const GLvoid *const*indices, GLsizei primcount, GLint modestride); +typedef void (APIENTRYP PFNGLMULTIMODEDRAWELEMENTSIBMPROC) (const GLenum *mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei primcount, GLint modestride); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glMultiModeDrawArraysIBM (const GLenum *mode, const GLint *first, const GLsizei *count, GLsizei primcount, GLint modestride); -GLAPI void APIENTRY glMultiModeDrawElementsIBM (const GLenum *mode, const GLsizei *count, GLenum type, const GLvoid *const*indices, GLsizei primcount, GLint modestride); +GLAPI void APIENTRY glMultiModeDrawElementsIBM (const GLenum *mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei primcount, GLint modestride); #endif #endif /* GL_IBM_multimode_draw_arrays */ @@ -7983,23 +8764,23 @@ GLAPI void APIENTRY glFlushStaticDataIBM (GLenum target); #define GL_EDGE_FLAG_ARRAY_LIST_STRIDE_IBM 103085 #define GL_FOG_COORDINATE_ARRAY_LIST_STRIDE_IBM 103086 #define GL_SECONDARY_COLOR_ARRAY_LIST_STRIDE_IBM 103087 -typedef void (APIENTRYP PFNGLCOLORPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid **pointer, GLint ptrstride); -typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid **pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLCOLORPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const void **pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const void **pointer, GLint ptrstride); typedef void (APIENTRYP PFNGLEDGEFLAGPOINTERLISTIBMPROC) (GLint stride, const GLboolean **pointer, GLint ptrstride); -typedef void (APIENTRYP PFNGLFOGCOORDPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid **pointer, GLint ptrstride); -typedef void (APIENTRYP PFNGLINDEXPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid **pointer, GLint ptrstride); -typedef void (APIENTRYP PFNGLNORMALPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid **pointer, GLint ptrstride); -typedef void (APIENTRYP PFNGLTEXCOORDPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid **pointer, GLint ptrstride); -typedef void (APIENTRYP PFNGLVERTEXPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid **pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLFOGCOORDPOINTERLISTIBMPROC) (GLenum type, GLint stride, const void **pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLINDEXPOINTERLISTIBMPROC) (GLenum type, GLint stride, const void **pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLNORMALPOINTERLISTIBMPROC) (GLenum type, GLint stride, const void **pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLTEXCOORDPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const void **pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLVERTEXPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const void **pointer, GLint ptrstride); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glColorPointerListIBM (GLint size, GLenum type, GLint stride, const GLvoid **pointer, GLint ptrstride); -GLAPI void APIENTRY glSecondaryColorPointerListIBM (GLint size, GLenum type, GLint stride, const GLvoid **pointer, GLint ptrstride); +GLAPI void APIENTRY glColorPointerListIBM (GLint size, GLenum type, GLint stride, const void **pointer, GLint ptrstride); +GLAPI void APIENTRY glSecondaryColorPointerListIBM (GLint size, GLenum type, GLint stride, const void **pointer, GLint ptrstride); GLAPI void APIENTRY glEdgeFlagPointerListIBM (GLint stride, const GLboolean **pointer, GLint ptrstride); -GLAPI void APIENTRY glFogCoordPointerListIBM (GLenum type, GLint stride, const GLvoid **pointer, GLint ptrstride); -GLAPI void APIENTRY glIndexPointerListIBM (GLenum type, GLint stride, const GLvoid **pointer, GLint ptrstride); -GLAPI void APIENTRY glNormalPointerListIBM (GLenum type, GLint stride, const GLvoid **pointer, GLint ptrstride); -GLAPI void APIENTRY glTexCoordPointerListIBM (GLint size, GLenum type, GLint stride, const GLvoid **pointer, GLint ptrstride); -GLAPI void APIENTRY glVertexPointerListIBM (GLint size, GLenum type, GLint stride, const GLvoid **pointer, GLint ptrstride); +GLAPI void APIENTRY glFogCoordPointerListIBM (GLenum type, GLint stride, const void **pointer, GLint ptrstride); +GLAPI void APIENTRY glIndexPointerListIBM (GLenum type, GLint stride, const void **pointer, GLint ptrstride); +GLAPI void APIENTRY glNormalPointerListIBM (GLenum type, GLint stride, const void **pointer, GLint ptrstride); +GLAPI void APIENTRY glTexCoordPointerListIBM (GLint size, GLenum type, GLint stride, const void **pointer, GLint ptrstride); +GLAPI void APIENTRY glVertexPointerListIBM (GLint size, GLenum type, GLint stride, const void **pointer, GLint ptrstride); #endif #endif /* GL_IBM_vertex_array_lists */ @@ -8028,6 +8809,18 @@ GLAPI void APIENTRY glBlendFuncSeparateINGR (GLenum sfactorRGB, GLenum dfactorRG #define GL_INTERLACE_READ_INGR 0x8568 #endif /* GL_INGR_interlace_read */ +#ifndef GL_INTEL_fragment_shader_ordering +#define GL_INTEL_fragment_shader_ordering 1 +#endif /* GL_INTEL_fragment_shader_ordering */ + +#ifndef GL_INTEL_framebuffer_CMAA +#define GL_INTEL_framebuffer_CMAA 1 +typedef void (APIENTRYP PFNGLAPPLYFRAMEBUFFERATTACHMENTCMAAINTELPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glApplyFramebufferAttachmentCMAAINTEL (void); +#endif +#endif /* GL_INTEL_framebuffer_CMAA */ + #ifndef GL_INTEL_map_texture #define GL_INTEL_map_texture 1 #define GL_TEXTURE_MEMORY_LAYOUT_INTEL 0x83FF @@ -8036,11 +8829,11 @@ GLAPI void APIENTRY glBlendFuncSeparateINGR (GLenum sfactorRGB, GLenum dfactorRG #define GL_LAYOUT_LINEAR_CPU_CACHED_INTEL 2 typedef void (APIENTRYP PFNGLSYNCTEXTUREINTELPROC) (GLuint texture); typedef void (APIENTRYP PFNGLUNMAPTEXTURE2DINTELPROC) (GLuint texture, GLint level); -typedef void *(APIENTRYP PFNGLMAPTEXTURE2DINTELPROC) (GLuint texture, GLint level, GLbitfield access, const GLint *stride, const GLenum *layout); +typedef void *(APIENTRYP PFNGLMAPTEXTURE2DINTELPROC) (GLuint texture, GLint level, GLbitfield access, GLint *stride, GLenum *layout); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glSyncTextureINTEL (GLuint texture); GLAPI void APIENTRY glUnmapTexture2DINTEL (GLuint texture, GLint level); -GLAPI void *APIENTRY glMapTexture2DINTEL (GLuint texture, GLint level, GLbitfield access, const GLint *stride, const GLenum *layout); +GLAPI void *APIENTRY glMapTexture2DINTEL (GLuint texture, GLint level, GLbitfield access, GLint *stride, GLenum *layout); #endif #endif /* GL_INTEL_map_texture */ @@ -8051,18 +8844,64 @@ GLAPI void *APIENTRY glMapTexture2DINTEL (GLuint texture, GLint level, GLbitfiel #define GL_NORMAL_ARRAY_PARALLEL_POINTERS_INTEL 0x83F6 #define GL_COLOR_ARRAY_PARALLEL_POINTERS_INTEL 0x83F7 #define GL_TEXTURE_COORD_ARRAY_PARALLEL_POINTERS_INTEL 0x83F8 -typedef void (APIENTRYP PFNGLVERTEXPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid **pointer); -typedef void (APIENTRYP PFNGLNORMALPOINTERVINTELPROC) (GLenum type, const GLvoid **pointer); -typedef void (APIENTRYP PFNGLCOLORPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid **pointer); -typedef void (APIENTRYP PFNGLTEXCOORDPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid **pointer); +typedef void (APIENTRYP PFNGLVERTEXPOINTERVINTELPROC) (GLint size, GLenum type, const void **pointer); +typedef void (APIENTRYP PFNGLNORMALPOINTERVINTELPROC) (GLenum type, const void **pointer); +typedef void (APIENTRYP PFNGLCOLORPOINTERVINTELPROC) (GLint size, GLenum type, const void **pointer); +typedef void (APIENTRYP PFNGLTEXCOORDPOINTERVINTELPROC) (GLint size, GLenum type, const void **pointer); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glVertexPointervINTEL (GLint size, GLenum type, const GLvoid **pointer); -GLAPI void APIENTRY glNormalPointervINTEL (GLenum type, const GLvoid **pointer); -GLAPI void APIENTRY glColorPointervINTEL (GLint size, GLenum type, const GLvoid **pointer); -GLAPI void APIENTRY glTexCoordPointervINTEL (GLint size, GLenum type, const GLvoid **pointer); +GLAPI void APIENTRY glVertexPointervINTEL (GLint size, GLenum type, const void **pointer); +GLAPI void APIENTRY glNormalPointervINTEL (GLenum type, const void **pointer); +GLAPI void APIENTRY glColorPointervINTEL (GLint size, GLenum type, const void **pointer); +GLAPI void APIENTRY glTexCoordPointervINTEL (GLint size, GLenum type, const void **pointer); #endif #endif /* GL_INTEL_parallel_arrays */ +#ifndef GL_INTEL_performance_query +#define GL_INTEL_performance_query 1 +#define GL_PERFQUERY_SINGLE_CONTEXT_INTEL 0x00000000 +#define GL_PERFQUERY_GLOBAL_CONTEXT_INTEL 0x00000001 +#define GL_PERFQUERY_WAIT_INTEL 0x83FB +#define GL_PERFQUERY_FLUSH_INTEL 0x83FA +#define GL_PERFQUERY_DONOT_FLUSH_INTEL 0x83F9 +#define GL_PERFQUERY_COUNTER_EVENT_INTEL 0x94F0 +#define GL_PERFQUERY_COUNTER_DURATION_NORM_INTEL 0x94F1 +#define GL_PERFQUERY_COUNTER_DURATION_RAW_INTEL 0x94F2 +#define GL_PERFQUERY_COUNTER_THROUGHPUT_INTEL 0x94F3 +#define GL_PERFQUERY_COUNTER_RAW_INTEL 0x94F4 +#define GL_PERFQUERY_COUNTER_TIMESTAMP_INTEL 0x94F5 +#define GL_PERFQUERY_COUNTER_DATA_UINT32_INTEL 0x94F8 +#define GL_PERFQUERY_COUNTER_DATA_UINT64_INTEL 0x94F9 +#define GL_PERFQUERY_COUNTER_DATA_FLOAT_INTEL 0x94FA +#define GL_PERFQUERY_COUNTER_DATA_DOUBLE_INTEL 0x94FB +#define GL_PERFQUERY_COUNTER_DATA_BOOL32_INTEL 0x94FC +#define GL_PERFQUERY_QUERY_NAME_LENGTH_MAX_INTEL 0x94FD +#define GL_PERFQUERY_COUNTER_NAME_LENGTH_MAX_INTEL 0x94FE +#define GL_PERFQUERY_COUNTER_DESC_LENGTH_MAX_INTEL 0x94FF +#define GL_PERFQUERY_GPA_EXTENDED_COUNTERS_INTEL 0x9500 +typedef void (APIENTRYP PFNGLBEGINPERFQUERYINTELPROC) (GLuint queryHandle); +typedef void (APIENTRYP PFNGLCREATEPERFQUERYINTELPROC) (GLuint queryId, GLuint *queryHandle); +typedef void (APIENTRYP PFNGLDELETEPERFQUERYINTELPROC) (GLuint queryHandle); +typedef void (APIENTRYP PFNGLENDPERFQUERYINTELPROC) (GLuint queryHandle); +typedef void (APIENTRYP PFNGLGETFIRSTPERFQUERYIDINTELPROC) (GLuint *queryId); +typedef void (APIENTRYP PFNGLGETNEXTPERFQUERYIDINTELPROC) (GLuint queryId, GLuint *nextQueryId); +typedef void (APIENTRYP PFNGLGETPERFCOUNTERINFOINTELPROC) (GLuint queryId, GLuint counterId, GLuint counterNameLength, GLchar *counterName, GLuint counterDescLength, GLchar *counterDesc, GLuint *counterOffset, GLuint *counterDataSize, GLuint *counterTypeEnum, GLuint *counterDataTypeEnum, GLuint64 *rawCounterMaxValue); +typedef void (APIENTRYP PFNGLGETPERFQUERYDATAINTELPROC) (GLuint queryHandle, GLuint flags, GLsizei dataSize, GLvoid *data, GLuint *bytesWritten); +typedef void (APIENTRYP PFNGLGETPERFQUERYIDBYNAMEINTELPROC) (GLchar *queryName, GLuint *queryId); +typedef void (APIENTRYP PFNGLGETPERFQUERYINFOINTELPROC) (GLuint queryId, GLuint queryNameLength, GLchar *queryName, GLuint *dataSize, GLuint *noCounters, GLuint *noInstances, GLuint *capsMask); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBeginPerfQueryINTEL (GLuint queryHandle); +GLAPI void APIENTRY glCreatePerfQueryINTEL (GLuint queryId, GLuint *queryHandle); +GLAPI void APIENTRY glDeletePerfQueryINTEL (GLuint queryHandle); +GLAPI void APIENTRY glEndPerfQueryINTEL (GLuint queryHandle); +GLAPI void APIENTRY glGetFirstPerfQueryIdINTEL (GLuint *queryId); +GLAPI void APIENTRY glGetNextPerfQueryIdINTEL (GLuint queryId, GLuint *nextQueryId); +GLAPI void APIENTRY glGetPerfCounterInfoINTEL (GLuint queryId, GLuint counterId, GLuint counterNameLength, GLchar *counterName, GLuint counterDescLength, GLchar *counterDesc, GLuint *counterOffset, GLuint *counterDataSize, GLuint *counterTypeEnum, GLuint *counterDataTypeEnum, GLuint64 *rawCounterMaxValue); +GLAPI void APIENTRY glGetPerfQueryDataINTEL (GLuint queryHandle, GLuint flags, GLsizei dataSize, GLvoid *data, GLuint *bytesWritten); +GLAPI void APIENTRY glGetPerfQueryIdByNameINTEL (GLchar *queryName, GLuint *queryId); +GLAPI void APIENTRY glGetPerfQueryInfoINTEL (GLuint queryId, GLuint queryNameLength, GLchar *queryName, GLuint *dataSize, GLuint *noCounters, GLuint *noInstances, GLuint *capsMask); +#endif +#endif /* GL_INTEL_performance_query */ + #ifndef GL_MESAX_texture_stack #define GL_MESAX_texture_stack 1 #define GL_TEXTURE_1D_STACK_MESAX 0x8759 @@ -8157,16 +8996,35 @@ GLAPI void APIENTRY glEndConditionalRenderNVX (void); #endif #endif /* GL_NVX_conditional_render */ +#ifndef GL_NVX_gpu_memory_info +#define GL_NVX_gpu_memory_info 1 +#define GL_GPU_MEMORY_INFO_DEDICATED_VIDMEM_NVX 0x9047 +#define GL_GPU_MEMORY_INFO_TOTAL_AVAILABLE_MEMORY_NVX 0x9048 +#define GL_GPU_MEMORY_INFO_CURRENT_AVAILABLE_VIDMEM_NVX 0x9049 +#define GL_GPU_MEMORY_INFO_EVICTION_COUNT_NVX 0x904A +#define GL_GPU_MEMORY_INFO_EVICTED_MEMORY_NVX 0x904B +#endif /* GL_NVX_gpu_memory_info */ + #ifndef GL_NV_bindless_multi_draw_indirect #define GL_NV_bindless_multi_draw_indirect 1 -typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSINDIRECTBINDLESSNVPROC) (GLenum mode, const GLvoid *indirect, GLsizei drawCount, GLsizei stride, GLint vertexBufferCount); -typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTBINDLESSNVPROC) (GLenum mode, GLenum type, const GLvoid *indirect, GLsizei drawCount, GLsizei stride, GLint vertexBufferCount); +typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSINDIRECTBINDLESSNVPROC) (GLenum mode, const void *indirect, GLsizei drawCount, GLsizei stride, GLint vertexBufferCount); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTBINDLESSNVPROC) (GLenum mode, GLenum type, const void *indirect, GLsizei drawCount, GLsizei stride, GLint vertexBufferCount); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glMultiDrawArraysIndirectBindlessNV (GLenum mode, const GLvoid *indirect, GLsizei drawCount, GLsizei stride, GLint vertexBufferCount); -GLAPI void APIENTRY glMultiDrawElementsIndirectBindlessNV (GLenum mode, GLenum type, const GLvoid *indirect, GLsizei drawCount, GLsizei stride, GLint vertexBufferCount); +GLAPI void APIENTRY glMultiDrawArraysIndirectBindlessNV (GLenum mode, const void *indirect, GLsizei drawCount, GLsizei stride, GLint vertexBufferCount); +GLAPI void APIENTRY glMultiDrawElementsIndirectBindlessNV (GLenum mode, GLenum type, const void *indirect, GLsizei drawCount, GLsizei stride, GLint vertexBufferCount); #endif #endif /* GL_NV_bindless_multi_draw_indirect */ +#ifndef GL_NV_bindless_multi_draw_indirect_count +#define GL_NV_bindless_multi_draw_indirect_count 1 +typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSINDIRECTBINDLESSCOUNTNVPROC) (GLenum mode, const void *indirect, GLsizei drawCount, GLsizei maxDrawCount, GLsizei stride, GLint vertexBufferCount); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTBINDLESSCOUNTNVPROC) (GLenum mode, GLenum type, const void *indirect, GLsizei drawCount, GLsizei maxDrawCount, GLsizei stride, GLint vertexBufferCount); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMultiDrawArraysIndirectBindlessCountNV (GLenum mode, const void *indirect, GLsizei drawCount, GLsizei maxDrawCount, GLsizei stride, GLint vertexBufferCount); +GLAPI void APIENTRY glMultiDrawElementsIndirectBindlessCountNV (GLenum mode, GLenum type, const void *indirect, GLsizei drawCount, GLsizei maxDrawCount, GLsizei stride, GLint vertexBufferCount); +#endif +#endif /* GL_NV_bindless_multi_draw_indirect_count */ + #ifndef GL_NV_bindless_texture #define GL_NV_bindless_texture 1 typedef GLuint64 (APIENTRYP PFNGLGETTEXTUREHANDLENVPROC) (GLuint texture); @@ -8201,9 +9059,9 @@ GLAPI GLboolean APIENTRY glIsImageHandleResidentNV (GLuint64 handle); #ifndef GL_NV_blend_equation_advanced #define GL_NV_blend_equation_advanced 1 -#define GL_BLEND_ADVANCED_COHERENT_NV 0x9285 #define GL_BLEND_OVERLAP_NV 0x9281 #define GL_BLEND_PREMULTIPLIED_SRC_NV 0x9280 +#define GL_BLUE_NV 0x1905 #define GL_COLORBURN_NV 0x929A #define GL_COLORDODGE_NV 0x9299 #define GL_CONJOINT_NV 0x9284 @@ -8217,6 +9075,7 @@ GLAPI GLboolean APIENTRY glIsImageHandleResidentNV (GLuint64 handle); #define GL_DST_OUT_NV 0x928D #define GL_DST_OVER_NV 0x9289 #define GL_EXCLUSION_NV 0x92A0 +#define GL_GREEN_NV 0x1904 #define GL_HARDLIGHT_NV 0x929B #define GL_HARDMIX_NV 0x92A9 #define GL_HSL_COLOR_NV 0x92AF @@ -8238,6 +9097,7 @@ GLAPI GLboolean APIENTRY glIsImageHandleResidentNV (GLuint64 handle); #define GL_PLUS_CLAMPED_NV 0x92B1 #define GL_PLUS_DARKER_NV 0x9292 #define GL_PLUS_NV 0x9291 +#define GL_RED_NV 0x1903 #define GL_SCREEN_NV 0x9295 #define GL_SOFTLIGHT_NV 0x929C #define GL_SRC_ATOP_NV 0x928E @@ -8247,6 +9107,7 @@ GLAPI GLboolean APIENTRY glIsImageHandleResidentNV (GLuint64 handle); #define GL_SRC_OVER_NV 0x9288 #define GL_UNCORRELATED_NV 0x9282 #define GL_VIVIDLIGHT_NV 0x92A6 +#define GL_XOR_NV 0x1506 typedef void (APIENTRYP PFNGLBLENDPARAMETERINVPROC) (GLenum pname, GLint value); typedef void (APIENTRYP PFNGLBLENDBARRIERNVPROC) (void); #ifdef GL_GLEXT_PROTOTYPES @@ -8257,12 +9118,72 @@ GLAPI void APIENTRY glBlendBarrierNV (void); #ifndef GL_NV_blend_equation_advanced_coherent #define GL_NV_blend_equation_advanced_coherent 1 +#define GL_BLEND_ADVANCED_COHERENT_NV 0x9285 #endif /* GL_NV_blend_equation_advanced_coherent */ #ifndef GL_NV_blend_square #define GL_NV_blend_square 1 #endif /* GL_NV_blend_square */ +#ifndef GL_NV_command_list +#define GL_NV_command_list 1 +#define GL_TERMINATE_SEQUENCE_COMMAND_NV 0x0000 +#define GL_NOP_COMMAND_NV 0x0001 +#define GL_DRAW_ELEMENTS_COMMAND_NV 0x0002 +#define GL_DRAW_ARRAYS_COMMAND_NV 0x0003 +#define GL_DRAW_ELEMENTS_STRIP_COMMAND_NV 0x0004 +#define GL_DRAW_ARRAYS_STRIP_COMMAND_NV 0x0005 +#define GL_DRAW_ELEMENTS_INSTANCED_COMMAND_NV 0x0006 +#define GL_DRAW_ARRAYS_INSTANCED_COMMAND_NV 0x0007 +#define GL_ELEMENT_ADDRESS_COMMAND_NV 0x0008 +#define GL_ATTRIBUTE_ADDRESS_COMMAND_NV 0x0009 +#define GL_UNIFORM_ADDRESS_COMMAND_NV 0x000A +#define GL_BLEND_COLOR_COMMAND_NV 0x000B +#define GL_STENCIL_REF_COMMAND_NV 0x000C +#define GL_LINE_WIDTH_COMMAND_NV 0x000D +#define GL_POLYGON_OFFSET_COMMAND_NV 0x000E +#define GL_ALPHA_REF_COMMAND_NV 0x000F +#define GL_VIEWPORT_COMMAND_NV 0x0010 +#define GL_SCISSOR_COMMAND_NV 0x0011 +#define GL_FRONT_FACE_COMMAND_NV 0x0012 +typedef void (APIENTRYP PFNGLCREATESTATESNVPROC) (GLsizei n, GLuint *states); +typedef void (APIENTRYP PFNGLDELETESTATESNVPROC) (GLsizei n, const GLuint *states); +typedef GLboolean (APIENTRYP PFNGLISSTATENVPROC) (GLuint state); +typedef void (APIENTRYP PFNGLSTATECAPTURENVPROC) (GLuint state, GLenum mode); +typedef GLuint (APIENTRYP PFNGLGETCOMMANDHEADERNVPROC) (GLenum tokenID, GLuint size); +typedef GLushort (APIENTRYP PFNGLGETSTAGEINDEXNVPROC) (GLenum shadertype); +typedef void (APIENTRYP PFNGLDRAWCOMMANDSNVPROC) (GLenum primitiveMode, GLuint buffer, const GLintptr *indirects, const GLsizei *sizes, GLuint count); +typedef void (APIENTRYP PFNGLDRAWCOMMANDSADDRESSNVPROC) (GLenum primitiveMode, const GLuint64 *indirects, const GLsizei *sizes, GLuint count); +typedef void (APIENTRYP PFNGLDRAWCOMMANDSSTATESNVPROC) (GLuint buffer, const GLintptr *indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count); +typedef void (APIENTRYP PFNGLDRAWCOMMANDSSTATESADDRESSNVPROC) (const GLuint64 *indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count); +typedef void (APIENTRYP PFNGLCREATECOMMANDLISTSNVPROC) (GLsizei n, GLuint *lists); +typedef void (APIENTRYP PFNGLDELETECOMMANDLISTSNVPROC) (GLsizei n, const GLuint *lists); +typedef GLboolean (APIENTRYP PFNGLISCOMMANDLISTNVPROC) (GLuint list); +typedef void (APIENTRYP PFNGLLISTDRAWCOMMANDSSTATESCLIENTNVPROC) (GLuint list, GLuint segment, const void **indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count); +typedef void (APIENTRYP PFNGLCOMMANDLISTSEGMENTSNVPROC) (GLuint list, GLuint segments); +typedef void (APIENTRYP PFNGLCOMPILECOMMANDLISTNVPROC) (GLuint list); +typedef void (APIENTRYP PFNGLCALLCOMMANDLISTNVPROC) (GLuint list); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glCreateStatesNV (GLsizei n, GLuint *states); +GLAPI void APIENTRY glDeleteStatesNV (GLsizei n, const GLuint *states); +GLAPI GLboolean APIENTRY glIsStateNV (GLuint state); +GLAPI void APIENTRY glStateCaptureNV (GLuint state, GLenum mode); +GLAPI GLuint APIENTRY glGetCommandHeaderNV (GLenum tokenID, GLuint size); +GLAPI GLushort APIENTRY glGetStageIndexNV (GLenum shadertype); +GLAPI void APIENTRY glDrawCommandsNV (GLenum primitiveMode, GLuint buffer, const GLintptr *indirects, const GLsizei *sizes, GLuint count); +GLAPI void APIENTRY glDrawCommandsAddressNV (GLenum primitiveMode, const GLuint64 *indirects, const GLsizei *sizes, GLuint count); +GLAPI void APIENTRY glDrawCommandsStatesNV (GLuint buffer, const GLintptr *indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count); +GLAPI void APIENTRY glDrawCommandsStatesAddressNV (const GLuint64 *indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count); +GLAPI void APIENTRY glCreateCommandListsNV (GLsizei n, GLuint *lists); +GLAPI void APIENTRY glDeleteCommandListsNV (GLsizei n, const GLuint *lists); +GLAPI GLboolean APIENTRY glIsCommandListNV (GLuint list); +GLAPI void APIENTRY glListDrawCommandsStatesClientNV (GLuint list, GLuint segment, const void **indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count); +GLAPI void APIENTRY glCommandListSegmentsNV (GLuint list, GLuint segments); +GLAPI void APIENTRY glCompileCommandListNV (GLuint list); +GLAPI void APIENTRY glCallCommandListNV (GLuint list); +#endif +#endif /* GL_NV_command_list */ + #ifndef GL_NV_compute_program5 #define GL_NV_compute_program5 1 #define GL_COMPUTE_PROGRAM_NV 0x90FB @@ -8283,6 +9204,29 @@ GLAPI void APIENTRY glEndConditionalRenderNV (void); #endif #endif /* GL_NV_conditional_render */ +#ifndef GL_NV_conservative_raster +#define GL_NV_conservative_raster 1 +#define GL_CONSERVATIVE_RASTERIZATION_NV 0x9346 +#define GL_SUBPIXEL_PRECISION_BIAS_X_BITS_NV 0x9347 +#define GL_SUBPIXEL_PRECISION_BIAS_Y_BITS_NV 0x9348 +#define GL_MAX_SUBPIXEL_PRECISION_BIAS_BITS_NV 0x9349 +typedef void (APIENTRYP PFNGLSUBPIXELPRECISIONBIASNVPROC) (GLuint xbits, GLuint ybits); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glSubpixelPrecisionBiasNV (GLuint xbits, GLuint ybits); +#endif +#endif /* GL_NV_conservative_raster */ + +#ifndef GL_NV_conservative_raster_dilate +#define GL_NV_conservative_raster_dilate 1 +#define GL_CONSERVATIVE_RASTER_DILATE_NV 0x9379 +#define GL_CONSERVATIVE_RASTER_DILATE_RANGE_NV 0x937A +#define GL_CONSERVATIVE_RASTER_DILATE_GRANULARITY_NV 0x937B +typedef void (APIENTRYP PFNGLCONSERVATIVERASTERPARAMETERFNVPROC) (GLenum pname, GLfloat value); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glConservativeRasterParameterfNV (GLenum pname, GLfloat value); +#endif +#endif /* GL_NV_conservative_raster_dilate */ + #ifndef GL_NV_copy_depth_to_color #define GL_NV_copy_depth_to_color 1 #define GL_DEPTH_STENCIL_TO_RGBA_NV 0x886E @@ -8358,20 +9302,20 @@ GLAPI void APIENTRY glDrawTextureNV (GLuint texture, GLuint sampler, GLfloat x0, #define GL_EVAL_VERTEX_ATTRIB15_NV 0x86D5 #define GL_MAX_MAP_TESSELLATION_NV 0x86D6 #define GL_MAX_RATIONAL_EVAL_ORDER_NV 0x86D7 -typedef void (APIENTRYP PFNGLMAPCONTROLPOINTSNVPROC) (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLint uorder, GLint vorder, GLboolean packed, const GLvoid *points); +typedef void (APIENTRYP PFNGLMAPCONTROLPOINTSNVPROC) (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLint uorder, GLint vorder, GLboolean packed, const void *points); typedef void (APIENTRYP PFNGLMAPPARAMETERIVNVPROC) (GLenum target, GLenum pname, const GLint *params); typedef void (APIENTRYP PFNGLMAPPARAMETERFVNVPROC) (GLenum target, GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLGETMAPCONTROLPOINTSNVPROC) (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLboolean packed, GLvoid *points); +typedef void (APIENTRYP PFNGLGETMAPCONTROLPOINTSNVPROC) (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLboolean packed, void *points); typedef void (APIENTRYP PFNGLGETMAPPARAMETERIVNVPROC) (GLenum target, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETMAPPARAMETERFVNVPROC) (GLenum target, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETMAPATTRIBPARAMETERIVNVPROC) (GLenum target, GLuint index, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETMAPATTRIBPARAMETERFVNVPROC) (GLenum target, GLuint index, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLEVALMAPSNVPROC) (GLenum target, GLenum mode); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glMapControlPointsNV (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLint uorder, GLint vorder, GLboolean packed, const GLvoid *points); +GLAPI void APIENTRY glMapControlPointsNV (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLint uorder, GLint vorder, GLboolean packed, const void *points); GLAPI void APIENTRY glMapParameterivNV (GLenum target, GLenum pname, const GLint *params); GLAPI void APIENTRY glMapParameterfvNV (GLenum target, GLenum pname, const GLfloat *params); -GLAPI void APIENTRY glGetMapControlPointsNV (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLboolean packed, GLvoid *points); +GLAPI void APIENTRY glGetMapControlPointsNV (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLboolean packed, void *points); GLAPI void APIENTRY glGetMapParameterivNV (GLenum target, GLenum pname, GLint *params); GLAPI void APIENTRY glGetMapParameterfvNV (GLenum target, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetMapAttribParameterivNV (GLenum target, GLuint index, GLenum pname, GLint *params); @@ -8425,6 +9369,11 @@ GLAPI void APIENTRY glSetFenceNV (GLuint fence, GLenum condition); #endif #endif /* GL_NV_fence */ +#ifndef GL_NV_fill_rectangle +#define GL_NV_fill_rectangle 1 +#define GL_FILL_RECTANGLE_NV 0x933C +#endif /* GL_NV_fill_rectangle */ + #ifndef GL_NV_float_buffer #define GL_NV_float_buffer 1 #define GL_FLOAT_R_NV 0x8880 @@ -8451,6 +9400,16 @@ GLAPI void APIENTRY glSetFenceNV (GLuint fence, GLenum condition); #define GL_EYE_PLANE_ABSOLUTE_NV 0x855C #endif /* GL_NV_fog_distance */ +#ifndef GL_NV_fragment_coverage_to_color +#define GL_NV_fragment_coverage_to_color 1 +#define GL_FRAGMENT_COVERAGE_TO_COLOR_NV 0x92DD +#define GL_FRAGMENT_COVERAGE_COLOR_NV 0x92DE +typedef void (APIENTRYP PFNGLFRAGMENTCOVERAGECOLORNVPROC) (GLuint color); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFragmentCoverageColorNV (GLuint color); +#endif +#endif /* GL_NV_fragment_coverage_to_color */ + #ifndef GL_NV_fragment_program #define GL_NV_fragment_program 1 #define GL_MAX_FRAGMENT_PROGRAM_LOCAL_PARAMETERS_NV 0x8868 @@ -8492,6 +9451,30 @@ GLAPI void APIENTRY glGetProgramNamedParameterdvNV (GLuint id, GLsizei len, cons #define GL_NV_fragment_program_option 1 #endif /* GL_NV_fragment_program_option */ +#ifndef GL_NV_fragment_shader_interlock +#define GL_NV_fragment_shader_interlock 1 +#endif /* GL_NV_fragment_shader_interlock */ + +#ifndef GL_NV_framebuffer_mixed_samples +#define GL_NV_framebuffer_mixed_samples 1 +#define GL_COVERAGE_MODULATION_TABLE_NV 0x9331 +#define GL_COLOR_SAMPLES_NV 0x8E20 +#define GL_DEPTH_SAMPLES_NV 0x932D +#define GL_STENCIL_SAMPLES_NV 0x932E +#define GL_MIXED_DEPTH_SAMPLES_SUPPORTED_NV 0x932F +#define GL_MIXED_STENCIL_SAMPLES_SUPPORTED_NV 0x9330 +#define GL_COVERAGE_MODULATION_NV 0x9332 +#define GL_COVERAGE_MODULATION_TABLE_SIZE_NV 0x9333 +typedef void (APIENTRYP PFNGLCOVERAGEMODULATIONTABLENVPROC) (GLsizei n, const GLfloat *v); +typedef void (APIENTRYP PFNGLGETCOVERAGEMODULATIONTABLENVPROC) (GLsizei bufsize, GLfloat *v); +typedef void (APIENTRYP PFNGLCOVERAGEMODULATIONNVPROC) (GLenum components); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glCoverageModulationTableNV (GLsizei n, const GLfloat *v); +GLAPI void APIENTRY glGetCoverageModulationTableNV (GLsizei bufsize, GLfloat *v); +GLAPI void APIENTRY glCoverageModulationNV (GLenum components); +#endif +#endif /* GL_NV_framebuffer_mixed_samples */ + #ifndef GL_NV_framebuffer_multisample_coverage #define GL_NV_framebuffer_multisample_coverage 1 #define GL_RENDERBUFFER_COVERAGE_SAMPLES_NV 0x8CAB @@ -8511,12 +9494,10 @@ GLAPI void APIENTRY glRenderbufferStorageMultisampleCoverageNV (GLenum target, G #define GL_MAX_PROGRAM_TOTAL_OUTPUT_COMPONENTS_NV 0x8C28 typedef void (APIENTRYP PFNGLPROGRAMVERTEXLIMITNVPROC) (GLenum target, GLint limit); typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREEXTPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level); -typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURELAYEREXTPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint layer); typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREFACEEXTPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLenum face); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glProgramVertexLimitNV (GLenum target, GLint limit); GLAPI void APIENTRY glFramebufferTextureEXT (GLenum target, GLenum attachment, GLuint texture, GLint level); -GLAPI void APIENTRY glFramebufferTextureLayerEXT (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint layer); GLAPI void APIENTRY glFramebufferTextureFaceEXT (GLenum target, GLenum attachment, GLuint texture, GLint level, GLenum face); #endif #endif /* GL_NV_geometry_program4 */ @@ -8525,6 +9506,10 @@ GLAPI void APIENTRY glFramebufferTextureFaceEXT (GLenum target, GLenum attachmen #define GL_NV_geometry_shader4 1 #endif /* GL_NV_geometry_shader4 */ +#ifndef GL_NV_geometry_shader_passthrough +#define GL_NV_geometry_shader_passthrough 1 +#endif /* GL_NV_geometry_shader_passthrough */ + #ifndef GL_NV_gpu_program4 #define GL_NV_gpu_program4 1 #define GL_MIN_PROGRAM_TEXEL_OFFSET_NV 0x8904 @@ -8595,103 +9580,6 @@ GLAPI void APIENTRY glGetProgramSubroutineParameteruivNV (GLenum target, GLuint #ifndef GL_NV_gpu_shader5 #define GL_NV_gpu_shader5 1 -typedef int64_t GLint64EXT; -#define GL_INT64_NV 0x140E -#define GL_UNSIGNED_INT64_NV 0x140F -#define GL_INT8_NV 0x8FE0 -#define GL_INT8_VEC2_NV 0x8FE1 -#define GL_INT8_VEC3_NV 0x8FE2 -#define GL_INT8_VEC4_NV 0x8FE3 -#define GL_INT16_NV 0x8FE4 -#define GL_INT16_VEC2_NV 0x8FE5 -#define GL_INT16_VEC3_NV 0x8FE6 -#define GL_INT16_VEC4_NV 0x8FE7 -#define GL_INT64_VEC2_NV 0x8FE9 -#define GL_INT64_VEC3_NV 0x8FEA -#define GL_INT64_VEC4_NV 0x8FEB -#define GL_UNSIGNED_INT8_NV 0x8FEC -#define GL_UNSIGNED_INT8_VEC2_NV 0x8FED -#define GL_UNSIGNED_INT8_VEC3_NV 0x8FEE -#define GL_UNSIGNED_INT8_VEC4_NV 0x8FEF -#define GL_UNSIGNED_INT16_NV 0x8FF0 -#define GL_UNSIGNED_INT16_VEC2_NV 0x8FF1 -#define GL_UNSIGNED_INT16_VEC3_NV 0x8FF2 -#define GL_UNSIGNED_INT16_VEC4_NV 0x8FF3 -#define GL_UNSIGNED_INT64_VEC2_NV 0x8FF5 -#define GL_UNSIGNED_INT64_VEC3_NV 0x8FF6 -#define GL_UNSIGNED_INT64_VEC4_NV 0x8FF7 -#define GL_FLOAT16_NV 0x8FF8 -#define GL_FLOAT16_VEC2_NV 0x8FF9 -#define GL_FLOAT16_VEC3_NV 0x8FFA -#define GL_FLOAT16_VEC4_NV 0x8FFB -typedef void (APIENTRYP PFNGLUNIFORM1I64NVPROC) (GLint location, GLint64EXT x); -typedef void (APIENTRYP PFNGLUNIFORM2I64NVPROC) (GLint location, GLint64EXT x, GLint64EXT y); -typedef void (APIENTRYP PFNGLUNIFORM3I64NVPROC) (GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z); -typedef void (APIENTRYP PFNGLUNIFORM4I64NVPROC) (GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z, GLint64EXT w); -typedef void (APIENTRYP PFNGLUNIFORM1I64VNVPROC) (GLint location, GLsizei count, const GLint64EXT *value); -typedef void (APIENTRYP PFNGLUNIFORM2I64VNVPROC) (GLint location, GLsizei count, const GLint64EXT *value); -typedef void (APIENTRYP PFNGLUNIFORM3I64VNVPROC) (GLint location, GLsizei count, const GLint64EXT *value); -typedef void (APIENTRYP PFNGLUNIFORM4I64VNVPROC) (GLint location, GLsizei count, const GLint64EXT *value); -typedef void (APIENTRYP PFNGLUNIFORM1UI64NVPROC) (GLint location, GLuint64EXT x); -typedef void (APIENTRYP PFNGLUNIFORM2UI64NVPROC) (GLint location, GLuint64EXT x, GLuint64EXT y); -typedef void (APIENTRYP PFNGLUNIFORM3UI64NVPROC) (GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z); -typedef void (APIENTRYP PFNGLUNIFORM4UI64NVPROC) (GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z, GLuint64EXT w); -typedef void (APIENTRYP PFNGLUNIFORM1UI64VNVPROC) (GLint location, GLsizei count, const GLuint64EXT *value); -typedef void (APIENTRYP PFNGLUNIFORM2UI64VNVPROC) (GLint location, GLsizei count, const GLuint64EXT *value); -typedef void (APIENTRYP PFNGLUNIFORM3UI64VNVPROC) (GLint location, GLsizei count, const GLuint64EXT *value); -typedef void (APIENTRYP PFNGLUNIFORM4UI64VNVPROC) (GLint location, GLsizei count, const GLuint64EXT *value); -typedef void (APIENTRYP PFNGLGETUNIFORMI64VNVPROC) (GLuint program, GLint location, GLint64EXT *params); -typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1I64NVPROC) (GLuint program, GLint location, GLint64EXT x); -typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2I64NVPROC) (GLuint program, GLint location, GLint64EXT x, GLint64EXT y); -typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3I64NVPROC) (GLuint program, GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z); -typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4I64NVPROC) (GLuint program, GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z, GLint64EXT w); -typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1I64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); -typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2I64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); -typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3I64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); -typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4I64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); -typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UI64NVPROC) (GLuint program, GLint location, GLuint64EXT x); -typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UI64NVPROC) (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y); -typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UI64NVPROC) (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z); -typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UI64NVPROC) (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z, GLuint64EXT w); -typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UI64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); -typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UI64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); -typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UI64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); -typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UI64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glUniform1i64NV (GLint location, GLint64EXT x); -GLAPI void APIENTRY glUniform2i64NV (GLint location, GLint64EXT x, GLint64EXT y); -GLAPI void APIENTRY glUniform3i64NV (GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z); -GLAPI void APIENTRY glUniform4i64NV (GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z, GLint64EXT w); -GLAPI void APIENTRY glUniform1i64vNV (GLint location, GLsizei count, const GLint64EXT *value); -GLAPI void APIENTRY glUniform2i64vNV (GLint location, GLsizei count, const GLint64EXT *value); -GLAPI void APIENTRY glUniform3i64vNV (GLint location, GLsizei count, const GLint64EXT *value); -GLAPI void APIENTRY glUniform4i64vNV (GLint location, GLsizei count, const GLint64EXT *value); -GLAPI void APIENTRY glUniform1ui64NV (GLint location, GLuint64EXT x); -GLAPI void APIENTRY glUniform2ui64NV (GLint location, GLuint64EXT x, GLuint64EXT y); -GLAPI void APIENTRY glUniform3ui64NV (GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z); -GLAPI void APIENTRY glUniform4ui64NV (GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z, GLuint64EXT w); -GLAPI void APIENTRY glUniform1ui64vNV (GLint location, GLsizei count, const GLuint64EXT *value); -GLAPI void APIENTRY glUniform2ui64vNV (GLint location, GLsizei count, const GLuint64EXT *value); -GLAPI void APIENTRY glUniform3ui64vNV (GLint location, GLsizei count, const GLuint64EXT *value); -GLAPI void APIENTRY glUniform4ui64vNV (GLint location, GLsizei count, const GLuint64EXT *value); -GLAPI void APIENTRY glGetUniformi64vNV (GLuint program, GLint location, GLint64EXT *params); -GLAPI void APIENTRY glProgramUniform1i64NV (GLuint program, GLint location, GLint64EXT x); -GLAPI void APIENTRY glProgramUniform2i64NV (GLuint program, GLint location, GLint64EXT x, GLint64EXT y); -GLAPI void APIENTRY glProgramUniform3i64NV (GLuint program, GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z); -GLAPI void APIENTRY glProgramUniform4i64NV (GLuint program, GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z, GLint64EXT w); -GLAPI void APIENTRY glProgramUniform1i64vNV (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); -GLAPI void APIENTRY glProgramUniform2i64vNV (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); -GLAPI void APIENTRY glProgramUniform3i64vNV (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); -GLAPI void APIENTRY glProgramUniform4i64vNV (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); -GLAPI void APIENTRY glProgramUniform1ui64NV (GLuint program, GLint location, GLuint64EXT x); -GLAPI void APIENTRY glProgramUniform2ui64NV (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y); -GLAPI void APIENTRY glProgramUniform3ui64NV (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z); -GLAPI void APIENTRY glProgramUniform4ui64NV (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z, GLuint64EXT w); -GLAPI void APIENTRY glProgramUniform1ui64vNV (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); -GLAPI void APIENTRY glProgramUniform2ui64vNV (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); -GLAPI void APIENTRY glProgramUniform3ui64vNV (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); -GLAPI void APIENTRY glProgramUniform4ui64vNV (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); -#endif #endif /* GL_NV_gpu_shader5 */ #ifndef GL_NV_half_float @@ -8794,6 +9682,18 @@ GLAPI void APIENTRY glVertexAttribs4hvNV (GLuint index, GLsizei n, const GLhalfN #endif #endif /* GL_NV_half_float */ +#ifndef GL_NV_internalformat_sample_query +#define GL_NV_internalformat_sample_query 1 +#define GL_MULTISAMPLES_NV 0x9371 +#define GL_SUPERSAMPLE_SCALE_X_NV 0x9372 +#define GL_SUPERSAMPLE_SCALE_Y_NV 0x9373 +#define GL_CONFORMANT_NV 0x9374 +typedef void (APIENTRYP PFNGLGETINTERNALFORMATSAMPLEIVNVPROC) (GLenum target, GLenum internalformat, GLsizei samples, GLenum pname, GLsizei bufSize, GLint *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGetInternalformatSampleivNV (GLenum target, GLenum internalformat, GLsizei samples, GLenum pname, GLsizei bufSize, GLint *params); +#endif +#endif /* GL_NV_internalformat_sample_query */ + #ifndef GL_NV_light_max_exponent #define GL_NV_light_max_exponent 1 #define GL_MAX_SHININESS_NV 0x8504 @@ -8802,7 +9702,6 @@ GLAPI void APIENTRY glVertexAttribs4hvNV (GLuint index, GLsizei n, const GLhalfN #ifndef GL_NV_multisample_coverage #define GL_NV_multisample_coverage 1 -#define GL_COLOR_SAMPLES_NV 0x8E20 #endif /* GL_NV_multisample_coverage */ #ifndef GL_NV_multisample_filter_hint @@ -8915,13 +9814,11 @@ GLAPI void APIENTRY glProgramBufferParametersIuivNV (GLenum target, GLuint bindi #define GL_SKIP_MISSING_GLYPH_NV 0x90A9 #define GL_USE_MISSING_GLYPH_NV 0x90AA #define GL_PATH_ERROR_POSITION_NV 0x90AB -#define GL_PATH_FOG_GEN_MODE_NV 0x90AC #define GL_ACCUM_ADJACENT_PAIRS_NV 0x90AD #define GL_ADJACENT_PAIRS_NV 0x90AE #define GL_FIRST_TO_REST_NV 0x90AF #define GL_PATH_GEN_MODE_NV 0x90B0 #define GL_PATH_GEN_COEFF_NV 0x90B1 -#define GL_PATH_GEN_COLOR_FORMAT_NV 0x90B2 #define GL_PATH_GEN_COMPONENTS_NV 0x90B3 #define GL_PATH_STENCIL_FUNC_NV 0x90B7 #define GL_PATH_STENCIL_REF_NV 0x90B8 @@ -8990,18 +9887,54 @@ GLAPI void APIENTRY glProgramBufferParametersIuivNV (GLenum target, GLuint bindi #define GL_FONT_UNDERLINE_POSITION_BIT_NV 0x04000000 #define GL_FONT_UNDERLINE_THICKNESS_BIT_NV 0x08000000 #define GL_FONT_HAS_KERNING_BIT_NV 0x10000000 +#define GL_ROUNDED_RECT_NV 0xE8 +#define GL_RELATIVE_ROUNDED_RECT_NV 0xE9 +#define GL_ROUNDED_RECT2_NV 0xEA +#define GL_RELATIVE_ROUNDED_RECT2_NV 0xEB +#define GL_ROUNDED_RECT4_NV 0xEC +#define GL_RELATIVE_ROUNDED_RECT4_NV 0xED +#define GL_ROUNDED_RECT8_NV 0xEE +#define GL_RELATIVE_ROUNDED_RECT8_NV 0xEF +#define GL_RELATIVE_RECT_NV 0xF7 +#define GL_FONT_GLYPHS_AVAILABLE_NV 0x9368 +#define GL_FONT_TARGET_UNAVAILABLE_NV 0x9369 +#define GL_FONT_UNAVAILABLE_NV 0x936A +#define GL_FONT_UNINTELLIGIBLE_NV 0x936B +#define GL_CONIC_CURVE_TO_NV 0x1A +#define GL_RELATIVE_CONIC_CURVE_TO_NV 0x1B +#define GL_FONT_NUM_GLYPH_INDICES_BIT_NV 0x20000000 +#define GL_STANDARD_FONT_FORMAT_NV 0x936C +#define GL_2_BYTES_NV 0x1407 +#define GL_3_BYTES_NV 0x1408 +#define GL_4_BYTES_NV 0x1409 +#define GL_EYE_LINEAR_NV 0x2400 +#define GL_OBJECT_LINEAR_NV 0x2401 +#define GL_CONSTANT_NV 0x8576 +#define GL_PATH_FOG_GEN_MODE_NV 0x90AC #define GL_PRIMARY_COLOR_NV 0x852C #define GL_SECONDARY_COLOR_NV 0x852D +#define GL_PATH_GEN_COLOR_FORMAT_NV 0x90B2 +#define GL_PATH_PROJECTION_NV 0x1701 +#define GL_PATH_MODELVIEW_NV 0x1700 +#define GL_PATH_MODELVIEW_STACK_DEPTH_NV 0x0BA3 +#define GL_PATH_MODELVIEW_MATRIX_NV 0x0BA6 +#define GL_PATH_MAX_MODELVIEW_STACK_DEPTH_NV 0x0D36 +#define GL_PATH_TRANSPOSE_MODELVIEW_MATRIX_NV 0x84E3 +#define GL_PATH_PROJECTION_STACK_DEPTH_NV 0x0BA4 +#define GL_PATH_PROJECTION_MATRIX_NV 0x0BA7 +#define GL_PATH_MAX_PROJECTION_STACK_DEPTH_NV 0x0D38 +#define GL_PATH_TRANSPOSE_PROJECTION_MATRIX_NV 0x84E4 +#define GL_FRAGMENT_INPUT_NV 0x936D typedef GLuint (APIENTRYP PFNGLGENPATHSNVPROC) (GLsizei range); typedef void (APIENTRYP PFNGLDELETEPATHSNVPROC) (GLuint path, GLsizei range); typedef GLboolean (APIENTRYP PFNGLISPATHNVPROC) (GLuint path); -typedef void (APIENTRYP PFNGLPATHCOMMANDSNVPROC) (GLuint path, GLsizei numCommands, const GLubyte *commands, GLsizei numCoords, GLenum coordType, const GLvoid *coords); -typedef void (APIENTRYP PFNGLPATHCOORDSNVPROC) (GLuint path, GLsizei numCoords, GLenum coordType, const GLvoid *coords); -typedef void (APIENTRYP PFNGLPATHSUBCOMMANDSNVPROC) (GLuint path, GLsizei commandStart, GLsizei commandsToDelete, GLsizei numCommands, const GLubyte *commands, GLsizei numCoords, GLenum coordType, const GLvoid *coords); -typedef void (APIENTRYP PFNGLPATHSUBCOORDSNVPROC) (GLuint path, GLsizei coordStart, GLsizei numCoords, GLenum coordType, const GLvoid *coords); -typedef void (APIENTRYP PFNGLPATHSTRINGNVPROC) (GLuint path, GLenum format, GLsizei length, const GLvoid *pathString); -typedef void (APIENTRYP PFNGLPATHGLYPHSNVPROC) (GLuint firstPathName, GLenum fontTarget, const GLvoid *fontName, GLbitfield fontStyle, GLsizei numGlyphs, GLenum type, const GLvoid *charcodes, GLenum handleMissingGlyphs, GLuint pathParameterTemplate, GLfloat emScale); -typedef void (APIENTRYP PFNGLPATHGLYPHRANGENVPROC) (GLuint firstPathName, GLenum fontTarget, const GLvoid *fontName, GLbitfield fontStyle, GLuint firstGlyph, GLsizei numGlyphs, GLenum handleMissingGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +typedef void (APIENTRYP PFNGLPATHCOMMANDSNVPROC) (GLuint path, GLsizei numCommands, const GLubyte *commands, GLsizei numCoords, GLenum coordType, const void *coords); +typedef void (APIENTRYP PFNGLPATHCOORDSNVPROC) (GLuint path, GLsizei numCoords, GLenum coordType, const void *coords); +typedef void (APIENTRYP PFNGLPATHSUBCOMMANDSNVPROC) (GLuint path, GLsizei commandStart, GLsizei commandsToDelete, GLsizei numCommands, const GLubyte *commands, GLsizei numCoords, GLenum coordType, const void *coords); +typedef void (APIENTRYP PFNGLPATHSUBCOORDSNVPROC) (GLuint path, GLsizei coordStart, GLsizei numCoords, GLenum coordType, const void *coords); +typedef void (APIENTRYP PFNGLPATHSTRINGNVPROC) (GLuint path, GLenum format, GLsizei length, const void *pathString); +typedef void (APIENTRYP PFNGLPATHGLYPHSNVPROC) (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLsizei numGlyphs, GLenum type, const void *charcodes, GLenum handleMissingGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +typedef void (APIENTRYP PFNGLPATHGLYPHRANGENVPROC) (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint firstGlyph, GLsizei numGlyphs, GLenum handleMissingGlyphs, GLuint pathParameterTemplate, GLfloat emScale); typedef void (APIENTRYP PFNGLWEIGHTPATHSNVPROC) (GLuint resultPath, GLsizei numPaths, const GLuint *paths, const GLfloat *weights); typedef void (APIENTRYP PFNGLCOPYPATHNVPROC) (GLuint resultPath, GLuint srcPath); typedef void (APIENTRYP PFNGLINTERPOLATEPATHSNVPROC) (GLuint resultPath, GLuint pathA, GLuint pathB, GLfloat weight); @@ -9015,43 +9948,58 @@ typedef void (APIENTRYP PFNGLPATHSTENCILFUNCNVPROC) (GLenum func, GLint ref, GLu typedef void (APIENTRYP PFNGLPATHSTENCILDEPTHOFFSETNVPROC) (GLfloat factor, GLfloat units); typedef void (APIENTRYP PFNGLSTENCILFILLPATHNVPROC) (GLuint path, GLenum fillMode, GLuint mask); typedef void (APIENTRYP PFNGLSTENCILSTROKEPATHNVPROC) (GLuint path, GLint reference, GLuint mask); -typedef void (APIENTRYP PFNGLSTENCILFILLPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const GLvoid *paths, GLuint pathBase, GLenum fillMode, GLuint mask, GLenum transformType, const GLfloat *transformValues); -typedef void (APIENTRYP PFNGLSTENCILSTROKEPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const GLvoid *paths, GLuint pathBase, GLint reference, GLuint mask, GLenum transformType, const GLfloat *transformValues); +typedef void (APIENTRYP PFNGLSTENCILFILLPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum fillMode, GLuint mask, GLenum transformType, const GLfloat *transformValues); +typedef void (APIENTRYP PFNGLSTENCILSTROKEPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLint reference, GLuint mask, GLenum transformType, const GLfloat *transformValues); typedef void (APIENTRYP PFNGLPATHCOVERDEPTHFUNCNVPROC) (GLenum func); -typedef void (APIENTRYP PFNGLPATHCOLORGENNVPROC) (GLenum color, GLenum genMode, GLenum colorFormat, const GLfloat *coeffs); -typedef void (APIENTRYP PFNGLPATHTEXGENNVPROC) (GLenum texCoordSet, GLenum genMode, GLint components, const GLfloat *coeffs); -typedef void (APIENTRYP PFNGLPATHFOGGENNVPROC) (GLenum genMode); typedef void (APIENTRYP PFNGLCOVERFILLPATHNVPROC) (GLuint path, GLenum coverMode); typedef void (APIENTRYP PFNGLCOVERSTROKEPATHNVPROC) (GLuint path, GLenum coverMode); -typedef void (APIENTRYP PFNGLCOVERFILLPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const GLvoid *paths, GLuint pathBase, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); -typedef void (APIENTRYP PFNGLCOVERSTROKEPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const GLvoid *paths, GLuint pathBase, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +typedef void (APIENTRYP PFNGLCOVERFILLPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +typedef void (APIENTRYP PFNGLCOVERSTROKEPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); typedef void (APIENTRYP PFNGLGETPATHPARAMETERIVNVPROC) (GLuint path, GLenum pname, GLint *value); typedef void (APIENTRYP PFNGLGETPATHPARAMETERFVNVPROC) (GLuint path, GLenum pname, GLfloat *value); typedef void (APIENTRYP PFNGLGETPATHCOMMANDSNVPROC) (GLuint path, GLubyte *commands); typedef void (APIENTRYP PFNGLGETPATHCOORDSNVPROC) (GLuint path, GLfloat *coords); typedef void (APIENTRYP PFNGLGETPATHDASHARRAYNVPROC) (GLuint path, GLfloat *dashArray); -typedef void (APIENTRYP PFNGLGETPATHMETRICSNVPROC) (GLbitfield metricQueryMask, GLsizei numPaths, GLenum pathNameType, const GLvoid *paths, GLuint pathBase, GLsizei stride, GLfloat *metrics); +typedef void (APIENTRYP PFNGLGETPATHMETRICSNVPROC) (GLbitfield metricQueryMask, GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLsizei stride, GLfloat *metrics); typedef void (APIENTRYP PFNGLGETPATHMETRICRANGENVPROC) (GLbitfield metricQueryMask, GLuint firstPathName, GLsizei numPaths, GLsizei stride, GLfloat *metrics); -typedef void (APIENTRYP PFNGLGETPATHSPACINGNVPROC) (GLenum pathListMode, GLsizei numPaths, GLenum pathNameType, const GLvoid *paths, GLuint pathBase, GLfloat advanceScale, GLfloat kerningScale, GLenum transformType, GLfloat *returnedSpacing); -typedef void (APIENTRYP PFNGLGETPATHCOLORGENIVNVPROC) (GLenum color, GLenum pname, GLint *value); -typedef void (APIENTRYP PFNGLGETPATHCOLORGENFVNVPROC) (GLenum color, GLenum pname, GLfloat *value); -typedef void (APIENTRYP PFNGLGETPATHTEXGENIVNVPROC) (GLenum texCoordSet, GLenum pname, GLint *value); -typedef void (APIENTRYP PFNGLGETPATHTEXGENFVNVPROC) (GLenum texCoordSet, GLenum pname, GLfloat *value); +typedef void (APIENTRYP PFNGLGETPATHSPACINGNVPROC) (GLenum pathListMode, GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLfloat advanceScale, GLfloat kerningScale, GLenum transformType, GLfloat *returnedSpacing); typedef GLboolean (APIENTRYP PFNGLISPOINTINFILLPATHNVPROC) (GLuint path, GLuint mask, GLfloat x, GLfloat y); typedef GLboolean (APIENTRYP PFNGLISPOINTINSTROKEPATHNVPROC) (GLuint path, GLfloat x, GLfloat y); typedef GLfloat (APIENTRYP PFNGLGETPATHLENGTHNVPROC) (GLuint path, GLsizei startSegment, GLsizei numSegments); typedef GLboolean (APIENTRYP PFNGLPOINTALONGPATHNVPROC) (GLuint path, GLsizei startSegment, GLsizei numSegments, GLfloat distance, GLfloat *x, GLfloat *y, GLfloat *tangentX, GLfloat *tangentY); +typedef void (APIENTRYP PFNGLMATRIXLOAD3X2FNVPROC) (GLenum matrixMode, const GLfloat *m); +typedef void (APIENTRYP PFNGLMATRIXLOAD3X3FNVPROC) (GLenum matrixMode, const GLfloat *m); +typedef void (APIENTRYP PFNGLMATRIXLOADTRANSPOSE3X3FNVPROC) (GLenum matrixMode, const GLfloat *m); +typedef void (APIENTRYP PFNGLMATRIXMULT3X2FNVPROC) (GLenum matrixMode, const GLfloat *m); +typedef void (APIENTRYP PFNGLMATRIXMULT3X3FNVPROC) (GLenum matrixMode, const GLfloat *m); +typedef void (APIENTRYP PFNGLMATRIXMULTTRANSPOSE3X3FNVPROC) (GLenum matrixMode, const GLfloat *m); +typedef void (APIENTRYP PFNGLSTENCILTHENCOVERFILLPATHNVPROC) (GLuint path, GLenum fillMode, GLuint mask, GLenum coverMode); +typedef void (APIENTRYP PFNGLSTENCILTHENCOVERSTROKEPATHNVPROC) (GLuint path, GLint reference, GLuint mask, GLenum coverMode); +typedef void (APIENTRYP PFNGLSTENCILTHENCOVERFILLPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum fillMode, GLuint mask, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +typedef void (APIENTRYP PFNGLSTENCILTHENCOVERSTROKEPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLint reference, GLuint mask, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +typedef GLenum (APIENTRYP PFNGLPATHGLYPHINDEXRANGENVPROC) (GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint pathParameterTemplate, GLfloat emScale, GLuint baseAndCount[2]); +typedef GLenum (APIENTRYP PFNGLPATHGLYPHINDEXARRAYNVPROC) (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +typedef GLenum (APIENTRYP PFNGLPATHMEMORYGLYPHINDEXARRAYNVPROC) (GLuint firstPathName, GLenum fontTarget, GLsizeiptr fontSize, const void *fontData, GLsizei faceIndex, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +typedef void (APIENTRYP PFNGLPROGRAMPATHFRAGMENTINPUTGENNVPROC) (GLuint program, GLint location, GLenum genMode, GLint components, const GLfloat *coeffs); +typedef void (APIENTRYP PFNGLGETPROGRAMRESOURCEFVNVPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei bufSize, GLsizei *length, GLfloat *params); +typedef void (APIENTRYP PFNGLPATHCOLORGENNVPROC) (GLenum color, GLenum genMode, GLenum colorFormat, const GLfloat *coeffs); +typedef void (APIENTRYP PFNGLPATHTEXGENNVPROC) (GLenum texCoordSet, GLenum genMode, GLint components, const GLfloat *coeffs); +typedef void (APIENTRYP PFNGLPATHFOGGENNVPROC) (GLenum genMode); +typedef void (APIENTRYP PFNGLGETPATHCOLORGENIVNVPROC) (GLenum color, GLenum pname, GLint *value); +typedef void (APIENTRYP PFNGLGETPATHCOLORGENFVNVPROC) (GLenum color, GLenum pname, GLfloat *value); +typedef void (APIENTRYP PFNGLGETPATHTEXGENIVNVPROC) (GLenum texCoordSet, GLenum pname, GLint *value); +typedef void (APIENTRYP PFNGLGETPATHTEXGENFVNVPROC) (GLenum texCoordSet, GLenum pname, GLfloat *value); #ifdef GL_GLEXT_PROTOTYPES GLAPI GLuint APIENTRY glGenPathsNV (GLsizei range); GLAPI void APIENTRY glDeletePathsNV (GLuint path, GLsizei range); GLAPI GLboolean APIENTRY glIsPathNV (GLuint path); -GLAPI void APIENTRY glPathCommandsNV (GLuint path, GLsizei numCommands, const GLubyte *commands, GLsizei numCoords, GLenum coordType, const GLvoid *coords); -GLAPI void APIENTRY glPathCoordsNV (GLuint path, GLsizei numCoords, GLenum coordType, const GLvoid *coords); -GLAPI void APIENTRY glPathSubCommandsNV (GLuint path, GLsizei commandStart, GLsizei commandsToDelete, GLsizei numCommands, const GLubyte *commands, GLsizei numCoords, GLenum coordType, const GLvoid *coords); -GLAPI void APIENTRY glPathSubCoordsNV (GLuint path, GLsizei coordStart, GLsizei numCoords, GLenum coordType, const GLvoid *coords); -GLAPI void APIENTRY glPathStringNV (GLuint path, GLenum format, GLsizei length, const GLvoid *pathString); -GLAPI void APIENTRY glPathGlyphsNV (GLuint firstPathName, GLenum fontTarget, const GLvoid *fontName, GLbitfield fontStyle, GLsizei numGlyphs, GLenum type, const GLvoid *charcodes, GLenum handleMissingGlyphs, GLuint pathParameterTemplate, GLfloat emScale); -GLAPI void APIENTRY glPathGlyphRangeNV (GLuint firstPathName, GLenum fontTarget, const GLvoid *fontName, GLbitfield fontStyle, GLuint firstGlyph, GLsizei numGlyphs, GLenum handleMissingGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +GLAPI void APIENTRY glPathCommandsNV (GLuint path, GLsizei numCommands, const GLubyte *commands, GLsizei numCoords, GLenum coordType, const void *coords); +GLAPI void APIENTRY glPathCoordsNV (GLuint path, GLsizei numCoords, GLenum coordType, const void *coords); +GLAPI void APIENTRY glPathSubCommandsNV (GLuint path, GLsizei commandStart, GLsizei commandsToDelete, GLsizei numCommands, const GLubyte *commands, GLsizei numCoords, GLenum coordType, const void *coords); +GLAPI void APIENTRY glPathSubCoordsNV (GLuint path, GLsizei coordStart, GLsizei numCoords, GLenum coordType, const void *coords); +GLAPI void APIENTRY glPathStringNV (GLuint path, GLenum format, GLsizei length, const void *pathString); +GLAPI void APIENTRY glPathGlyphsNV (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLsizei numGlyphs, GLenum type, const void *charcodes, GLenum handleMissingGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +GLAPI void APIENTRY glPathGlyphRangeNV (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint firstGlyph, GLsizei numGlyphs, GLenum handleMissingGlyphs, GLuint pathParameterTemplate, GLfloat emScale); GLAPI void APIENTRY glWeightPathsNV (GLuint resultPath, GLsizei numPaths, const GLuint *paths, const GLfloat *weights); GLAPI void APIENTRY glCopyPathNV (GLuint resultPath, GLuint srcPath); GLAPI void APIENTRY glInterpolatePathsNV (GLuint resultPath, GLuint pathA, GLuint pathB, GLfloat weight); @@ -9065,35 +10013,55 @@ GLAPI void APIENTRY glPathStencilFuncNV (GLenum func, GLint ref, GLuint mask); GLAPI void APIENTRY glPathStencilDepthOffsetNV (GLfloat factor, GLfloat units); GLAPI void APIENTRY glStencilFillPathNV (GLuint path, GLenum fillMode, GLuint mask); GLAPI void APIENTRY glStencilStrokePathNV (GLuint path, GLint reference, GLuint mask); -GLAPI void APIENTRY glStencilFillPathInstancedNV (GLsizei numPaths, GLenum pathNameType, const GLvoid *paths, GLuint pathBase, GLenum fillMode, GLuint mask, GLenum transformType, const GLfloat *transformValues); -GLAPI void APIENTRY glStencilStrokePathInstancedNV (GLsizei numPaths, GLenum pathNameType, const GLvoid *paths, GLuint pathBase, GLint reference, GLuint mask, GLenum transformType, const GLfloat *transformValues); +GLAPI void APIENTRY glStencilFillPathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum fillMode, GLuint mask, GLenum transformType, const GLfloat *transformValues); +GLAPI void APIENTRY glStencilStrokePathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLint reference, GLuint mask, GLenum transformType, const GLfloat *transformValues); GLAPI void APIENTRY glPathCoverDepthFuncNV (GLenum func); -GLAPI void APIENTRY glPathColorGenNV (GLenum color, GLenum genMode, GLenum colorFormat, const GLfloat *coeffs); -GLAPI void APIENTRY glPathTexGenNV (GLenum texCoordSet, GLenum genMode, GLint components, const GLfloat *coeffs); -GLAPI void APIENTRY glPathFogGenNV (GLenum genMode); GLAPI void APIENTRY glCoverFillPathNV (GLuint path, GLenum coverMode); GLAPI void APIENTRY glCoverStrokePathNV (GLuint path, GLenum coverMode); -GLAPI void APIENTRY glCoverFillPathInstancedNV (GLsizei numPaths, GLenum pathNameType, const GLvoid *paths, GLuint pathBase, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); -GLAPI void APIENTRY glCoverStrokePathInstancedNV (GLsizei numPaths, GLenum pathNameType, const GLvoid *paths, GLuint pathBase, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +GLAPI void APIENTRY glCoverFillPathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +GLAPI void APIENTRY glCoverStrokePathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); GLAPI void APIENTRY glGetPathParameterivNV (GLuint path, GLenum pname, GLint *value); GLAPI void APIENTRY glGetPathParameterfvNV (GLuint path, GLenum pname, GLfloat *value); GLAPI void APIENTRY glGetPathCommandsNV (GLuint path, GLubyte *commands); GLAPI void APIENTRY glGetPathCoordsNV (GLuint path, GLfloat *coords); GLAPI void APIENTRY glGetPathDashArrayNV (GLuint path, GLfloat *dashArray); -GLAPI void APIENTRY glGetPathMetricsNV (GLbitfield metricQueryMask, GLsizei numPaths, GLenum pathNameType, const GLvoid *paths, GLuint pathBase, GLsizei stride, GLfloat *metrics); +GLAPI void APIENTRY glGetPathMetricsNV (GLbitfield metricQueryMask, GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLsizei stride, GLfloat *metrics); GLAPI void APIENTRY glGetPathMetricRangeNV (GLbitfield metricQueryMask, GLuint firstPathName, GLsizei numPaths, GLsizei stride, GLfloat *metrics); -GLAPI void APIENTRY glGetPathSpacingNV (GLenum pathListMode, GLsizei numPaths, GLenum pathNameType, const GLvoid *paths, GLuint pathBase, GLfloat advanceScale, GLfloat kerningScale, GLenum transformType, GLfloat *returnedSpacing); -GLAPI void APIENTRY glGetPathColorGenivNV (GLenum color, GLenum pname, GLint *value); -GLAPI void APIENTRY glGetPathColorGenfvNV (GLenum color, GLenum pname, GLfloat *value); -GLAPI void APIENTRY glGetPathTexGenivNV (GLenum texCoordSet, GLenum pname, GLint *value); -GLAPI void APIENTRY glGetPathTexGenfvNV (GLenum texCoordSet, GLenum pname, GLfloat *value); +GLAPI void APIENTRY glGetPathSpacingNV (GLenum pathListMode, GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLfloat advanceScale, GLfloat kerningScale, GLenum transformType, GLfloat *returnedSpacing); GLAPI GLboolean APIENTRY glIsPointInFillPathNV (GLuint path, GLuint mask, GLfloat x, GLfloat y); GLAPI GLboolean APIENTRY glIsPointInStrokePathNV (GLuint path, GLfloat x, GLfloat y); GLAPI GLfloat APIENTRY glGetPathLengthNV (GLuint path, GLsizei startSegment, GLsizei numSegments); GLAPI GLboolean APIENTRY glPointAlongPathNV (GLuint path, GLsizei startSegment, GLsizei numSegments, GLfloat distance, GLfloat *x, GLfloat *y, GLfloat *tangentX, GLfloat *tangentY); +GLAPI void APIENTRY glMatrixLoad3x2fNV (GLenum matrixMode, const GLfloat *m); +GLAPI void APIENTRY glMatrixLoad3x3fNV (GLenum matrixMode, const GLfloat *m); +GLAPI void APIENTRY glMatrixLoadTranspose3x3fNV (GLenum matrixMode, const GLfloat *m); +GLAPI void APIENTRY glMatrixMult3x2fNV (GLenum matrixMode, const GLfloat *m); +GLAPI void APIENTRY glMatrixMult3x3fNV (GLenum matrixMode, const GLfloat *m); +GLAPI void APIENTRY glMatrixMultTranspose3x3fNV (GLenum matrixMode, const GLfloat *m); +GLAPI void APIENTRY glStencilThenCoverFillPathNV (GLuint path, GLenum fillMode, GLuint mask, GLenum coverMode); +GLAPI void APIENTRY glStencilThenCoverStrokePathNV (GLuint path, GLint reference, GLuint mask, GLenum coverMode); +GLAPI void APIENTRY glStencilThenCoverFillPathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum fillMode, GLuint mask, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +GLAPI void APIENTRY glStencilThenCoverStrokePathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLint reference, GLuint mask, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +GLAPI GLenum APIENTRY glPathGlyphIndexRangeNV (GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint pathParameterTemplate, GLfloat emScale, GLuint baseAndCount[2]); +GLAPI GLenum APIENTRY glPathGlyphIndexArrayNV (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +GLAPI GLenum APIENTRY glPathMemoryGlyphIndexArrayNV (GLuint firstPathName, GLenum fontTarget, GLsizeiptr fontSize, const void *fontData, GLsizei faceIndex, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +GLAPI void APIENTRY glProgramPathFragmentInputGenNV (GLuint program, GLint location, GLenum genMode, GLint components, const GLfloat *coeffs); +GLAPI void APIENTRY glGetProgramResourcefvNV (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei bufSize, GLsizei *length, GLfloat *params); +GLAPI void APIENTRY glPathColorGenNV (GLenum color, GLenum genMode, GLenum colorFormat, const GLfloat *coeffs); +GLAPI void APIENTRY glPathTexGenNV (GLenum texCoordSet, GLenum genMode, GLint components, const GLfloat *coeffs); +GLAPI void APIENTRY glPathFogGenNV (GLenum genMode); +GLAPI void APIENTRY glGetPathColorGenivNV (GLenum color, GLenum pname, GLint *value); +GLAPI void APIENTRY glGetPathColorGenfvNV (GLenum color, GLenum pname, GLfloat *value); +GLAPI void APIENTRY glGetPathTexGenivNV (GLenum texCoordSet, GLenum pname, GLint *value); +GLAPI void APIENTRY glGetPathTexGenfvNV (GLenum texCoordSet, GLenum pname, GLfloat *value); #endif #endif /* GL_NV_path_rendering */ +#ifndef GL_NV_path_rendering_shared_edge +#define GL_NV_path_rendering_shared_edge 1 +#define GL_SHARED_EDGE_NV 0xC0 +#endif /* GL_NV_path_rendering_shared_edge */ + #ifndef GL_NV_pixel_data_range #define GL_NV_pixel_data_range 1 #define GL_WRITE_PIXEL_DATA_RANGE_NV 0x8878 @@ -9102,10 +10070,10 @@ GLAPI GLboolean APIENTRY glPointAlongPathNV (GLuint path, GLsizei startSegment, #define GL_READ_PIXEL_DATA_RANGE_LENGTH_NV 0x887B #define GL_WRITE_PIXEL_DATA_RANGE_POINTER_NV 0x887C #define GL_READ_PIXEL_DATA_RANGE_POINTER_NV 0x887D -typedef void (APIENTRYP PFNGLPIXELDATARANGENVPROC) (GLenum target, GLsizei length, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLPIXELDATARANGENVPROC) (GLenum target, GLsizei length, const void *pointer); typedef void (APIENTRYP PFNGLFLUSHPIXELDATARANGENVPROC) (GLenum target); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glPixelDataRangeNV (GLenum target, GLsizei length, const GLvoid *pointer); +GLAPI void APIENTRY glPixelDataRangeNV (GLenum target, GLsizei length, const void *pointer); GLAPI void APIENTRY glFlushPixelDataRangeNV (GLenum target); #endif #endif /* GL_NV_pixel_data_range */ @@ -9251,6 +10219,30 @@ GLAPI void APIENTRY glGetCombinerStageParameterfvNV (GLenum stage, GLenum pname, #endif #endif /* GL_NV_register_combiners2 */ +#ifndef GL_NV_sample_locations +#define GL_NV_sample_locations 1 +#define GL_SAMPLE_LOCATION_SUBPIXEL_BITS_NV 0x933D +#define GL_SAMPLE_LOCATION_PIXEL_GRID_WIDTH_NV 0x933E +#define GL_SAMPLE_LOCATION_PIXEL_GRID_HEIGHT_NV 0x933F +#define GL_PROGRAMMABLE_SAMPLE_LOCATION_TABLE_SIZE_NV 0x9340 +#define GL_SAMPLE_LOCATION_NV 0x8E50 +#define GL_PROGRAMMABLE_SAMPLE_LOCATION_NV 0x9341 +#define GL_FRAMEBUFFER_PROGRAMMABLE_SAMPLE_LOCATIONS_NV 0x9342 +#define GL_FRAMEBUFFER_SAMPLE_LOCATION_PIXEL_GRID_NV 0x9343 +typedef void (APIENTRYP PFNGLFRAMEBUFFERSAMPLELOCATIONSFVNVPROC) (GLenum target, GLuint start, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERSAMPLELOCATIONSFVNVPROC) (GLuint framebuffer, GLuint start, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLRESOLVEDEPTHVALUESNVPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFramebufferSampleLocationsfvNV (GLenum target, GLuint start, GLsizei count, const GLfloat *v); +GLAPI void APIENTRY glNamedFramebufferSampleLocationsfvNV (GLuint framebuffer, GLuint start, GLsizei count, const GLfloat *v); +GLAPI void APIENTRY glResolveDepthValuesNV (void); +#endif +#endif /* GL_NV_sample_locations */ + +#ifndef GL_NV_sample_mask_override_coverage +#define GL_NV_sample_mask_override_coverage 1 +#endif /* GL_NV_sample_mask_override_coverage */ + #ifndef GL_NV_shader_atomic_counters #define GL_NV_shader_atomic_counters 1 #endif /* GL_NV_shader_atomic_counters */ @@ -9259,6 +10251,14 @@ GLAPI void APIENTRY glGetCombinerStageParameterfvNV (GLenum stage, GLenum pname, #define GL_NV_shader_atomic_float 1 #endif /* GL_NV_shader_atomic_float */ +#ifndef GL_NV_shader_atomic_fp16_vector +#define GL_NV_shader_atomic_fp16_vector 1 +#endif /* GL_NV_shader_atomic_fp16_vector */ + +#ifndef GL_NV_shader_atomic_int64 +#define GL_NV_shader_atomic_int64 1 +#endif /* GL_NV_shader_atomic_int64 */ + #ifndef GL_NV_shader_buffer_load #define GL_NV_shader_buffer_load 1 #define GL_BUFFER_GPU_ADDRESS_NV 0x8F1D @@ -9275,7 +10275,6 @@ typedef void (APIENTRYP PFNGLGETNAMEDBUFFERPARAMETERUI64VNVPROC) (GLuint buffer, typedef void (APIENTRYP PFNGLGETINTEGERUI64VNVPROC) (GLenum value, GLuint64EXT *result); typedef void (APIENTRYP PFNGLUNIFORMUI64NVPROC) (GLint location, GLuint64EXT value); typedef void (APIENTRYP PFNGLUNIFORMUI64VNVPROC) (GLint location, GLsizei count, const GLuint64EXT *value); -typedef void (APIENTRYP PFNGLGETUNIFORMUI64VNVPROC) (GLuint program, GLint location, GLuint64EXT *params); typedef void (APIENTRYP PFNGLPROGRAMUNIFORMUI64NVPROC) (GLuint program, GLint location, GLuint64EXT value); typedef void (APIENTRYP PFNGLPROGRAMUNIFORMUI64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); #ifdef GL_GLEXT_PROTOTYPES @@ -9290,7 +10289,6 @@ GLAPI void APIENTRY glGetNamedBufferParameterui64vNV (GLuint buffer, GLenum pnam GLAPI void APIENTRY glGetIntegerui64vNV (GLenum value, GLuint64EXT *result); GLAPI void APIENTRY glUniformui64NV (GLint location, GLuint64EXT value); GLAPI void APIENTRY glUniformui64vNV (GLint location, GLsizei count, const GLuint64EXT *value); -GLAPI void APIENTRY glGetUniformui64vNV (GLuint program, GLint location, GLuint64EXT *params); GLAPI void APIENTRY glProgramUniformui64NV (GLuint program, GLint location, GLuint64EXT value); GLAPI void APIENTRY glProgramUniformui64vNV (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); #endif @@ -9305,6 +10303,17 @@ GLAPI void APIENTRY glProgramUniformui64vNV (GLuint program, GLint location, GLs #define GL_NV_shader_storage_buffer_object 1 #endif /* GL_NV_shader_storage_buffer_object */ +#ifndef GL_NV_shader_thread_group +#define GL_NV_shader_thread_group 1 +#define GL_WARP_SIZE_NV 0x9339 +#define GL_WARPS_PER_SM_NV 0x933A +#define GL_SM_COUNT_NV 0x933B +#endif /* GL_NV_shader_thread_group */ + +#ifndef GL_NV_shader_thread_shuffle +#define GL_NV_shader_thread_shuffle 1 +#endif /* GL_NV_shader_thread_shuffle */ + #ifndef GL_NV_tessellation_program5 #define GL_NV_tessellation_program5 1 #define GL_MAX_PROGRAM_PATCH_ATTRIBS_NV 0x86D8 @@ -9519,7 +10528,7 @@ GLAPI void APIENTRY glTextureImage3DMultisampleCoverageNV (GLuint texture, GLenu #define GL_SKIP_COMPONENTS1_NV -6 typedef void (APIENTRYP PFNGLBEGINTRANSFORMFEEDBACKNVPROC) (GLenum primitiveMode); typedef void (APIENTRYP PFNGLENDTRANSFORMFEEDBACKNVPROC) (void); -typedef void (APIENTRYP PFNGLTRANSFORMFEEDBACKATTRIBSNVPROC) (GLuint count, const GLint *attribs, GLenum bufferMode); +typedef void (APIENTRYP PFNGLTRANSFORMFEEDBACKATTRIBSNVPROC) (GLsizei count, const GLint *attribs, GLenum bufferMode); typedef void (APIENTRYP PFNGLBINDBUFFERRANGENVPROC) (GLenum target, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size); typedef void (APIENTRYP PFNGLBINDBUFFEROFFSETNVPROC) (GLenum target, GLuint index, GLuint buffer, GLintptr offset); typedef void (APIENTRYP PFNGLBINDBUFFERBASENVPROC) (GLenum target, GLuint index, GLuint buffer); @@ -9532,7 +10541,7 @@ typedef void (APIENTRYP PFNGLTRANSFORMFEEDBACKSTREAMATTRIBSNVPROC) (GLsizei coun #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glBeginTransformFeedbackNV (GLenum primitiveMode); GLAPI void APIENTRY glEndTransformFeedbackNV (void); -GLAPI void APIENTRY glTransformFeedbackAttribsNV (GLuint count, const GLint *attribs, GLenum bufferMode); +GLAPI void APIENTRY glTransformFeedbackAttribsNV (GLsizei count, const GLint *attribs, GLenum bufferMode); GLAPI void APIENTRY glBindBufferRangeNV (GLenum target, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size); GLAPI void APIENTRY glBindBufferOffsetNV (GLenum target, GLuint index, GLuint buffer, GLintptr offset); GLAPI void APIENTRY glBindBufferBaseNV (GLenum target, GLuint index, GLuint buffer); @@ -9569,6 +10578,13 @@ GLAPI void APIENTRY glDrawTransformFeedbackNV (GLenum mode, GLuint id); #endif #endif /* GL_NV_transform_feedback2 */ +#ifndef GL_NV_uniform_buffer_unified_memory +#define GL_NV_uniform_buffer_unified_memory 1 +#define GL_UNIFORM_BUFFER_UNIFIED_NV 0x936E +#define GL_UNIFORM_BUFFER_ADDRESS_NV 0x936F +#define GL_UNIFORM_BUFFER_LENGTH_NV 0x9370 +#endif /* GL_NV_uniform_buffer_unified_memory */ + #ifndef GL_NV_vdpau_interop #define GL_NV_vdpau_interop 1 typedef GLintptr GLvdpauSurfaceNV; @@ -9576,22 +10592,22 @@ typedef GLintptr GLvdpauSurfaceNV; #define GL_SURFACE_REGISTERED_NV 0x86FD #define GL_SURFACE_MAPPED_NV 0x8700 #define GL_WRITE_DISCARD_NV 0x88BE -typedef void (APIENTRYP PFNGLVDPAUINITNVPROC) (const GLvoid *vdpDevice, const GLvoid *getProcAddress); +typedef void (APIENTRYP PFNGLVDPAUINITNVPROC) (const void *vdpDevice, const void *getProcAddress); typedef void (APIENTRYP PFNGLVDPAUFININVPROC) (void); -typedef GLvdpauSurfaceNV (APIENTRYP PFNGLVDPAUREGISTERVIDEOSURFACENVPROC) (const GLvoid *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames); -typedef GLvdpauSurfaceNV (APIENTRYP PFNGLVDPAUREGISTEROUTPUTSURFACENVPROC) (const GLvoid *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames); -typedef void (APIENTRYP PFNGLVDPAUISSURFACENVPROC) (GLvdpauSurfaceNV surface); +typedef GLvdpauSurfaceNV (APIENTRYP PFNGLVDPAUREGISTERVIDEOSURFACENVPROC) (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames); +typedef GLvdpauSurfaceNV (APIENTRYP PFNGLVDPAUREGISTEROUTPUTSURFACENVPROC) (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames); +typedef GLboolean (APIENTRYP PFNGLVDPAUISSURFACENVPROC) (GLvdpauSurfaceNV surface); typedef void (APIENTRYP PFNGLVDPAUUNREGISTERSURFACENVPROC) (GLvdpauSurfaceNV surface); typedef void (APIENTRYP PFNGLVDPAUGETSURFACEIVNVPROC) (GLvdpauSurfaceNV surface, GLenum pname, GLsizei bufSize, GLsizei *length, GLint *values); typedef void (APIENTRYP PFNGLVDPAUSURFACEACCESSNVPROC) (GLvdpauSurfaceNV surface, GLenum access); typedef void (APIENTRYP PFNGLVDPAUMAPSURFACESNVPROC) (GLsizei numSurfaces, const GLvdpauSurfaceNV *surfaces); typedef void (APIENTRYP PFNGLVDPAUUNMAPSURFACESNVPROC) (GLsizei numSurface, const GLvdpauSurfaceNV *surfaces); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glVDPAUInitNV (const GLvoid *vdpDevice, const GLvoid *getProcAddress); +GLAPI void APIENTRY glVDPAUInitNV (const void *vdpDevice, const void *getProcAddress); GLAPI void APIENTRY glVDPAUFiniNV (void); -GLAPI GLvdpauSurfaceNV APIENTRY glVDPAURegisterVideoSurfaceNV (const GLvoid *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames); -GLAPI GLvdpauSurfaceNV APIENTRY glVDPAURegisterOutputSurfaceNV (const GLvoid *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames); -GLAPI void APIENTRY glVDPAUIsSurfaceNV (GLvdpauSurfaceNV surface); +GLAPI GLvdpauSurfaceNV APIENTRY glVDPAURegisterVideoSurfaceNV (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames); +GLAPI GLvdpauSurfaceNV APIENTRY glVDPAURegisterOutputSurfaceNV (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames); +GLAPI GLboolean APIENTRY glVDPAUIsSurfaceNV (GLvdpauSurfaceNV surface); GLAPI void APIENTRY glVDPAUUnregisterSurfaceNV (GLvdpauSurfaceNV surface); GLAPI void APIENTRY glVDPAUGetSurfaceivNV (GLvdpauSurfaceNV surface, GLenum pname, GLsizei bufSize, GLsizei *length, GLint *values); GLAPI void APIENTRY glVDPAUSurfaceAccessNV (GLvdpauSurfaceNV surface, GLenum access); @@ -9608,10 +10624,10 @@ GLAPI void APIENTRY glVDPAUUnmapSurfacesNV (GLsizei numSurface, const GLvdpauSur #define GL_MAX_VERTEX_ARRAY_RANGE_ELEMENT_NV 0x8520 #define GL_VERTEX_ARRAY_RANGE_POINTER_NV 0x8521 typedef void (APIENTRYP PFNGLFLUSHVERTEXARRAYRANGENVPROC) (void); -typedef void (APIENTRYP PFNGLVERTEXARRAYRANGENVPROC) (GLsizei length, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLVERTEXARRAYRANGENVPROC) (GLsizei length, const void *pointer); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glFlushVertexArrayRangeNV (void); -GLAPI void APIENTRY glVertexArrayRangeNV (GLsizei length, const GLvoid *pointer); +GLAPI void APIENTRY glVertexArrayRangeNV (GLsizei length, const void *pointer); #endif #endif /* GL_NV_vertex_array_range */ @@ -9817,7 +10833,7 @@ typedef void (APIENTRYP PFNGLGETTRACKMATRIXIVNVPROC) (GLenum target, GLuint addr typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVNVPROC) (GLuint index, GLenum pname, GLdouble *params); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVNVPROC) (GLuint index, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVNVPROC) (GLuint index, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVNVPROC) (GLuint index, GLenum pname, GLvoid **pointer); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVNVPROC) (GLuint index, GLenum pname, void **pointer); typedef GLboolean (APIENTRYP PFNGLISPROGRAMNVPROC) (GLuint id); typedef void (APIENTRYP PFNGLLOADPROGRAMNVPROC) (GLenum target, GLuint id, GLsizei len, const GLubyte *program); typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4DNVPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); @@ -9828,7 +10844,7 @@ typedef void (APIENTRYP PFNGLPROGRAMPARAMETERS4DVNVPROC) (GLenum target, GLuint typedef void (APIENTRYP PFNGLPROGRAMPARAMETERS4FVNVPROC) (GLenum target, GLuint index, GLsizei count, const GLfloat *v); typedef void (APIENTRYP PFNGLREQUESTRESIDENTPROGRAMSNVPROC) (GLsizei n, const GLuint *programs); typedef void (APIENTRYP PFNGLTRACKMATRIXNVPROC) (GLenum target, GLuint address, GLenum matrix, GLenum transform); -typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERNVPROC) (GLuint index, GLint fsize, GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERNVPROC) (GLuint index, GLint fsize, GLenum type, GLsizei stride, const void *pointer); typedef void (APIENTRYP PFNGLVERTEXATTRIB1DNVPROC) (GLuint index, GLdouble x); typedef void (APIENTRYP PFNGLVERTEXATTRIB1DVNVPROC) (GLuint index, const GLdouble *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB1FNVPROC) (GLuint index, GLfloat x); @@ -9882,7 +10898,7 @@ GLAPI void APIENTRY glGetTrackMatrixivNV (GLenum target, GLuint address, GLenum GLAPI void APIENTRY glGetVertexAttribdvNV (GLuint index, GLenum pname, GLdouble *params); GLAPI void APIENTRY glGetVertexAttribfvNV (GLuint index, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetVertexAttribivNV (GLuint index, GLenum pname, GLint *params); -GLAPI void APIENTRY glGetVertexAttribPointervNV (GLuint index, GLenum pname, GLvoid **pointer); +GLAPI void APIENTRY glGetVertexAttribPointervNV (GLuint index, GLenum pname, void **pointer); GLAPI GLboolean APIENTRY glIsProgramNV (GLuint id); GLAPI void APIENTRY glLoadProgramNV (GLenum target, GLuint id, GLsizei len, const GLubyte *program); GLAPI void APIENTRY glProgramParameter4dNV (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); @@ -9893,7 +10909,7 @@ GLAPI void APIENTRY glProgramParameters4dvNV (GLenum target, GLuint index, GLsiz GLAPI void APIENTRY glProgramParameters4fvNV (GLenum target, GLuint index, GLsizei count, const GLfloat *v); GLAPI void APIENTRY glRequestResidentProgramsNV (GLsizei n, const GLuint *programs); GLAPI void APIENTRY glTrackMatrixNV (GLenum target, GLuint address, GLenum matrix, GLenum transform); -GLAPI void APIENTRY glVertexAttribPointerNV (GLuint index, GLint fsize, GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glVertexAttribPointerNV (GLuint index, GLint fsize, GLenum type, GLsizei stride, const void *pointer); GLAPI void APIENTRY glVertexAttrib1dNV (GLuint index, GLdouble x); GLAPI void APIENTRY glVertexAttrib1dvNV (GLuint index, const GLdouble *v); GLAPI void APIENTRY glVertexAttrib1fNV (GLuint index, GLfloat x); @@ -9975,7 +10991,7 @@ typedef void (APIENTRYP PFNGLVERTEXATTRIBI4BVEXTPROC) (GLuint index, const GLbyt typedef void (APIENTRYP PFNGLVERTEXATTRIBI4SVEXTPROC) (GLuint index, const GLshort *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBI4UBVEXTPROC) (GLuint index, const GLubyte *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBI4USVEXTPROC) (GLuint index, const GLushort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBIPOINTEREXTPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLVERTEXATTRIBIPOINTEREXTPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const void *pointer); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIIVEXTPROC) (GLuint index, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIUIVEXTPROC) (GLuint index, GLenum pname, GLuint *params); #ifdef GL_GLEXT_PROTOTYPES @@ -9999,7 +11015,7 @@ GLAPI void APIENTRY glVertexAttribI4bvEXT (GLuint index, const GLbyte *v); GLAPI void APIENTRY glVertexAttribI4svEXT (GLuint index, const GLshort *v); GLAPI void APIENTRY glVertexAttribI4ubvEXT (GLuint index, const GLubyte *v); GLAPI void APIENTRY glVertexAttribI4usvEXT (GLuint index, const GLushort *v); -GLAPI void APIENTRY glVertexAttribIPointerEXT (GLuint index, GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glVertexAttribIPointerEXT (GLuint index, GLint size, GLenum type, GLsizei stride, const void *pointer); GLAPI void APIENTRY glGetVertexAttribIivEXT (GLuint index, GLenum pname, GLint *params); GLAPI void APIENTRY glGetVertexAttribIuivEXT (GLuint index, GLenum pname, GLuint *params); #endif @@ -10064,6 +11080,10 @@ GLAPI void APIENTRY glVideoCaptureStreamParameterdvNV (GLuint video_capture_slot #endif #endif /* GL_NV_video_capture */ +#ifndef GL_NV_viewport_array2 +#define GL_NV_viewport_array2 1 +#endif /* GL_NV_viewport_array2 */ + #ifndef GL_OML_interlace #define GL_OML_interlace 1 #define GL_INTERLACE_OML 0x8980 @@ -10086,6 +11106,21 @@ GLAPI void APIENTRY glVideoCaptureStreamParameterdvNV (GLuint video_capture_slot #define GL_FORMAT_SUBSAMPLE_244_244_OML 0x8983 #endif /* GL_OML_subsample */ +#ifndef GL_OVR_multiview +#define GL_OVR_multiview 1 +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_NUM_VIEWS_OVR 0x9630 +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_BASE_VIEW_INDEX_OVR 0x9632 +#define GL_MAX_VIEWS_OVR 0x9631 +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREMULTIVIEWOVRPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint baseViewIndex, GLsizei numViews); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFramebufferTextureMultiviewOVR (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint baseViewIndex, GLsizei numViews); +#endif +#endif /* GL_OVR_multiview */ + +#ifndef GL_OVR_multiview2 +#define GL_OVR_multiview2 1 +#endif /* GL_OVR_multiview2 */ + #ifndef GL_PGI_misc_hints #define GL_PGI_misc_hints 1 #define GL_PREFER_DOUBLEBUFFER_HINT_PGI 0x1A1F8 @@ -10293,11 +11328,11 @@ GLAPI void APIENTRY glGetSharpenTexFuncSGIS (GLenum target, GLfloat *points); #define GL_TEXTURE_WRAP_Q_SGIS 0x8137 #define GL_MAX_4D_TEXTURE_SIZE_SGIS 0x8138 #define GL_TEXTURE_4D_BINDING_SGIS 0x814F -typedef void (APIENTRYP PFNGLTEXIMAGE4DSGISPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLTEXSUBIMAGE4DSGISPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint woffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLTEXIMAGE4DSGISPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXSUBIMAGE4DSGISPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint woffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLenum format, GLenum type, const void *pixels); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glTexImage4DSGIS (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -GLAPI void APIENTRY glTexSubImage4DSGIS (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint woffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLenum format, GLenum type, const GLvoid *pixels); +GLAPI void APIENTRY glTexImage4DSGIS (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTexSubImage4DSGIS (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint woffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLenum format, GLenum type, const void *pixels); #endif #endif /* GL_SGIS_texture4D */ @@ -10533,9 +11568,9 @@ GLAPI void APIENTRY glFrameZoomSGIX (GLint factor); #ifndef GL_SGIX_igloo_interface #define GL_SGIX_igloo_interface 1 -typedef void (APIENTRYP PFNGLIGLOOINTERFACESGIXPROC) (GLenum pname, const GLvoid *params); +typedef void (APIENTRYP PFNGLIGLOOINTERFACESGIXPROC) (GLenum pname, const void *params); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glIglooInterfaceSGIX (GLenum pname, const GLvoid *params); +GLAPI void APIENTRY glIglooInterfaceSGIX (GLenum pname, const void *params); #endif #endif /* GL_SGIX_igloo_interface */ @@ -10642,10 +11677,10 @@ GLAPI void APIENTRY glReferencePlaneSGIX (const GLdouble *equation); #ifndef GL_SGIX_resample #define GL_SGIX_resample 1 -#define GL_PACK_RESAMPLE_SGIX 0x842C -#define GL_UNPACK_RESAMPLE_SGIX 0x842D -#define GL_RESAMPLE_REPLICATE_SGIX 0x842E -#define GL_RESAMPLE_ZERO_FILL_SGIX 0x842F +#define GL_PACK_RESAMPLE_SGIX 0x842E +#define GL_UNPACK_RESAMPLE_SGIX 0x842F +#define GL_RESAMPLE_REPLICATE_SGIX 0x8433 +#define GL_RESAMPLE_ZERO_FILL_SGIX 0x8434 #define GL_RESAMPLE_DECIMATE_SGIX 0x8430 #endif /* GL_SGIX_resample */ @@ -10792,19 +11827,19 @@ GLAPI void APIENTRY glTagSampleBufferSGIX (void); #define GL_COLOR_TABLE_ALPHA_SIZE_SGI 0x80DD #define GL_COLOR_TABLE_LUMINANCE_SIZE_SGI 0x80DE #define GL_COLOR_TABLE_INTENSITY_SIZE_SGI 0x80DF -typedef void (APIENTRYP PFNGLCOLORTABLESGIPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *table); +typedef void (APIENTRYP PFNGLCOLORTABLESGIPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const void *table); typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERFVSGIPROC) (GLenum target, GLenum pname, const GLfloat *params); typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERIVSGIPROC) (GLenum target, GLenum pname, const GLint *params); typedef void (APIENTRYP PFNGLCOPYCOLORTABLESGIPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); -typedef void (APIENTRYP PFNGLGETCOLORTABLESGIPROC) (GLenum target, GLenum format, GLenum type, GLvoid *table); +typedef void (APIENTRYP PFNGLGETCOLORTABLESGIPROC) (GLenum target, GLenum format, GLenum type, void *table); typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVSGIPROC) (GLenum target, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVSGIPROC) (GLenum target, GLenum pname, GLint *params); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glColorTableSGI (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *table); +GLAPI void APIENTRY glColorTableSGI (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const void *table); GLAPI void APIENTRY glColorTableParameterfvSGI (GLenum target, GLenum pname, const GLfloat *params); GLAPI void APIENTRY glColorTableParameterivSGI (GLenum target, GLenum pname, const GLint *params); GLAPI void APIENTRY glCopyColorTableSGI (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); -GLAPI void APIENTRY glGetColorTableSGI (GLenum target, GLenum format, GLenum type, GLvoid *table); +GLAPI void APIENTRY glGetColorTableSGI (GLenum target, GLenum format, GLenum type, void *table); GLAPI void APIENTRY glGetColorTableParameterfvSGI (GLenum target, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetColorTableParameterivSGI (GLenum target, GLenum pname, GLint *params); #endif @@ -10895,7 +11930,7 @@ typedef void (APIENTRYP PFNGLREPLACEMENTCODEUBSUNPROC) (GLubyte code); typedef void (APIENTRYP PFNGLREPLACEMENTCODEUIVSUNPROC) (const GLuint *code); typedef void (APIENTRYP PFNGLREPLACEMENTCODEUSVSUNPROC) (const GLushort *code); typedef void (APIENTRYP PFNGLREPLACEMENTCODEUBVSUNPROC) (const GLubyte *code); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEPOINTERSUNPROC) (GLenum type, GLsizei stride, const GLvoid **pointer); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEPOINTERSUNPROC) (GLenum type, GLsizei stride, const void **pointer); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glReplacementCodeuiSUN (GLuint code); GLAPI void APIENTRY glReplacementCodeusSUN (GLushort code); @@ -10903,7 +11938,7 @@ GLAPI void APIENTRY glReplacementCodeubSUN (GLubyte code); GLAPI void APIENTRY glReplacementCodeuivSUN (const GLuint *code); GLAPI void APIENTRY glReplacementCodeusvSUN (const GLushort *code); GLAPI void APIENTRY glReplacementCodeubvSUN (const GLubyte *code); -GLAPI void APIENTRY glReplacementCodePointerSUN (GLenum type, GLsizei stride, const GLvoid **pointer); +GLAPI void APIENTRY glReplacementCodePointerSUN (GLenum type, GLsizei stride, const void **pointer); #endif #endif /* GL_SUN_triangle_list */ From 09c8a41294d7c852f1770e0f66629a71b23acae1 Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Miguel=20A=2E=20Col=C3=B3n=20V=C3=A9lez?= Date: Sat, 22 Aug 2015 10:16:27 -0400 Subject: [PATCH 4/5] Update SoundTouch to 1.9.0. It claimed to be 1.7.1 but it had a mixture from various versions. It was hard to update as everything in the top directory so I used upstream's way to organize files. I renamed include to soundtouch since I did not want to #ifdef that for windows. . Wavfile.h is a private header so I used the private path instead of moving the file over. This changed 3 files in the plugin folder. --- 3rdparty/soundtouch/3dnow_win.cpp | 349 ------ 3rdparty/soundtouch/COPYING.TXT | 458 ++++++++ 3rdparty/soundtouch/Makefile.am | 71 -- 3rdparty/soundtouch/README.html | 316 ++++-- 3rdparty/soundtouch/RateTransposer.cpp | 626 ----------- 3rdparty/soundtouch/SoundTouch.vcxproj | 132 +-- .../soundtouch/SoundTouch.vcxproj.filters | 68 +- 3rdparty/soundtouch/WavFile.cpp | 745 ------------- 3rdparty/soundtouch/build.sh | 28 - 3rdparty/soundtouch/configure.ac | 37 - 3rdparty/soundtouch/cpu_detect_x86_gcc.cpp | 134 --- 3rdparty/soundtouch/cpu_detect_x86_win.cpp | 137 --- 3rdparty/soundtouch/depcomp | 1 - 3rdparty/soundtouch/install-sh | 1 - 3rdparty/soundtouch/missing | 1 - .../soundtouch/{ => soundtouch}/BPMDetect.h | 2 +- .../{ => soundtouch}/FIFOSampleBuffer.h | 10 +- .../{ => soundtouch}/FIFOSamplePipe.h | 2 +- .../soundtouch/{ => soundtouch}/STTypes.h | 24 +- .../soundtouch/{ => soundtouch}/SoundTouch.h | 14 +- 3rdparty/soundtouch/soundtouch_config.h | 7 - .../source/SoundStretch/WavFile.cpp | 997 ++++++++++++++++++ .../{ => source/SoundStretch}/WavFile.h | 83 +- .../{ => source/SoundTouch}/AAFilter.cpp | 66 +- .../{ => source/SoundTouch}/AAFilter.h | 13 +- .../{ => source/SoundTouch}/BPMDetect.cpp | 5 +- .../SoundTouch}/FIFOSampleBuffer.cpp | 2 +- .../{ => source/SoundTouch}/FIRFilter.cpp | 105 +- .../{ => source/SoundTouch}/FIRFilter.h | 7 +- .../source/SoundTouch/InterpolateCubic.cpp | 200 ++++ .../source/SoundTouch/InterpolateCubic.h | 67 ++ .../source/SoundTouch/InterpolateLinear.cpp | 299 ++++++ .../source/SoundTouch/InterpolateLinear.h | 92 ++ .../source/SoundTouch/InterpolateShannon.cpp | 185 ++++ .../source/SoundTouch/InterpolateShannon.h | 72 ++ .../{ => source/SoundTouch}/PeakFinder.cpp | 20 +- .../{ => source/SoundTouch}/PeakFinder.h | 2 +- .../source/SoundTouch/RateTransposer.cpp | 302 ++++++ .../{ => source/SoundTouch}/RateTransposer.h | 90 +- .../{ => source/SoundTouch}/SoundTouch.cpp | 47 +- .../{ => source/SoundTouch}/TDStretch.cpp | 244 ++++- .../{ => source/SoundTouch}/TDStretch.h | 24 +- .../{ => source/SoundTouch}/cpu_detect.h | 2 +- .../SoundTouch}/cpu_detect_x86.cpp | 25 +- .../{ => source/SoundTouch}/mmx_optimized.cpp | 102 +- .../{ => source/SoundTouch}/sse_optimized.cpp | 31 +- PCSX2_suite.sln | 21 +- common/vsprops/3rdpartyDeps.props | 2 +- old_plugins.sln | 9 +- plugins/spu2-x/src/Wavedump_wav.cpp | 2 +- plugins/zerospu2/zerospu2.cpp | 2 +- plugins/zerospu2/zeroworker.cpp | 2 +- 52 files changed, 3677 insertions(+), 2606 deletions(-) delete mode 100644 3rdparty/soundtouch/3dnow_win.cpp create mode 100644 3rdparty/soundtouch/COPYING.TXT delete mode 100644 3rdparty/soundtouch/Makefile.am delete mode 100644 3rdparty/soundtouch/RateTransposer.cpp delete mode 100644 3rdparty/soundtouch/WavFile.cpp delete mode 100644 3rdparty/soundtouch/build.sh delete mode 100644 3rdparty/soundtouch/configure.ac delete mode 100644 3rdparty/soundtouch/cpu_detect_x86_gcc.cpp delete mode 100644 3rdparty/soundtouch/cpu_detect_x86_win.cpp delete mode 120000 3rdparty/soundtouch/depcomp delete mode 120000 3rdparty/soundtouch/install-sh delete mode 120000 3rdparty/soundtouch/missing rename 3rdparty/soundtouch/{ => soundtouch}/BPMDetect.h (98%) rename 3rdparty/soundtouch/{ => soundtouch}/FIFOSampleBuffer.h (96%) rename 3rdparty/soundtouch/{ => soundtouch}/FIFOSamplePipe.h (99%) rename 3rdparty/soundtouch/{ => soundtouch}/STTypes.h (91%) rename 3rdparty/soundtouch/{ => soundtouch}/SoundTouch.h (96%) delete mode 100644 3rdparty/soundtouch/soundtouch_config.h create mode 100644 3rdparty/soundtouch/source/SoundStretch/WavFile.cpp rename 3rdparty/soundtouch/{ => source/SoundStretch}/WavFile.h (82%) rename 3rdparty/soundtouch/{ => source/SoundTouch}/AAFilter.cpp (73%) rename 3rdparty/soundtouch/{ => source/SoundTouch}/AAFilter.h (84%) rename 3rdparty/soundtouch/{ => source/SoundTouch}/BPMDetect.cpp (98%) rename 3rdparty/soundtouch/{ => source/SoundTouch}/FIFOSampleBuffer.cpp (99%) rename 3rdparty/soundtouch/{ => source/SoundTouch}/FIRFilter.cpp (76%) rename 3rdparty/soundtouch/{ => source/SoundTouch}/FIRFilter.h (94%) create mode 100644 3rdparty/soundtouch/source/SoundTouch/InterpolateCubic.cpp create mode 100644 3rdparty/soundtouch/source/SoundTouch/InterpolateCubic.h create mode 100644 3rdparty/soundtouch/source/SoundTouch/InterpolateLinear.cpp create mode 100644 3rdparty/soundtouch/source/SoundTouch/InterpolateLinear.h create mode 100644 3rdparty/soundtouch/source/SoundTouch/InterpolateShannon.cpp create mode 100644 3rdparty/soundtouch/source/SoundTouch/InterpolateShannon.h rename 3rdparty/soundtouch/{ => source/SoundTouch}/PeakFinder.cpp (93%) rename 3rdparty/soundtouch/{ => source/SoundTouch}/PeakFinder.h (98%) create mode 100644 3rdparty/soundtouch/source/SoundTouch/RateTransposer.cpp rename 3rdparty/soundtouch/{ => source/SoundTouch}/RateTransposer.h (72%) rename 3rdparty/soundtouch/{ => source/SoundTouch}/SoundTouch.cpp (94%) rename 3rdparty/soundtouch/{ => source/SoundTouch}/TDStretch.cpp (78%) rename 3rdparty/soundtouch/{ => source/SoundTouch}/TDStretch.h (92%) rename 3rdparty/soundtouch/{ => source/SoundTouch}/cpu_detect.h (97%) rename 3rdparty/soundtouch/{ => source/SoundTouch}/cpu_detect_x86.cpp (90%) rename 3rdparty/soundtouch/{ => source/SoundTouch}/mmx_optimized.cpp (74%) rename 3rdparty/soundtouch/{ => source/SoundTouch}/sse_optimized.cpp (93%) diff --git a/3rdparty/soundtouch/3dnow_win.cpp b/3rdparty/soundtouch/3dnow_win.cpp deleted file mode 100644 index aaa1b3811c..0000000000 --- a/3rdparty/soundtouch/3dnow_win.cpp +++ /dev/null @@ -1,349 +0,0 @@ -//////////////////////////////////////////////////////////////////////////////// -/// -/// Win32 version of the AMD 3DNow! optimized routines for AMD K6-2/Athlon -/// processors. All 3DNow! optimized functions have been gathered into this -/// single source code file, regardless to their class or original source code -/// file, in order to ease porting the library to other compiler and processor -/// platforms. -/// -/// By the way; the performance gain depends heavily on the CPU generation: On -/// K6-2 these routines provided speed-up of even 2.4 times, while on Athlon the -/// difference to the original routines stayed at unremarkable 8%! Such a small -/// improvement on Athlon is due to 3DNow can perform only two operations in -/// parallel, and obviously also the Athlon FPU is doing a very good job with -/// the standard C floating point routines! Here these routines are anyway, -/// although it might not be worth the effort to convert these to GCC platform, -/// for Athlon CPU at least. The situation is different regarding the SSE -/// optimizations though, thanks to the four parallel operations of SSE that -/// already make a difference. -/// -/// This file is to be compiled in Windows platform with Microsoft Visual C++ -/// Compiler. Please see '3dnow_gcc.cpp' for the gcc compiler version for all -/// GNU platforms (if file supplied). -/// -/// NOTICE: If using Visual Studio 6.0, you'll need to install the "Visual C++ -/// 6.0 processor pack" update to support 3DNow! instruction set. The update is -/// available for download at Microsoft Developers Network, see here: -/// http://msdn.microsoft.com/en-us/vstudio/aa718349.aspx -/// -/// If the above URL is expired or removed, go to "http://msdn.microsoft.com" and -/// perform a search with keywords "processor pack". -/// -/// Author : Copyright (c) Olli Parviainen -/// Author e-mail : oparviai 'at' iki.fi -/// SoundTouch WWW: http://www.surina.net/soundtouch -/// -//////////////////////////////////////////////////////////////////////////////// -// -// Last changed : $Date: 2009-02-21 18:00:14 +0200 (Sat, 21 Feb 2009) $ -// File revision : $Revision: 4 $ -// -// $Id: 3dnow_win.cpp 63 2009-02-21 16:00:14Z oparviai $ -// -//////////////////////////////////////////////////////////////////////////////// -// -// License : -// -// SoundTouch audio processing library -// Copyright (c) Olli Parviainen -// -// This library is free software; you can redistribute it and/or -// modify it under the terms of the GNU Lesser General Public -// License as published by the Free Software Foundation; either -// version 2.1 of the License, or (at your option) any later version. -// -// This library is distributed in the hope that it will be useful, -// but WITHOUT ANY WARRANTY; without even the implied warranty of -// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU -// Lesser General Public License for more details. -// -// You should have received a copy of the GNU Lesser General Public -// License along with this library; if not, write to the Free Software -// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA -// -//////////////////////////////////////////////////////////////////////////////// - -#include "cpu_detect.h" -#include "STTypes.h" - -#ifndef WIN32 -#error "wrong platform - this source code file is exclusively for Win32 platform" -#endif - -using namespace soundtouch; - -#ifdef ALLOW_3DNOW -// 3DNow! routines available only with float sample type - -////////////////////////////////////////////////////////////////////////////// -// -// implementation of 3DNow! optimized functions of class 'TDStretch3DNow' -// -////////////////////////////////////////////////////////////////////////////// - -#include "TDStretch.h" - - -// Calculates cross correlation of two buffers -double TDStretch3DNow::calcCrossCorrStereo(const float *pV1, const float *pV2) const -{ - int overlapLengthLocal = overlapLength; - float corr = 0; - - // Calculates the cross-correlation value between 'pV1' and 'pV2' vectors - /* - c-pseudocode: - - corr = 0; - for (i = 0; i < overlapLength / 4; i ++) - { - corr += pV1[0] * pV2[0]; - pV1[1] * pV2[1]; - pV1[2] * pV2[2]; - pV1[3] * pV2[3]; - pV1[4] * pV2[4]; - pV1[5] * pV2[5]; - pV1[6] * pV2[6]; - pV1[7] * pV2[7]; - - pV1 += 8; - pV2 += 8; - } - */ - - _asm - { - // give prefetch hints to CPU of what data are to be needed soonish. - // give more aggressive hints on pV1 as that changes more between different calls - // while pV2 stays the same. - prefetch [pV1] - prefetch [pV2] - prefetch [pV1 + 32] - - mov eax, dword ptr pV2 - mov ebx, dword ptr pV1 - - pxor mm0, mm0 - - mov ecx, overlapLengthLocal - shr ecx, 2 // div by four - - loop1: - movq mm1, [eax] - prefetch [eax + 32] // give a prefetch hint to CPU what data are to be needed soonish - pfmul mm1, [ebx] - prefetch [ebx + 64] // give a prefetch hint to CPU what data are to be needed soonish - - movq mm2, [eax + 8] - pfadd mm0, mm1 - pfmul mm2, [ebx + 8] - - movq mm3, [eax + 16] - pfadd mm0, mm2 - pfmul mm3, [ebx + 16] - - movq mm4, [eax + 24] - pfadd mm0, mm3 - pfmul mm4, [ebx + 24] - - add eax, 32 - pfadd mm0, mm4 - add ebx, 32 - - dec ecx - jnz loop1 - - // add halfs of mm0 together and return the result. - // note: mm1 is used as a dummy parameter only, we actually don't care about it's value - pfacc mm0, mm1 - movd corr, mm0 - femms - } - - return corr; -} - - - - -////////////////////////////////////////////////////////////////////////////// -// -// implementation of 3DNow! optimized functions of class 'FIRFilter' -// -////////////////////////////////////////////////////////////////////////////// - -#include "FIRFilter.h" - -FIRFilter3DNow::FIRFilter3DNow() : FIRFilter() -{ - filterCoeffsUnalign = NULL; - filterCoeffsAlign = NULL; -} - - -FIRFilter3DNow::~FIRFilter3DNow() -{ - delete[] filterCoeffsUnalign; - filterCoeffsUnalign = NULL; - filterCoeffsAlign = NULL; -} - - -// (overloaded) Calculates filter coefficients for 3DNow! routine -void FIRFilter3DNow::setCoefficients(const float *coeffs, uint newLength, uint uResultDivFactor) -{ - uint i; - float fDivider; - - FIRFilter::setCoefficients(coeffs, newLength, uResultDivFactor); - - // Scale the filter coefficients so that it won't be necessary to scale the filtering result - // also rearrange coefficients suitably for 3DNow! - // Ensure that filter coeffs array is aligned to 16-byte boundary - delete[] filterCoeffsUnalign; - filterCoeffsUnalign = new float[2 * newLength + 4]; - filterCoeffsAlign = (float *)(((uint)filterCoeffsUnalign + 15) & (uint)-16); - - fDivider = (float)resultDivider; - - // rearrange the filter coefficients for mmx routines - for (i = 0; i < newLength; i ++) - { - filterCoeffsAlign[2 * i + 0] = - filterCoeffsAlign[2 * i + 1] = coeffs[i + 0] / fDivider; - } -} - - -// 3DNow!-optimized version of the filter routine for stereo sound -uint FIRFilter3DNow::evaluateFilterStereo(float *dest, const float *src, uint numSamples) const -{ - float *filterCoeffsLocal = filterCoeffsAlign; - uint count = (numSamples - length) & (uint)-2; - uint lengthLocal = length / 4; - - assert(length != 0); - assert(count % 2 == 0); - - /* original code: - - double suml1, suml2; - double sumr1, sumr2; - uint i, j; - - for (j = 0; j < count; j += 2) - { - const float *ptr; - - suml1 = sumr1 = 0.0; - suml2 = sumr2 = 0.0; - ptr = src; - filterCoeffsLocal = filterCoeffs; - for (i = 0; i < lengthLocal; i ++) - { - // unroll loop for efficiency. - - suml1 += ptr[0] * filterCoeffsLocal[0] + - ptr[2] * filterCoeffsLocal[2] + - ptr[4] * filterCoeffsLocal[4] + - ptr[6] * filterCoeffsLocal[6]; - - sumr1 += ptr[1] * filterCoeffsLocal[1] + - ptr[3] * filterCoeffsLocal[3] + - ptr[5] * filterCoeffsLocal[5] + - ptr[7] * filterCoeffsLocal[7]; - - suml2 += ptr[8] * filterCoeffsLocal[0] + - ptr[10] * filterCoeffsLocal[2] + - ptr[12] * filterCoeffsLocal[4] + - ptr[14] * filterCoeffsLocal[6]; - - sumr2 += ptr[9] * filterCoeffsLocal[1] + - ptr[11] * filterCoeffsLocal[3] + - ptr[13] * filterCoeffsLocal[5] + - ptr[15] * filterCoeffsLocal[7]; - - ptr += 16; - filterCoeffsLocal += 8; - } - dest[0] = (float)suml1; - dest[1] = (float)sumr1; - dest[2] = (float)suml2; - dest[3] = (float)sumr2; - - src += 4; - dest += 4; - } - - */ - _asm - { - mov eax, dword ptr dest - mov ebx, dword ptr src - mov edx, count - shr edx, 1 - - loop1: - // "outer loop" : during each round 2*2 output samples are calculated - prefetch [ebx] // give a prefetch hint to CPU what data are to be needed soonish - prefetch [filterCoeffsLocal] // give a prefetch hint to CPU what data are to be needed soonish - - mov esi, ebx - mov edi, filterCoeffsLocal - pxor mm0, mm0 - pxor mm1, mm1 - mov ecx, lengthLocal - - loop2: - // "inner loop" : during each round four FIR filter taps are evaluated for 2*2 output samples - movq mm2, [edi] - movq mm3, mm2 - prefetch [edi + 32] // give a prefetch hint to CPU what data are to be needed soonish - pfmul mm2, [esi] - prefetch [esi + 32] // give a prefetch hint to CPU what data are to be needed soonish - pfmul mm3, [esi + 8] - - movq mm4, [edi + 8] - movq mm5, mm4 - pfadd mm0, mm2 - pfmul mm4, [esi + 8] - pfadd mm1, mm3 - pfmul mm5, [esi + 16] - - movq mm2, [edi + 16] - movq mm6, mm2 - pfadd mm0, mm4 - pfmul mm2, [esi + 16] - pfadd mm1, mm5 - pfmul mm6, [esi + 24] - - movq mm3, [edi + 24] - movq mm7, mm3 - pfadd mm0, mm2 - pfmul mm3, [esi + 24] - pfadd mm1, mm6 - pfmul mm7, [esi + 32] - add esi, 32 - pfadd mm0, mm3 - add edi, 32 - pfadd mm1, mm7 - - dec ecx - jnz loop2 - - movq [eax], mm0 - add ebx, 16 - movq [eax + 8], mm1 - add eax, 16 - - dec edx - jnz loop1 - - femms - } - - return count; -} - - -#endif // ALLOW_3DNOW diff --git a/3rdparty/soundtouch/COPYING.TXT b/3rdparty/soundtouch/COPYING.TXT new file mode 100644 index 0000000000..5b2161be20 --- /dev/null +++ b/3rdparty/soundtouch/COPYING.TXT @@ -0,0 +1,458 @@ + GNU LESSER GENERAL PUBLIC LICENSE + Version 2.1, February 1999 + + Copyright (C) 1991, 1999 Free Software Foundation, Inc. + 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA + Everyone is permitted to copy and distribute verbatim copies + of this license document, but changing it is not allowed. + +[This is the first released version of the Lesser GPL. It also counts + as the successor of the GNU Library Public License, version 2, hence + the version number 2.1.] + + Preamble + + The licenses for most software are designed to take away your +freedom to share and change it. By contrast, the GNU General Public +Licenses are intended to guarantee your freedom to share and change +free software--to make sure the software is free for all its users. + + This license, the Lesser General Public License, applies to some +specially designated software packages--typically libraries--of the +Free Software Foundation and other authors who decide to use it. You +can use it too, but we suggest you first think carefully about whether +this license or the ordinary General Public License is the better +strategy to use in any particular case, based on the explanations below. + + When we speak of free software, we are referring to freedom of use, +not price. Our General Public Licenses are designed to make sure that +you have the freedom to distribute copies of free software (and charge +for this service if you wish); that you receive source code or can get +it if you want it; that you can change the software and use pieces of +it in new free programs; and that you are informed that you can do +these things. + + To protect your rights, we need to make restrictions that forbid +distributors to deny you these rights or to ask you to surrender these +rights. These restrictions translate to certain responsibilities for +you if you distribute copies of the library or if you modify it. + + For example, if you distribute copies of the library, whether gratis +or for a fee, you must give the recipients all the rights that we gave +you. You must make sure that they, too, receive or can get the source +code. If you link other code with the library, you must provide +complete object files to the recipients, so that they can relink them +with the library after making changes to the library and recompiling +it. And you must show them these terms so they know their rights. + + We protect your rights with a two-step method: (1) we copyright the +library, and (2) we offer you this license, which gives you legal +permission to copy, distribute and/or modify the library. + + To protect each distributor, we want to make it very clear that +there is no warranty for the free library. Also, if the library is +modified by someone else and passed on, the recipients should know +that what they have is not the original version, so that the original +author's reputation will not be affected by problems that might be +introduced by others. + + Finally, software patents pose a constant threat to the existence of +any free program. We wish to make sure that a company cannot +effectively restrict the users of a free program by obtaining a +restrictive license from a patent holder. Therefore, we insist that +any patent license obtained for a version of the library must be +consistent with the full freedom of use specified in this license. + + Most GNU software, including some libraries, is covered by the +ordinary GNU General Public License. This license, the GNU Lesser +General Public License, applies to certain designated libraries, and +is quite different from the ordinary General Public License. We use +this license for certain libraries in order to permit linking those +libraries into non-free programs. + + When a program is linked with a library, whether statically or using +a shared library, the combination of the two is legally speaking a +combined work, a derivative of the original library. The ordinary +General Public License therefore permits such linking only if the +entire combination fits its criteria of freedom. The Lesser General +Public License permits more lax criteria for linking other code with +the library. + + We call this license the "Lesser" General Public License because it +does Less to protect the user's freedom than the ordinary General +Public License. It also provides other free software developers Less +of an advantage over competing non-free programs. These disadvantages +are the reason we use the ordinary General Public License for many +libraries. However, the Lesser license provides advantages in certain +special circumstances. + + For example, on rare occasions, there may be a special need to +encourage the widest possible use of a certain library, so that it becomes +a de-facto standard. To achieve this, non-free programs must be +allowed to use the library. A more frequent case is that a free +library does the same job as widely used non-free libraries. In this +case, there is little to gain by limiting the free library to free +software only, so we use the Lesser General Public License. + + In other cases, permission to use a particular library in non-free +programs enables a greater number of people to use a large body of +free software. For example, permission to use the GNU C Library in +non-free programs enables many more people to use the whole GNU +operating system, as well as its variant, the GNU/Linux operating +system. + + Although the Lesser General Public License is Less protective of the +users' freedom, it does ensure that the user of a program that is +linked with the Library has the freedom and the wherewithal to run +that program using a modified version of the Library. + + The precise terms and conditions for copying, distribution and +modification follow. Pay close attention to the difference between a +"work based on the library" and a "work that uses the library". The +former contains code derived from the library, whereas the latter must +be combined with the library in order to run. + + GNU LESSER GENERAL PUBLIC LICENSE + TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION + + 0. This License Agreement applies to any software library or other +program which contains a notice placed by the copyright holder or +other authoried party saying it may be distributed under the terms of +this Lesser General Public License (also called "this License"). +Each licensee is addressed as "you". + + A "library" means a collection of software functions and/or data +prepared so as to be conveniently linked with application programs +(which use some of those functions and data) to form executables. + + The "Library", below, refers to any such software library or work +which has been distributed under these terms. A "work based on the +Library" means either the Library or any derivative work under +copyright law: that is to say, a work containing the Library or a +portion of it, either verbatim or with modifications and/or translated +straightforwardly into another language. (Hereinafter, translation is +included without limitation in the term "modification".) + + "Source code" for a work means the preferred form of the work for +making modifications to it. For a library, complete source code means +all the source code for all modules it contains, plus any associated +interface definition files, plus the scripts used to control compilation +and installation of the library. + + Activities other than copying, distribution and modification are not +covered by this License; they are outside its scope. The act of +running a program using the Library is not restricted, and output from +such a program is covered only if its contents constitute a work based +on the Library (independent of the use of the Library in a tool for +writing it). Whether that is true depends on what the Library does +and what the program that uses the Library does. + + 1. You may copy and distribute verbatim copies of the Library's +complete source code as you receive it, in any medium, provided that +you conspicuously and appropriately publish on each copy an +appropriate copyright notice and disclaimer of warranty; keep intact +all the notices that refer to this License and to the absence of any +warranty; and distribute a copy of this License along with the +Library. + + You may charge a fee for the physical act of transferring a copy, +and you may at your option offer warranty protection in exchange for a +fee. + + 2. You may modify your copy or copies of the Library or any portion +of it, thus forming a work based on the Library, and copy and +distribute such modifications or work under the terms of Section 1 +above, provided that you also meet all of these conditions: + + a) The modified work must itself be a software library. + + b) You must cause the files modified to carry prominent notices + stating that you changed the files and the date of any change. + + c) You must cause the whole of the work to be licensed at no + charge to all third parties under the terms of this License. + + d) If a facility in the modified Library refers to a function or a + table of data to be supplied by an application program that uses + the facility, other than as an argument passed when the facility + is invoked, then you must make a good faith effort to ensure that, + in the event an application does not supply such function or + table, the facility still operates, and performs whatever part of + its purpose remains meaningful. + + (For example, a function in a library to compute square roots has + a purpose that is entirely well-defined independent of the + application. Therefore, Subsection 2d requires that any + application-supplied function or table used by this function must + be optional: if the application does not supply it, the square + root function must still compute square roots.) + +These requirements apply to the modified work as a whole. If +identifiable sections of that work are not derived from the Library, +and can be reasonably considered independent and separate works in +themselves, then this License, and its terms, do not apply to those +sections when you distribute them as separate works. But when you +distribute the same sections as part of a whole which is a work based +on the Library, the distribution of the whole must be on the terms of +this License, whose permissions for other licensees extend to the +entire whole, and thus to each and every part regardless of who wrote +it. + +Thus, it is not the intent of this section to claim rights or contest +your rights to work written entirely by you; rather, the intent is to +exercise the right to control the distribution of derivative or +collective works based on the Library. + +In addition, mere aggregation of another work not based on the Library +with the Library (or with a work based on the Library) on a volume of +a storage or distribution medium does not bring the other work under +the scope of this License. + + 3. You may opt to apply the terms of the ordinary GNU General Public +License instead of this License to a given copy of the Library. To do +this, you must alter all the notices that refer to this License, so +that they refer to the ordinary GNU General Public License, version 2, +instead of to this License. (If a newer version than version 2 of the +ordinary GNU General Public License has appeared, then you can specify +that version instead if you wish.) Do not make any other change in +these notices. + + Once this change is made in a given copy, it is irreversible for +that copy, so the ordinary GNU General Public License applies to all +subsequent copies and derivative works made from that copy. + + This option is useful when you wish to copy part of the code of +the Library into a program that is not a library. + + 4. You may copy and distribute the Library (or a portion or +derivative of it, under Section 2) in object code or executable form +under the terms of Sections 1 and 2 above provided that you accompany +it with the complete corresponding machine-readable source code, which +must be distributed under the terms of Sections 1 and 2 above on a +medium customarily used for software interchange. + + If distribution of object code is made by offering access to copy +from a designated place, then offering equivalent access to copy the +source code from the same place satisfies the requirement to +distribute the source code, even though third parties are not +compelled to copy the source along with the object code. + + 5. A program that contains no derivative of any portion of the +Library, but is designed to work with the Library by being compiled or +linked with it, is called a "work that uses the Library". Such a +work, in isolation, is not a derivative work of the Library, and +therefore falls outside the scope of this License. + + However, linking a "work that uses the Library" with the Library +creates an executable that is a derivative of the Library (because it +contains portions of the Library), rather than a "work that uses the +library". The executable is therefore covered by this License. +Section 6 states terms for distribution of such executables. + + When a "work that uses the Library" uses material from a header file +that is part of the Library, the object code for the work may be a +derivative work of the Library even though the source code is not. +Whether this is true is especially significant if the work can be +linked without the Library, or if the work is itself a library. The +threshold for this to be true is not precisely defined by law. + + If such an object file uses only numerical parameters, data +structure layouts and accessors, and small macros and small inline +functions (ten lines or less in length), then the use of the object +file is unrestricted, regardless of whether it is legally a derivative +work. (Executables containing this object code plus portions of the +Library will still fall under Section 6.) + + Otherwise, if the work is a derivative of the Library, you may +distribute the object code for the work under the terms of Section 6. +Any executables containing that work also fall under Section 6, +whether or not they are linked directly with the Library itself. + + 6. As an exception to the Sections above, you may also combine or +link a "work that uses the Library" with the Library to produce a +work containing portions of the Library, and distribute that work +under terms of your choice, provided that the terms permit +modification of the work for the customer's own use and reverse +engineering for debugging such modifications. + + You must give prominent notice with each copy of the work that the +Library is used in it and that the Library and its use are covered by +this License. You must supply a copy of this License. If the work +during execution displays copyright notices, you must include the +copyright notice for the Library among them, as well as a reference +directing the user to the copy of this License. Also, you must do one +of these things: + + a) Accompany the work with the complete corresponding + machine-readable source code for the Library including whatever + changes were used in the work (which must be distributed under + Sections 1 and 2 above); and, if the work is an executable linked + with the Library, with the complete machine-readable "work that + uses the Library", as object code and/or source code, so that the + user can modify the Library and then relink to produce a modified + executable containing the modified Library. (It is understood + that the user who changes the contents of definitions files in the + Library will not necessarily be able to recompile the application + to use the modified definitions.) + + b) Use a suitable shared library mechanism for linking with the + Library. A suitable mechanism is one that (1) uses at run time a + copy of the library already present on the user's computer system, + rather than copying library functions into the executable, and (2) + will operate properly with a modified version of the library, if + the user installs one, as long as the modified version is + interface-compatible with the version that the work was made with. + + c) Accompany the work with a written offer, valid for at + least three years, to give the same user the materials + specified in Subsection 6a, above, for a charge no more + than the cost of performing this distribution. + + d) If distribution of the work is made by offering access to copy + from a designated place, offer equivalent access to copy the above + specified materials from the same place. + + e) Verify that the user has already received a copy of these + materials or that you have already sent this user a copy. + + For an executable, the required form of the "work that uses the +Library" must include any data and utility programs needed for +reproducing the executable from it. However, as a special exception, +the materials to be distributed need not include anything that is +normally distributed (in either source or binary form) with the major +components (compiler, kernel, and so on) of the operating system on +which the executable runs, unless that component itself accompanies +the executable. + + It may happen that this requirement contradicts the license +restrictions of other proprietary libraries that do not normally +accompany the operating system. Such a contradiction means you cannot +use both them and the Library together in an executable that you +distribute. + + 7. You may place library facilities that are a work based on the +Library side-by-side in a single library together with other library +facilities not covered by this License, and distribute such a combined +library, provided that the separate distribution of the work based on +the Library and of the other library facilities is otherwise +permitted, and provided that you do these two things: + + a) Accompany the combined library with a copy of the same work + based on the Library, uncombined with any other library + facilities. This must be distributed under the terms of the + Sections above. + + b) Give prominent notice with the combined library of the fact + that part of it is a work based on the Library, and explaining + where to find the accompanying uncombined form of the same work. + + 8. You may not copy, modify, sublicense, link with, or distribute +the Library except as expressly provided under this License. Any +attempt otherwise to copy, modify, sublicense, link with, or +distribute the Library is void, and will automatically terminate your +rights under this License. However, parties who have received copies, +or rights, from you under this License will not have their licenses +terminated so long as such parties remain in full compliance. + + 9. You are not required to accept this License, since you have not +signed it. However, nothing else grants you permission to modify or +distribute the Library or its derivative works. These actions are +prohibited by law if you do not accept this License. Therefore, by +modifying or distributing the Library (or any work based on the +Library), you indicate your acceptance of this License to do so, and +all its terms and conditions for copying, distributing or modifying +the Library or works based on it. + + 10. Each time you redistribute the Library (or any work based on the +Library), the recipient automatically receives a license from the +original licensor to copy, distribute, link with or modify the Library +subject to these terms and conditions. You may not impose any further +restrictions on the recipients' exercise of the rights granted herein. +You are not responsible for enforcing compliance by third parties with +this License. + + 11. If, as a consequence of a court judgment or allegation of patent +infringement or for any other reason (not limited to patent issues), +conditions are imposed on you (whether by court order, agreement or +otherwise) that contradict the conditions of this License, they do not +excuse you from the conditions of this License. If you cannot +distribute so as to satisfy simultaneously your obligations under this +License and any other pertinent obligations, then as a consequence you +may not distribute the Library at all. For example, if a patent +license would not permit royalty-free redistribution of the Library by +all those who receive copies directly or indirectly through you, then +the only way you could satisfy both it and this License would be to +refrain entirely from distribution of the Library. + +If any portion of this section is held invalid or unenforceable under any +particular circumstance, the balance of the section is intended to apply, +and the section as a whole is intended to apply in other circumstances. + +It is not the purpose of this section to induce you to infringe any +patents or other property right claims or to contest validity of any +such claims; this section has the sole purpose of protecting the +integrity of the free software distribution system which is +implemented by public license practices. Many people have made +generous contributions to the wide range of software distributed +through that system in reliance on consistent application of that +system; it is up to the author/donor to decide if he or she is willing +to distribute software through any other system and a licensee cannot +impose that choice. + +This section is intended to make thoroughly clear what is believed to +be a consequence of the rest of this License. + + 12. If the distribution and/or use of the Library is restricted in +certain countries either by patents or by copyrighted interfaces, the +original copyright holder who places the Library under this License may add +an explicit geographical distribution limitation excluding those countries, +so that distribution is permitted only in or among countries not thus +excluded. In such case, this License incorporates the limitation as if +written in the body of this License. + + 13. The Free Software Foundation may publish revised and/or new +versions of the Lesser General Public License from time to time. +Such new versions will be similar in spirit to the present version, +but may differ in detail to address new problems or concerns. + +Each version is given a distinguishing version number. If the Library +specifies a version number of this License which applies to it and +"any later version", you have the option of following the terms and +conditions either of that version or of any later version published by +the Free Software Foundation. If the Library does not specify a +license version number, you may choose any version ever published by +the Free Software Foundation. + + 14. If you wish to incorporate parts of the Library into other free +programs whose distribution conditions are incompatible with these, +write to the author to ask for permission. For software which is +copyrighted by the Free Software Foundation, write to the Free +Software Foundation; we sometimes make exceptions for this. Our +decision will be guided by the two goals of preserving the free status +of all derivatives of our free software and of promoting the sharing +and reuse of software generally. + + NO WARRANTY + + 15. BECAUSE THE LIBRARY IS LICENSED FREE OF CHARGE, THERE IS NO +WARRANTY FOR THE LIBRARY, TO THE EXTENT PERMITTED BY APPLICABLE LAW. +EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR +OTHER PARTIES PROVIDE THE LIBRARY "AS IS" WITHOUT WARRANTY OF ANY +KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE +IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR +PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE +LIBRARY IS WITH YOU. SHOULD THE LIBRARY PROVE DEFECTIVE, YOU ASSUME +THE COST OF ALL NECESSARY SERVICING, REPAIR OR CORRECTION. + + 16. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN +WRITING WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MAY MODIFY +AND/OR REDISTRIBUTE THE LIBRARY AS PERMITTED ABOVE, BE LIABLE TO YOU +FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR +CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE +LIBRARY (INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING +RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A +FAILURE OF THE LIBRARY TO OPERATE WITH ANY OTHER SOFTWARE), EVEN IF +SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH +DAMAGES. + + END OF TERMS AND CONDITIONS diff --git a/3rdparty/soundtouch/Makefile.am b/3rdparty/soundtouch/Makefile.am deleted file mode 100644 index 3c70f56e05..0000000000 --- a/3rdparty/soundtouch/Makefile.am +++ /dev/null @@ -1,71 +0,0 @@ -## Process this file with automake to create Makefile.in -## -## $Id: Makefile.am 138 2012-04-01 20:00:09Z oparviai $ -## -## This file is part of SoundTouch, an audio processing library for pitch/time adjustments -## -## SoundTouch is free software; you can redistribute it and/or modify it under the -## terms of the GNU General Public License as published by the Free Software -## Foundation; either version 2 of the License, or (at your option) any later -## version. -## -## SoundTouch is distributed in the hope that it will be useful, but WITHOUT ANY -## WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR -## A PARTICULAR PURPOSE. See the GNU General Public License for more details. -## -## You should have received a copy of the GNU General Public License along with -## this program; if not, write to the Free Software Foundation, Inc., 59 Temple -## Place - Suite 330, Boston, MA 02111-1307, USA - - -include $(top_srcdir)/config/am_include.mk - - -# set to something if you want other stuff to be included in the distribution tarball -EXTRA_DIST=SoundTouch.dsp SoundTouch.dsw SoundTouch.sln SoundTouch.vcproj - -noinst_HEADERS=AAFilter.h cpu_detect.h cpu_detect_x86.cpp FIRFilter.h RateTransposer.h TDStretch.h PeakFinder.h - -lib_LTLIBRARIES=libSoundTouch.la -# -libSoundTouch_la_SOURCES=AAFilter.cpp FIRFilter.cpp FIFOSampleBuffer.cpp RateTransposer.cpp SoundTouch.cpp TDStretch.cpp cpu_detect_x86.cpp BPMDetect.cpp PeakFinder.cpp - - -# Compiler flags -AM_CXXFLAGS=-O3 -fcheck-new -I../../include - -# Compile the files that need MMX and SSE individually. -libSoundTouch_la_LIBADD=libSoundTouchMMX.la libSoundTouchSSE.la -noinst_LTLIBRARIES=libSoundTouchMMX.la libSoundTouchSSE.la -libSoundTouchMMX_la_SOURCES=mmx_optimized.cpp -libSoundTouchSSE_la_SOURCES=sse_optimized.cpp - -# We enable optimizations by default. -# If MMX is supported compile with -mmmx. -# Do not assume -msse is also supported. -if HAVE_MMX -libSoundTouchMMX_la_CXXFLAGS = -mmmx $(AM_CXXFLAGS) -else -libSoundTouchMMX_la_CXXFLAGS = $(AM_CXXFLAGS) -endif - -# We enable optimizations by default. -# If SSE is supported compile with -msse. -if HAVE_SSE -libSoundTouchSSE_la_CXXFLAGS = -msse $(AM_CXXFLAGS) -else -libSoundTouchSSE_la_CXXFLAGS = $(AM_CXXFLAGS) -endif - -# Let the user disable optimizations if he wishes to. -if !X86_OPTIMIZATIONS -libSoundTouchMMX_la_CXXFLAGS = $(AM_CXXFLAGS) -libSoundTouchSSE_la_CXXFLAGS = $(AM_CXXFLAGS) -endif - - -# other linking flags to add -# noinst_LTLIBRARIES = libSoundTouchOpt.la -# libSoundTouch_la_LIBADD = libSoundTouchOpt.la -# libSoundTouchOpt_la_SOURCES = mmx_optimized.cpp sse_optimized.cpp -# libSoundTouchOpt_la_CXXFLAGS = -O3 -msse -fcheck-new -I../../include diff --git a/3rdparty/soundtouch/README.html b/3rdparty/soundtouch/README.html index 5b2bcbb240..0221b0f26a 100644 --- a/3rdparty/soundtouch/README.html +++ b/3rdparty/soundtouch/README.html @@ -8,15 +8,13 @@ - -
-

SoundTouch audio processing library v1.7.1

-

SoundTouch library Copyright © Olli Parviainen 2001-2012

+

SoundTouch audio processing library v1.9

+

SoundTouch library Copyright © Olli Parviainen 2001-2015

1. Introduction

SoundTouch is an open-source audio processing library that allows @@ -24,35 +22,31 @@ changing the sound tempo, pitch and playback rate parameters independently from each other, i.e.:

  • Sound tempo can be increased or decreased while maintaining the -original pitch
    • +original pitch
  • Sound pitch can be increased or decreased while maintaining the -original tempo
    • +original tempo
  • Change playback rate that affects both tempo and pitch at the -same time
    • +same time
  • Choose any combination of tempo/pitch/rate

1.1 Contact information

Author email: oparviai 'at' iki.fi

-

SoundTouch WWW page: http://www.surina.net/soundtouch

+

SoundTouch WWW page: http://soundtouch.surina.net

2. Compiling SoundTouch

-

Before compiling, notice that you can choose the sample data format -if it's desirable to use floating point sample data instead of 16bit -integers. See section "sample data format" for more information.

+

Before compiling, notice that you can choose the sample data format if it's +desirable to use floating point sample data instead of 16bit integers. See +section "sample data format" for more information.

+

Also notice that SoundTouch can use OpenMP instructions for parallel +computation to accelerate the runtime processing speed in multi-core systems, +however, these improvements need to be separately enabled before compiling. See +OpenMP notes in Chapter 3 below.

2.1. Building in Microsoft Windows

-

Project files for Microsoft Visual C++ 6.0 and Visual C++ .NET are -supplied with the source code package.
+

Project files for Microsoft Visual C++ are supplied with the source +code package. Go to Microsoft WWW page to download + +Microsoft Visual Studio Express version for free.

-

Please notice that SoundTouch library uses processor-specific -optimizations for Pentium III and AMD processors. Visual Studio .NET -and later versions supports the required instructions by default, but -Visual Studio 6.0 requires a processor pack upgrade to be installed in -order to support these optimizations. The processor pack upgrade can be -downloaded from Microsoft site at this URL:

-

http://msdn.microsoft.com/en-us/vstudio/aa718349.aspx

-

If the above URL is unavailable or removed, go to http://msdn.microsoft.com and -perform a search with keywords "processor pack".

To build the binaries with Visual C++ compiler, either run "make-win.bat" script, or open the appropriate project files in source code directories with Visual Studio. The final executable will appear @@ -61,6 +55,22 @@ instead of the make-win.bat script, directories bin and lib may need to be created manually to the SoundTouch package root for the final executables. The make-win.bat script creates these directories automatically.

+

OpenMP NOTE: If activating the OpenMP parallel computing in +the compilation, the target program will require additional vcomp dll library to +properly run. In Visual C++ 9.0 these libraries can be found in the following +folders.

+
    +
  • x86 32bit: C:\Program Files (x86)\Microsoft Visual Studio + 9.0\VC\redist\x86\Microsoft.VC90.OPENMP\vcomp90.dll
    • +
  • x64 64bit: C:\Program Files (x86)\Microsoft Visual Studio + 9.0\VC\redist\amd64\Microsoft.VC90.OPENMP\vcomp90.dll
    • +
+

In Visual Studio 2008, a SP1 version may be required for these libraries. In +other VC++ versions the required library will be expectedly found in similar +"redist" location.

+

Notice that as minor demonstration of a "dll hell" phenomenon both the 32-bit +and 64-bit version of vcomp90.dll have the same filename but different contents, +thus choose the proper version to allow the program start.

2.2. Building in Gnu platforms

The SoundTouch library compiles in practically any platform supporting GNU compiler (GCC) tools. SoundTouch requires GCC version 4.3 or later.

@@ -92,7 +102,9 @@ Notice that "configure" file is not available before running the 
make         -
-

Builds the SoundTouch library & SoundStretch utility.

+

Builds the SoundTouch library & SoundStretch utility. You can + optionally add "-j" switch after "make" to speed up the compilation in + multi-core systems.

@@ -133,7 +145,7 @@ directly and remove the following definition:
#define SOUNDTOUCH_ALLOW_X86_OPTIMIZATIONS 1
-

2.2.3 Compiling Shared Library / DLL version

+

2.2.3 Compiling Shared Library / DLL version in Cygwin

The GNU compilation does not automatically create a shared-library version of SoundTouch (.so or .dll). If such is desired, then you can create it as follows @@ -147,7 +159,15 @@ sstrip SoundTouch.dll

2.1. Building in Android

Android compilation instructions are within the source code package, see file "source/Android-lib/README-SoundTouch-Android.html" - in the package.

+ in the source code package.

+

The Android compilation automatically builds separate .so library binaries +for ARM, X86 and MIPS processor architectures. For optimal device support, +include all these .so library binaries into the Android .apk application +package, so the target Android device can automatically choose the proper +library binary version to use.

+

The source/Android-lib folder includes also an Android +example application that processes WAV audio files using SoundTouch library in +Android devices.

3. About implementation & Usage tips

3.1. Supported sample data formats

@@ -157,7 +177,7 @@ and 32bit floating point values, the default is 32bit floating point.

"STTypes.h" by choosing one of the following defines:

  • #define -SOUNDTOUCH_INTEGER_SAMPLES for 16bit signed integer
    • +SOUNDTOUCH_INTEGER_SAMPLES for 16bit signed integer
  • #define SOUNDTOUCH_FLOAT_SAMPLES for 32bit floating @@ -183,7 +203,7 @@ the channels, which consequently would ruin the stereo effect.

  • Input/output processing latency for the SoundTouch processor is around 100 ms. This is when time-stretching is used. If the rate transposing effect alone is used, the latency requirement is much -shorter, see section 'About algorithms'.
    • +shorter, see section 'About algorithms'.
  • Processing CD-quality sound (16bit stereo sound with 44100H sample rate) in real-time or faster is possible starting from processors equivalent to Intel Pentium 133Mh or better, if using the @@ -217,9 +237,9 @@ is around 100 ms.

    to produce the tempo, pitch and rate controls:

    • 'Tempo' control is implemented purely by -time-stretching.
      • +time-stretching.
    • 'Rate' control is implemented purely by sample -rate transposing.
      • +rate transposing.
    • 'Pitch' control is implemented as a combination of time-stretching and sample rate transposing. For example, to increase pitch the audio stream is first time-stretched to @@ -251,7 +271,7 @@ when increasing the tempo and vice versa. 

      By default, this setting value is calculated automatically according to tempo value.
      -
      • +
    • DEFAULT_SEEKWINDOW_MS: The seeking window default length in milliseconds is for the algorithm that seeks the best possible overlapping location. This determines from how wide a sample @@ -267,7 +287,7 @@ this setting.

      By default, this setting value is calculated automatically according to tempo value.
      -
      • +
    • DEFAULT_OVERLAP_MS: Overlap length in milliseconds. When the sound sequences are mixed back together to form again a continuous sound stream, this parameter defines how much the @@ -343,28 +363,55 @@ function with parameter  id of SETTING_USE_QUICKSEEK and value

      setSetting(SETTING_USE_QUICKSEEK, 1);

      CPU-specific optimizations:

      +

      Intel x86 specific SIMD optimizations are implemented using compiler +intrinsics, providing about a 3x processing speedup for x86 compatible +processors vs. non-SIMD implementation:

        -
      • Intel MMX optimized routines are used with compatible CPUs when -16bit integer sample type is used. MMX optimizations are available both -in Win32 and Gnu/x86 platforms. Compatible processors are Intel -PentiumMMX and later; AMD K6-2, Athlon and later.
        • -
      • Intel SSE optimized routines are used with compatible CPUs when -floating point sample type is used. SSE optimizations are currently -implemented for Win32 platform only. Processors compatible with SSE -extension are Intel processors starting from Pentium-III, and AMD -processors starting from Athlon XP.
        • -
      • AMD 3DNow! optimized routines are used with compatible CPUs when -floating point sample type is used, but SSE extension isn't supported . -3DNow! optimizations are currently implemented for Win32 platform only. -These optimizations are used in AMD K6-2 and Athlon (classic) CPU's; -better performing SSE routines are used with AMD processor starting -from Athlon XP.
        • +
      • Intel MMX optimized routines are used with x86 CPUs when 16bit integer + sample type is used
        • +
      • Intel SSE optimized routines are used with x86 CPUs when 32bit floating + point sample type is used
        • +
      +

      3.5 OpenMP parallel computation

      +

      SoundTouch 1.9 onwards support running the algorithms parallel in several CPU +cores. Based on benchmark the experienced multi-core processing speed-up gain +ranges between +30% (on a high-spec dual-core x86 Windows PC) to 215% (on a moderately low-spec +quad-core ARM of Raspberry Pi2).

      +

      The parallel computing support is implemented using OpenMP spec 3.0 +instructions. These instructions are supported by Visual C++ 2008 and later, and +GCC v4.2 and later. Compilers that do not supporting OpenMP will ignore these +optimizations and routines will still work properly. Possible warnings about +unknown #pragmas are related to OpenMP support and can be safely ignored.

      +

      The OpenMP improvements are disabled by default, and need to be enabled by +developer during compile-time. Reason for this is that parallel processing adds +moderate runtime overhead in managing the multi-threading, so it may not be +necessary nor desirable in all applications. For example real-time processing +that is not constrained by CPU power will not benefit of speed-up provided by +the parallel processing, in the contrary it may increase power consumption due +to the increased overhead.

      +

      However, applications that run on low-spec multi-core CPUs and may otherwise +have possibly constrained performance will benefit of the OpenMP improvements. +This include for example multi-core embedded devices.

      +

      OpenMP parallel computation can be enabled before compiling SoundTouch +library as follows:

      +
        +
      • Visual Studio: Open properties for the SoundTouch + sub-project, browse to C/C++ and Language + settings. Set + there "OpenMP support" to "Yes". Alternatively add + /openmp switch to command-line + parameters
        • +
      • GNU: Run the configure script with "./configure + --enable-openmp" switch, then run make as usually
        • +
      • Android: Add "-fopenmp" switches to compiler & linker + options, see README-SoundTouch-Android.html in the source code package for + more detailed instructions.

      4. SoundStretch audio processing utility

      SoundStretch audio processing utility
      - Copyright (c) Olli Parviainen 2002-2012

      + Copyright (c) Olli Parviainen 2002-2015

      SoundStretch is a simple command-line application that can change tempo, pitch and playback rates of WAV sound files. This program is intended primarily to demonstrate how the "SoundTouch" library can be @@ -464,15 +511,15 @@ transposing. Gains speed but loses sound quality.

    • To use standard input/output pipes for processing, give "stdin" and "stdout" as input/output filenames correspondingly. The standard input/output pipes will still carry the audio data in .wav audio file -format.
      • +format.
    • The numerical switches allow both integer (e.g. "-tempo=123") -and decimal (e.g. "-tempo=123.45") numbers.
      • +and decimal (e.g. "-tempo=123.45") numbers.
    • The "-naa" and/or "-quick" switches can be used to reduce CPU -usage while compromising some sound quality
      • +usage while compromising some sound quality
    • The BPM detection algorithm works by detecting repeating bass or drum patterns at low frequencies of <250Hz. A lower-than-expected BPM figure may be reported for music with uneven or complex bass -patterns.
      • +patterns.

    4.2. SoundStretch usage examples

    Example 1

    @@ -510,9 +557,42 @@ and estimates the BPM rate:

    soundstretch stdin -bpm
    +

    Example 6

    +

    The following command tunes song from original 440Hz tuning to 432Hz tuning: +this corresponds to lowering the pitch by -0.318 semitones:

    +
    + 
    soundstretch original.wav output.wav -pitch=-0.318
    +

    5. Change History

    5.1. SoundTouch library Change History

    +

    1.9:

    +
      +
    • Added support for parallel computation support via OpenMP primitives for better performance in multicore systems. + Benchmarks show that achieved parallel processing speedup improvement + typically range from +30% (x86 dual-core) to +180% (ARM quad-core). The + OpenMP optimizations are disabled by default, see OpenMP notes above in this + readme file how to enabled these optimizations.
      • +
    • Android: Added support for Android devices featuring X86 and MIPS CPUs, + in addition to ARM CPUs.
      • +
    • Android: More versatile Android example application that processes WAV + audio files with SoundTouch library
      • +
    • Replaced Windows-like 'BOOL' types with native 'bool'
      • +
    • Changed documentation token to "dist_doc_DATA" in Makefile.am file
      • +
    • Miscellaneous small fixes and improvements
      • +
    +

    1.8.0:

    +
      +
    • Added support for multi-channel audio processing
      • +
    • Added support for cubic and shannon interpolation for rate and pitch shift effects besides + the original linear interpolation, to reduce aliasing at high frequencies due to interpolation. + Cubic interpolation is used as default for floating point processing, and linear interpolation for integer + processing.
      • +
    • Fixed bug in anti-alias filtering that limited stop-band attenuation to -10 dB instead of <-50dB, and + increased filter length from 32 to 64 taps to further reduce aliasing due to frequency folding.
      • +
    • Performance improvements in cross-correlation algorithm
      • +
    • Other bug and compatibility fixes
      • +

    1.7.1:

    • Added files for Android compilation @@ -532,7 +612,7 @@ and estimates the BPM rate:

      1.6.0:

      • Added automatic cutoff threshold adaptation to beat detection -routine to better adapt BPM calculation to different types of music
        • +routine to better adapt BPM calculation to different types of music
      • Retired 3DNow! optimization support as 3DNow! is nowadays obsoleted and assembler code is nuisance to maintain
      • Retired "configure" file from source code package due to @@ -542,7 +622,7 @@ toolchain version for generating the "configure" file
      • Resolved namespace/label naming conflicts with other libraries by replacing global labels such as INTEGER_SAMPLES with more specific SOUNDTOUCH_INTEGER_SAMPLES etc.
        -
        • +
      • Updated windows build scripts & project files for Visual Studio 2008 support
      • Updated SoundTouch.dll API for .NET compatibility
        • @@ -552,22 +632,22 @@ sample batch sizes

        1.5.0:

        • Added normalization to correlation calculation and improvement -automatic seek/sequence parameter calculation to improve sound quality
          • +automatic seek/sequence parameter calculation to improve sound quality
        • Bugfixes: 
            -
          • Fixed negative array indexing in quick seek algorithm
            • -
          • FIR autoalias filter running too far in processing buffer
            • -
          • Check against zero sample count in rate transposing
            • +
          • Fixed negative array indexing in quick seek algorithm
            • +
          • FIR autoalias filter running too far in processing buffer
            • +
          • Check against zero sample count in rate transposing
          • Fix for x86-64 support: Removed pop/push instructions from -the cpu detection algorithm. 
            • -
          • Check against empty buffers in FIFOSampleBuffer
            • +the cpu detection algorithm.  +
          • Check against empty buffers in FIFOSampleBuffer
          • Other minor fixes & code cleanup
          -
          • -
        • Fixes in compilation scripts for non-Intel platforms
          • + +
        • Fixes in compilation scripts for non-Intel platforms
        • Added Dynamic-Link-Library (DLL) version of SoundTouch library build, provided with Delphi/Pascal wrapper for calling the dll routines -
          • +
        • Added #define PREVENT_CLICK_AT_RATE_CROSSOVER that prevents a click artifact when crossing the nominal pitch from either positive to negative side or vice versa
          • @@ -580,86 +660,91 @@ processing more than 2048 samples at one call 

          1.4.0:

          • Improved sound quality by automatic calculation of time stretch -algorithm processing parameters according to tempo setting
            • +algorithm processing parameters according to tempo setting
          • Moved BPM detection routines from SoundStretch application into -SoundTouch library
            • +SoundTouch library
          • Bugfixes: Usage of uninitialied variables, GNU build scripts, -compiler errors due to 'const' keyword mismatch.
            • +compiler errors due to 'const' keyword mismatch.
          • Source code cleanup

          1.3.1:

          • Changed static class declaration to GCC 4.x compiler compatible -syntax.
            • +syntax.
          • Enabled MMX/SSE-optimized routines also for GCC compilers. Earlier the MMX/SSE-optimized routines were written in compiler-specific inline assembler, now these routines are migrated to use compiler intrinsic syntax which allows compiling the same -MMX/SSE-optimized source code with both Visual C++ and GCC compilers.
            • +MMX/SSE-optimized source code with both Visual C++ and GCC compilers.
          • Set floating point as the default sample format and added switch to the GNU configure script for selecting the other sample format.

          1.3.0:

          • Fixed tempo routine output duration inaccuracy due to rounding -error
            • +error
          • Implemented separate processing routines for integer and floating arithmetic to allow improvements to floating point routines (earlier used algorithms mostly optimized for integer arithmetic also -for floating point samples)
            • +for floating point samples)
          • Fixed a bug that distorts sound if sample rate changes during -the sound stream
            • +the sound stream
          • Fixed a memory leak that appeared in MMX/SSE/3DNow! optimized -routines
            • +routines
          • Reduced redundant code pieces in MMX/SSE/3DNow! optimized -routines vs. the standard C routines.
            • -
          • MMX routine incompatibility with new gcc compiler versions
            • -
          • Other miscellaneous bug fixes
            • +routines vs. the standard C routines. +
          • MMX routine incompatibility with new gcc compiler versions
            • +
          • Other miscellaneous bug fixes

          1.2.1:

          • Added automake/autoconf scripts for GNU platforms (in courtesy -of David Durham)
            • -
          • Fixed SCALE overflow bug in rate transposer routine.
            • -
          • Fixed 64bit address space bugs.
            • +of David Durham) +
          • Fixed SCALE overflow bug in rate transposer routine.
            • +
          • Fixed 64bit address space bugs.
          • Created a 'soundtouch' namespace for SAMPLETYPE definitions.

          1.2.0:

          • Added support for 32bit floating point sample data type with SSE/3DNow! optimizations for Win32 platform (SSE/3DNow! optimizations -currently not supported in GCC environment)
            • +currently not supported in GCC environment)
          • Replaced 'make-gcc' script for GNU environment by master -Makefile
            • +Makefile
          • Added time-stretch routine configurability to SoundTouch main -class
            • +class
          • Bugfixes

          1.1.1:

          • Moved SoundTouch under lesser GPL license (LGPL). This allows using SoundTouch library in programs that aren't released under GPL -license.
            • +license.
          • Changed MMX routine organiation so that MMX optimized routines are now implemented in classes that are derived from the basic classes -having the standard non-mmx routines.
            • -
          • MMX routines to support gcc version 3.
            • -
          • Replaced windows makefiles by script using the .dsw files
            • +having the standard non-mmx routines. +
          • MMX routines to support gcc version 3.
            • +
          • Replaced windows makefiles by script using the .dsw files

          1.0.1:

          • "mmx_gcc.cpp": Added "using namespace std" and removed "return 0" from a function with void return value to fix compiler errors when -compiling the library in Solaris environment.
            • +compiling the library in Solaris environment.
          • Moved file "FIFOSampleBuffer.h" to "include" directory to allow -accessing the FIFOSampleBuffer class from external files.
            • +accessing the FIFOSampleBuffer class from external files.

          1.0:

            -
          • Initial release
            • +
          • Initial release

           

          5.2. SoundStretch application Change History

          +

          1.9:

          +
            +
          • Added support for WAV file 'fact' information chunk.
            • +
          +

          1.7.0:

          • Bugfixes in Wavfile: exception string formatting, avoid getLengthMs() integer @@ -674,14 +759,14 @@ music processing.

            • 1.4.0:

            • Moved BPM detection routines from SoundStretch application into -SoundTouch library
              • +SoundTouch library
            • Allow using standard input/output pipes as audio processing input/output streams

            1.3.0:

            • Simplified accessing WAV files with floating point sample -format.
              • +format.

            1.2.1:

              @@ -689,69 +774,66 @@ format.

            1.2.0:

              -
            • Added support for 32bit floating point sample data type
              • -
            • Restructured the BPM routines into separate library
              • +
            • Added support for 32bit floating point sample data type
              • +
            • Restructured the BPM routines into separate library
            • Fixed big-endian conversion bugs in WAV file routines (hopefully :)

            1.1.1:

            • Fixed bugs in WAV file reading & added byte-order conversion -for big-endian processors.
              • +for big-endian processors.
            • Moved SoundStretch source code under 'example' directory to -highlight difference from SoundTouch stuff.
              • -
            • Replaced windows makefiles by script using the .dsw files
              • +highlight difference from SoundTouch stuff. +
            • Replaced windows makefiles by script using the .dsw files
            • Output file name isn't required if output isn't desired (e.g. if -using the switch '-bpm' in plain format only)
              • +using the switch '-bpm' in plain format only)

            1.1:

            • Fixed "Release" settings in Microsoft Visual C++ project file -(.dsp)
              • +(.dsp)
            • Added beats-per-minute (BPM) detection routine and command-line -switch "-bpm"
              • +switch "-bpm"

            1.01:

              -
            • Initial release
              • +
            • Initial release

            6. Acknowledgements

            Kudos for these people who have contributed to development or -submitted bugfixes since SoundTouch v1.3.1:

            +submitted bugfixes:

              -
            • Arthur A
              • +
            • Arthur A
            • Richard Ash
            • Stanislav Brabec
            • Christian Budde
              • +
            • Chris Bryan
            • Jacek Caban
            • Brian Cameron
            • Jason Champion
            • David Clark
            • Patrick Colis
            • Miquel Colon
              • +
            • Jim Credland
              • +
            • Sandro Cumerlato
            • Justin Frankel
              • +
            • Masa H.
            • Jason Garland
            • Takashi Iwai
              • +
            • Thomas Klausner
              • +
            • Mathias Möhl
            • Yuval Naveh
            • Paulo Pizarro
            • Blaise Potard
              • -
            • RJ Ryan
              • -
            • Patrick Colis
              • -
            • Miquel Colon
              • -
            • Sandro Cumerlato
              • -
            • Justin Frankel
              • -
            • Jason Garland
              • -
            • Takashi Iwai
              • -
            • Mathias Möhl
              • -
            • Yuval Naveh
              • -
            • Paulo Pizarro
              • -
            • Blaise Potard
              • -
            • RJ Ryan
              • -
            • John Sheehy
              • +
            • Michael Pruett
              • +
            • Rajeev Puran
              • +
            • RJ Ryan
              • +
            • John Sheehy
            • Tim Shuttleworth
              • +
            • Albert Sirvent
            • John Stumpo
              • -
            • Tim Shuttleworth
            • Katja Vetter

            Moral greetings to all other contributors and users also!

            @@ -770,8 +852,8 @@ General Public License for more details.

            License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA

            +$Id: README.html 220 2015-05-18 17:39:26Z oparviai $ -->

            - RREADME.html file updated on 28-Dec-2012

            + README.html file updated in May-2015

            diff --git a/3rdparty/soundtouch/RateTransposer.cpp b/3rdparty/soundtouch/RateTransposer.cpp deleted file mode 100644 index 19d4bf8ef2..0000000000 --- a/3rdparty/soundtouch/RateTransposer.cpp +++ /dev/null @@ -1,626 +0,0 @@ -//////////////////////////////////////////////////////////////////////////////// -/// -/// Sample rate transposer. Changes sample rate by using linear interpolation -/// together with anti-alias filtering (first order interpolation with anti- -/// alias filtering should be quite adequate for this application) -/// -/// Author : Copyright (c) Olli Parviainen -/// Author e-mail : oparviai 'at' iki.fi -/// SoundTouch WWW: http://www.surina.net/soundtouch -/// -//////////////////////////////////////////////////////////////////////////////// -// -// Last changed : $Date: 2011-09-02 15:56:11 -0300 (sex, 02 set 2011) $ -// File revision : $Revision: 4 $ -// -// $Id: RateTransposer.cpp 131 2011-09-02 18:56:11Z oparviai $ -// -//////////////////////////////////////////////////////////////////////////////// -// -// License : -// -// SoundTouch audio processing library -// Copyright (c) Olli Parviainen -// -// This library is free software; you can redistribute it and/or -// modify it under the terms of the GNU Lesser General Public -// License as published by the Free Software Foundation; either -// version 2.1 of the License, or (at your option) any later version. -// -// This library is distributed in the hope that it will be useful, -// but WITHOUT ANY WARRANTY; without even the implied warranty of -// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU -// Lesser General Public License for more details. -// -// You should have received a copy of the GNU Lesser General Public -// License along with this library; if not, write to the Free Software -// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA -// -//////////////////////////////////////////////////////////////////////////////// - -#include -#include -#include -#include -#include "RateTransposer.h" -#include "AAFilter.h" - -using namespace soundtouch; - - -/// A linear samplerate transposer class that uses integer arithmetics. -/// for the transposing. -class RateTransposerInteger : public RateTransposer -{ -protected: - int iSlopeCount; - int iRate; - SAMPLETYPE sPrevSampleL, sPrevSampleR; - - virtual void resetRegisters(); - - virtual uint transposeStereo(SAMPLETYPE *dest, - const SAMPLETYPE *src, - uint numSamples); - virtual uint transposeMono(SAMPLETYPE *dest, - const SAMPLETYPE *src, - uint numSamples); - -public: - RateTransposerInteger(); - virtual ~RateTransposerInteger(); - - /// Sets new target rate. Normal rate = 1.0, smaller values represent slower - /// rate, larger faster rates. - virtual void setRate(float newRate); - -}; - - -/// A linear samplerate transposer class that uses floating point arithmetics -/// for the transposing. -class RateTransposerFloat : public RateTransposer -{ -protected: - float fSlopeCount; - SAMPLETYPE sPrevSampleL, sPrevSampleR; - - virtual void resetRegisters(); - - virtual uint transposeStereo(SAMPLETYPE *dest, - const SAMPLETYPE *src, - uint numSamples); - virtual uint transposeMono(SAMPLETYPE *dest, - const SAMPLETYPE *src, - uint numSamples); - -public: - RateTransposerFloat(); - virtual ~RateTransposerFloat(); -}; - - - - -// Operator 'new' is overloaded so that it automatically creates a suitable instance -// depending on if we've a MMX/SSE/etc-capable CPU available or not. -void * RateTransposer::operator new(size_t s) -{ - ST_THROW_RT_ERROR("Error in RateTransoser::new: don't use \"new TDStretch\" directly, use \"newInstance\" to create a new instance instead!"); - return newInstance(); -} - - -RateTransposer *RateTransposer::newInstance() -{ -#ifdef SOUNDTOUCH_INTEGER_SAMPLES - return ::new RateTransposerInteger; -#else - return ::new RateTransposerFloat; -#endif -} - - -// Constructor -RateTransposer::RateTransposer() : FIFOProcessor(&outputBuffer) -{ - numChannels = 2; - bUseAAFilter = TRUE; - fRate = 0; - - // Instantiates the anti-alias filter with default tap length - // of 32 - pAAFilter = new AAFilter(32); -} - - - -RateTransposer::~RateTransposer() -{ - delete pAAFilter; -} - - - -/// Enables/disables the anti-alias filter. Zero to disable, nonzero to enable -void RateTransposer::enableAAFilter(BOOL newMode) -{ - bUseAAFilter = newMode; -} - - -/// Returns nonzero if anti-alias filter is enabled. -BOOL RateTransposer::isAAFilterEnabled() const -{ - return bUseAAFilter; -} - - -AAFilter *RateTransposer::getAAFilter() -{ - return pAAFilter; -} - - - -// Sets new target iRate. Normal iRate = 1.0, smaller values represent slower -// iRate, larger faster iRates. -void RateTransposer::setRate(float newRate) -{ - double fCutoff; - - fRate = newRate; - - // design a new anti-alias filter - if (newRate > 1.0f) - { - fCutoff = 0.5f / newRate; - } - else - { - fCutoff = 0.5f * newRate; - } - pAAFilter->setCutoffFreq(fCutoff); -} - - -// Outputs as many samples of the 'outputBuffer' as possible, and if there's -// any room left, outputs also as many of the incoming samples as possible. -// The goal is to drive the outputBuffer empty. -// -// It's allowed for 'output' and 'input' parameters to point to the same -// memory position. -/* -void RateTransposer::flushStoreBuffer() -{ - if (storeBuffer.isEmpty()) return; - - outputBuffer.moveSamples(storeBuffer); -} -*/ - - -// Adds 'nSamples' pcs of samples from the 'samples' memory position into -// the input of the object. -void RateTransposer::putSamples(const SAMPLETYPE *samples, uint nSamples) -{ - processSamples(samples, nSamples); -} - - - -// Transposes up the sample rate, causing the observed playback 'rate' of the -// sound to decrease -void RateTransposer::upsample(const SAMPLETYPE *src, uint nSamples) -{ - uint count, sizeTemp, num; - - // If the parameter 'uRate' value is smaller than 'SCALE', first transpose - // the samples and then apply the anti-alias filter to remove aliasing. - - // First check that there's enough room in 'storeBuffer' - // (+16 is to reserve some slack in the destination buffer) - sizeTemp = (uint)((float)nSamples / fRate + 16.0f); - - // Transpose the samples, store the result into the end of "storeBuffer" - count = transpose(storeBuffer.ptrEnd(sizeTemp), src, nSamples); - storeBuffer.putSamples(count); - - // Apply the anti-alias filter to samples in "store output", output the - // result to "dest" - num = storeBuffer.numSamples(); - count = pAAFilter->evaluate(outputBuffer.ptrEnd(num), - storeBuffer.ptrBegin(), num, (uint)numChannels); - outputBuffer.putSamples(count); - - // Remove the processed samples from "storeBuffer" - storeBuffer.receiveSamples(count); -} - - -// Transposes down the sample rate, causing the observed playback 'rate' of the -// sound to increase -void RateTransposer::downsample(const SAMPLETYPE *src, uint nSamples) -{ - uint count, sizeTemp; - - // If the parameter 'uRate' value is larger than 'SCALE', first apply the - // anti-alias filter to remove high frequencies (prevent them from folding - // over the lover frequencies), then transpose. - - // Add the new samples to the end of the storeBuffer - storeBuffer.putSamples(src, nSamples); - - // Anti-alias filter the samples to prevent folding and output the filtered - // data to tempBuffer. Note : because of the FIR filter length, the - // filtering routine takes in 'filter_length' more samples than it outputs. - assert(tempBuffer.isEmpty()); - sizeTemp = storeBuffer.numSamples(); - - count = pAAFilter->evaluate(tempBuffer.ptrEnd(sizeTemp), - storeBuffer.ptrBegin(), sizeTemp, (uint)numChannels); - - if (count == 0) return; - - // Remove the filtered samples from 'storeBuffer' - storeBuffer.receiveSamples(count); - - // Transpose the samples (+16 is to reserve some slack in the destination buffer) - sizeTemp = (uint)((float)nSamples / fRate + 16.0f); - count = transpose(outputBuffer.ptrEnd(sizeTemp), tempBuffer.ptrBegin(), count); - outputBuffer.putSamples(count); -} - - -// Transposes sample rate by applying anti-alias filter to prevent folding. -// Returns amount of samples returned in the "dest" buffer. -// The maximum amount of samples that can be returned at a time is set by -// the 'set_returnBuffer_size' function. -void RateTransposer::processSamples(const SAMPLETYPE *src, uint nSamples) -{ - uint count; - uint sizeReq; - - if (nSamples == 0) return; - assert(pAAFilter); - - // If anti-alias filter is turned off, simply transpose without applying - // the filter - if (bUseAAFilter == FALSE) - { - sizeReq = (uint)((float)nSamples / fRate + 1.0f); - count = transpose(outputBuffer.ptrEnd(sizeReq), src, nSamples); - outputBuffer.putSamples(count); - return; - } - - // Transpose with anti-alias filter - if (fRate < 1.0f) - { - upsample(src, nSamples); - } - else - { - downsample(src, nSamples); - } -} - - -// Transposes the sample rate of the given samples using linear interpolation. -// Returns the number of samples returned in the "dest" buffer -inline uint RateTransposer::transpose(SAMPLETYPE *dest, const SAMPLETYPE *src, uint nSamples) -{ - if (numChannels == 2) - { - return transposeStereo(dest, src, nSamples); - } - else - { - return transposeMono(dest, src, nSamples); - } -} - - -// Sets the number of channels, 1 = mono, 2 = stereo -void RateTransposer::setChannels(int nChannels) -{ - assert(nChannels > 0); - if (numChannels == nChannels) return; - - assert(nChannels == 1 || nChannels == 2); - numChannels = nChannels; - - storeBuffer.setChannels(numChannels); - tempBuffer.setChannels(numChannels); - outputBuffer.setChannels(numChannels); - - // Inits the linear interpolation registers - resetRegisters(); -} - - -// Clears all the samples in the object -void RateTransposer::clear() -{ - outputBuffer.clear(); - storeBuffer.clear(); -} - - -// Returns nonzero if there aren't any samples available for outputting. -int RateTransposer::isEmpty() const -{ - int res; - - res = FIFOProcessor::isEmpty(); - if (res == 0) return 0; - return storeBuffer.isEmpty(); -} - - -////////////////////////////////////////////////////////////////////////////// -// -// RateTransposerInteger - integer arithmetic implementation -// - -/// fixed-point interpolation routine precision -#define SCALE 65536 - -// Constructor -RateTransposerInteger::RateTransposerInteger() : RateTransposer() -{ - // Notice: use local function calling syntax for sake of clarity, - // to indicate the fact that C++ constructor can't call virtual functions. - RateTransposerInteger::resetRegisters(); - RateTransposerInteger::setRate(1.0f); -} - - -RateTransposerInteger::~RateTransposerInteger() -{ -} - - -void RateTransposerInteger::resetRegisters() -{ - iSlopeCount = 0; - sPrevSampleL = - sPrevSampleR = 0; -} - - - -// Transposes the sample rate of the given samples using linear interpolation. -// 'Mono' version of the routine. Returns the number of samples returned in -// the "dest" buffer -uint RateTransposerInteger::transposeMono(SAMPLETYPE *dest, const SAMPLETYPE *src, uint nSamples) -{ - unsigned int i, used; - LONG_SAMPLETYPE temp, vol1; - - if (nSamples == 0) return 0; // no samples, no work - - used = 0; - i = 0; - - // Process the last sample saved from the previous call first... - while (iSlopeCount <= SCALE) - { - vol1 = (LONG_SAMPLETYPE)(SCALE - iSlopeCount); - temp = vol1 * sPrevSampleL + iSlopeCount * src[0]; - dest[i] = (SAMPLETYPE)(temp / SCALE); - i++; - iSlopeCount += iRate; - } - // now always (iSlopeCount > SCALE) - iSlopeCount -= SCALE; - - while (1) - { - while (iSlopeCount > SCALE) - { - iSlopeCount -= SCALE; - used ++; - if (used >= nSamples - 1) goto end; - } - vol1 = (LONG_SAMPLETYPE)(SCALE - iSlopeCount); - temp = src[used] * vol1 + iSlopeCount * src[used + 1]; - dest[i] = (SAMPLETYPE)(temp / SCALE); - - i++; - iSlopeCount += iRate; - } -end: - // Store the last sample for the next round - sPrevSampleL = src[nSamples - 1]; - - return i; -} - - -// Transposes the sample rate of the given samples using linear interpolation. -// 'Stereo' version of the routine. Returns the number of samples returned in -// the "dest" buffer -uint RateTransposerInteger::transposeStereo(SAMPLETYPE *dest, const SAMPLETYPE *src, uint nSamples) -{ - unsigned int srcPos, i, used; - LONG_SAMPLETYPE temp, vol1; - - if (nSamples == 0) return 0; // no samples, no work - - used = 0; - i = 0; - - // Process the last sample saved from the sPrevSampleLious call first... - while (iSlopeCount <= SCALE) - { - vol1 = (LONG_SAMPLETYPE)(SCALE - iSlopeCount); - temp = vol1 * sPrevSampleL + iSlopeCount * src[0]; - dest[2 * i] = (SAMPLETYPE)(temp / SCALE); - temp = vol1 * sPrevSampleR + iSlopeCount * src[1]; - dest[2 * i + 1] = (SAMPLETYPE)(temp / SCALE); - i++; - iSlopeCount += iRate; - } - // now always (iSlopeCount > SCALE) - iSlopeCount -= SCALE; - - while (1) - { - while (iSlopeCount > SCALE) - { - iSlopeCount -= SCALE; - used ++; - if (used >= nSamples - 1) goto end; - } - srcPos = 2 * used; - vol1 = (LONG_SAMPLETYPE)(SCALE - iSlopeCount); - temp = src[srcPos] * vol1 + iSlopeCount * src[srcPos + 2]; - dest[2 * i] = (SAMPLETYPE)(temp / SCALE); - temp = src[srcPos + 1] * vol1 + iSlopeCount * src[srcPos + 3]; - dest[2 * i + 1] = (SAMPLETYPE)(temp / SCALE); - - i++; - iSlopeCount += iRate; - } -end: - // Store the last sample for the next round - sPrevSampleL = src[2 * nSamples - 2]; - sPrevSampleR = src[2 * nSamples - 1]; - - return i; -} - - -// Sets new target iRate. Normal iRate = 1.0, smaller values represent slower -// iRate, larger faster iRates. -void RateTransposerInteger::setRate(float newRate) -{ - iRate = (int)(newRate * SCALE + 0.5f); - RateTransposer::setRate(newRate); -} - - -////////////////////////////////////////////////////////////////////////////// -// -// RateTransposerFloat - floating point arithmetic implementation -// -////////////////////////////////////////////////////////////////////////////// - -// Constructor -RateTransposerFloat::RateTransposerFloat() : RateTransposer() -{ - // Notice: use local function calling syntax for sake of clarity, - // to indicate the fact that C++ constructor can't call virtual functions. - RateTransposerFloat::resetRegisters(); - RateTransposerFloat::setRate(1.0f); -} - - -RateTransposerFloat::~RateTransposerFloat() -{ -} - - -void RateTransposerFloat::resetRegisters() -{ - fSlopeCount = 0; - sPrevSampleL = - sPrevSampleR = 0; -} - - - -// Transposes the sample rate of the given samples using linear interpolation. -// 'Mono' version of the routine. Returns the number of samples returned in -// the "dest" buffer -uint RateTransposerFloat::transposeMono(SAMPLETYPE *dest, const SAMPLETYPE *src, uint nSamples) -{ - unsigned int i, used; - - used = 0; - i = 0; - - // Process the last sample saved from the previous call first... - while (fSlopeCount <= 1.0f) - { - dest[i] = (SAMPLETYPE)((1.0f - fSlopeCount) * sPrevSampleL + fSlopeCount * src[0]); - i++; - fSlopeCount += fRate; - } - fSlopeCount -= 1.0f; - - if (nSamples > 1) - { - while (1) - { - while (fSlopeCount > 1.0f) - { - fSlopeCount -= 1.0f; - used ++; - if (used >= nSamples - 1) goto end; - } - dest[i] = (SAMPLETYPE)((1.0f - fSlopeCount) * src[used] + fSlopeCount * src[used + 1]); - i++; - fSlopeCount += fRate; - } - } -end: - // Store the last sample for the next round - sPrevSampleL = src[nSamples - 1]; - - return i; -} - - -// Transposes the sample rate of the given samples using linear interpolation. -// 'Mono' version of the routine. Returns the number of samples returned in -// the "dest" buffer -uint RateTransposerFloat::transposeStereo(SAMPLETYPE *dest, const SAMPLETYPE *src, uint nSamples) -{ - unsigned int srcPos, i, used; - - if (nSamples == 0) return 0; // no samples, no work - - used = 0; - i = 0; - - // Process the last sample saved from the sPrevSampleLious call first... - while (fSlopeCount <= 1.0f) - { - dest[2 * i] = (SAMPLETYPE)((1.0f - fSlopeCount) * sPrevSampleL + fSlopeCount * src[0]); - dest[2 * i + 1] = (SAMPLETYPE)((1.0f - fSlopeCount) * sPrevSampleR + fSlopeCount * src[1]); - i++; - fSlopeCount += fRate; - } - // now always (iSlopeCount > 1.0f) - fSlopeCount -= 1.0f; - - if (nSamples > 1) - { - while (1) - { - while (fSlopeCount > 1.0f) - { - fSlopeCount -= 1.0f; - used ++; - if (used >= nSamples - 1) goto end; - } - srcPos = 2 * used; - - dest[2 * i] = (SAMPLETYPE)((1.0f - fSlopeCount) * src[srcPos] - + fSlopeCount * src[srcPos + 2]); - dest[2 * i + 1] = (SAMPLETYPE)((1.0f - fSlopeCount) * src[srcPos + 1] - + fSlopeCount * src[srcPos + 3]); - - i++; - fSlopeCount += fRate; - } - } -end: - // Store the last sample for the next round - sPrevSampleL = src[2 * nSamples - 2]; - sPrevSampleR = src[2 * nSamples - 1]; - - return i; -} diff --git a/3rdparty/soundtouch/SoundTouch.vcxproj b/3rdparty/soundtouch/SoundTouch.vcxproj index 914cef8042..9e8a4767b9 100644 --- a/3rdparty/soundtouch/SoundTouch.vcxproj +++ b/3rdparty/soundtouch/SoundTouch.vcxproj @@ -5,112 +5,88 @@ Debug Win32 + + Debug + x64 + Devel Win32 + + Devel + x64 + Release Win32 + + Release + x64 + {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D} - SoundTouch SoundTouch + SoundTouch - + StaticLibrary - MultiByte - true - $(DefaultPlatformToolset)_xp - - - StaticLibrary - MultiByte - true - $(DefaultPlatformToolset)_xp - - - StaticLibrary - MultiByte $(DefaultPlatformToolset)_xp + true + false + true - - - + - - + + + + - - - - - - - - - - - - - - - - <_ProjectFileVersion>10.0.30319.1 - AllRules.ruleset - - - AllRules.ruleset - - - AllRules.ruleset - - - $(ProjectName)-dev - - + - Level3 - - - - - Level3 + $(ProjectDir)soundtouch;%(AdditionalIncludeDirectories) - - - - - - - - - - - + + + + + + + + + + + + + + + - - - - - - - - - - - + + + + + + + + + + + + + + + - - \ No newline at end of file diff --git a/3rdparty/soundtouch/SoundTouch.vcxproj.filters b/3rdparty/soundtouch/SoundTouch.vcxproj.filters index 6b7c493050..3f469b6614 100644 --- a/3rdparty/soundtouch/SoundTouch.vcxproj.filters +++ b/3rdparty/soundtouch/SoundTouch.vcxproj.filters @@ -11,72 +11,96 @@ - + Source Files - + Source Files - + Source Files - + Source Files - + Source Files - + Source Files - + Source Files - + Source Files - + Source Files - + Source Files - + + Source Files + + + Source Files + + + Source Files + + + Source Files + + Source Files - + Header Files - + Header Files - + Header Files - + Header Files - + Header Files - + Header Files - + Header Files - + Header Files - + Header Files - + Header Files - + + Header Files + + + Header Files + + + Header Files + + + Header Files + + Header Files diff --git a/3rdparty/soundtouch/WavFile.cpp b/3rdparty/soundtouch/WavFile.cpp deleted file mode 100644 index 948930215b..0000000000 --- a/3rdparty/soundtouch/WavFile.cpp +++ /dev/null @@ -1,745 +0,0 @@ -//////////////////////////////////////////////////////////////////////////////// -/// -/// Classes for easy reading & writing of WAV sound files. -/// -/// For big-endian CPU, define _BIG_ENDIAN_ during compile-time to correctly -/// parse the WAV files with such processors. -/// -/// Admittingly, more complete WAV reader routines may exist in public domain, -/// but the reason for 'yet another' one is that those generic WAV reader -/// libraries are exhaustingly large and cumbersome! Wanted to have something -/// simpler here, i.e. something that's not already larger than rest of the -/// SoundTouch/SoundStretch program... -/// -/// Author : Copyright (c) Olli Parviainen -/// Author e-mail : oparviai 'at' iki.fi -/// SoundTouch WWW: http://www.surina.net/soundtouch -/// -//////////////////////////////////////////////////////////////////////////////// -// -// Last changed : $Date: 2009-02-21 18:00:14 +0200 (Sat, 21 Feb 2009) $ -// File revision : $Revision: 4 $ -// -// $Id: WavFile.cpp 63 2009-02-21 16:00:14Z oparviai $ -// -//////////////////////////////////////////////////////////////////////////////// -// -// License : -// -// SoundTouch audio processing library -// Copyright (c) Olli Parviainen -// -// This library is free software; you can redistribute it and/or -// modify it under the terms of the GNU Lesser General Public -// License as published by the Free Software Foundation; either -// version 2.1 of the License, or (at your option) any later version. -// -// This library is distributed in the hope that it will be useful, -// but WITHOUT ANY WARRANTY; without even the implied warranty of -// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU -// Lesser General Public License for more details. -// -// You should have received a copy of the GNU Lesser General Public -// License along with this library; if not, write to the Free Software -// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA -// -//////////////////////////////////////////////////////////////////////////////// - -#include -#include -#include -#include -#include -#include - -#include "WavFile.h" - -using namespace std; - -static const char riffStr[] = "RIFF"; -static const char waveStr[] = "WAVE"; -static const char fmtStr[] = "fmt "; -static const char dataStr[] = "data"; - - -////////////////////////////////////////////////////////////////////////////// -// -// Helper functions for swapping byte order to correctly read/write WAV files -// with big-endian CPU's: Define compile-time definition _BIG_ENDIAN_ to -// turn-on the conversion if it appears necessary. -// -// For example, Intel x86 is little-endian and doesn't require conversion, -// while PowerPC of Mac's and many other RISC cpu's are big-endian. - -#ifdef BYTE_ORDER - // In gcc compiler detect the byte order automatically - #if BYTE_ORDER == BIG_ENDIAN - // big-endian platform. - #define _BIG_ENDIAN_ - #endif -#endif - -#ifdef _BIG_ENDIAN_ - // big-endian CPU, swap bytes in 16 & 32 bit words - - // helper-function to swap byte-order of 32bit integer - static inline void _swap32(unsigned int &dwData) - { - dwData = ((dwData >> 24) & 0x000000FF) | - ((dwData >> 8) & 0x0000FF00) | - ((dwData << 8) & 0x00FF0000) | - ((dwData << 24) & 0xFF000000); - } - - // helper-function to swap byte-order of 16bit integer - static inline void _swap16(unsigned short &wData) - { - wData = ((wData >> 8) & 0x00FF) | - ((wData << 8) & 0xFF00); - } - - // helper-function to swap byte-order of buffer of 16bit integers - static inline void _swap16Buffer(unsigned short *pData, unsigned int dwNumWords) - { - unsigned long i; - - for (i = 0; i < dwNumWords; i ++) - { - _swap16(pData[i]); - } - } - -#else // BIG_ENDIAN - // little-endian CPU, WAV file is ok as such - - // dummy helper-function - static inline void _swap32(unsigned int &dwData) - { - // do nothing - } - - // dummy helper-function - static inline void _swap16(unsigned short &wData) - { - // do nothing - } - - // dummy helper-function - static inline void _swap16Buffer(unsigned short *pData, unsigned int dwNumBytes) - { - // do nothing - } - -#endif // BIG_ENDIAN - - -////////////////////////////////////////////////////////////////////////////// -// -// Class WavInFile -// - -WavInFile::WavInFile(const char *fileName) -{ - // Try to open the file for reading - fptr = fopen(fileName, "rb"); - if (fptr == NULL) - { - // didn't succeed - string msg = "Error : Unable to open file \""; - msg += fileName; - msg += "\" for reading."; - throw runtime_error(msg); - } - - init(); -} - - -WavInFile::WavInFile(FILE *file) -{ - // Try to open the file for reading - fptr = file; - if (!file) - { - // didn't succeed - string msg = "Error : Unable to access input stream for reading"; - throw runtime_error(msg); - } - - init(); -} - - -/// Init the WAV file stream -void WavInFile::init() -{ - int hdrsOk; - - // assume file stream is already open - assert(fptr); - - // Read the file headers - hdrsOk = readWavHeaders(); - if (hdrsOk != 0) - { - // Something didn't match in the wav file headers - string msg = "Input file is corrupt or not a WAV file"; - throw runtime_error(msg); - } - - if (header.format.fixed != 1) - { - string msg = "Input file uses unsupported encoding."; - throw runtime_error(msg); - } - - dataRead = 0; -} - - - -WavInFile::~WavInFile() -{ - if (fptr) fclose(fptr); - fptr = NULL; -} - - - -void WavInFile::rewind() -{ - int hdrsOk; - - fseek(fptr, 0, SEEK_SET); - hdrsOk = readWavHeaders(); - assert(hdrsOk == 0); - dataRead = 0; -} - - -int WavInFile::checkCharTags() const -{ - // header.format.fmt should equal to 'fmt ' - if (memcmp(fmtStr, header.format.fmt, 4) != 0) return -1; - // header.data.data_field should equal to 'data' - if (memcmp(dataStr, header.data.data_field, 4) != 0) return -1; - - return 0; -} - - -int WavInFile::read(char *buffer, int maxElems) -{ - int numBytes; - uint afterDataRead; - - // ensure it's 8 bit format - if (header.format.bits_per_sample != 8) - { - throw runtime_error("Error: WavInFile::read(char*, int) works only with 8bit samples."); - } - assert(sizeof(char) == 1); - - numBytes = maxElems; - afterDataRead = dataRead + numBytes; - if (afterDataRead > header.data.data_len) - { - // Don't read more samples than are marked available in header - numBytes = (int)header.data.data_len - (int)dataRead; - assert(numBytes >= 0); - } - - assert(buffer); - numBytes = fread(buffer, 1, numBytes, fptr); - dataRead += numBytes; - - return numBytes; -} - - -int WavInFile::read(short *buffer, int maxElems) -{ - unsigned int afterDataRead; - int numBytes; - int numElems; - - assert(buffer); - if (header.format.bits_per_sample == 8) - { - // 8 bit format - char *temp = new char[maxElems]; - int i; - - numElems = read(temp, maxElems); - // convert from 8 to 16 bit - for (i = 0; i < numElems; i ++) - { - buffer[i] = temp[i] << 8; - } - delete[] temp; - } - else - { - // 16 bit format - assert(header.format.bits_per_sample == 16); - assert(sizeof(short) == 2); - - numBytes = maxElems * 2; - afterDataRead = dataRead + numBytes; - if (afterDataRead > header.data.data_len) - { - // Don't read more samples than are marked available in header - numBytes = (int)header.data.data_len - (int)dataRead; - assert(numBytes >= 0); - } - - numBytes = fread(buffer, 1, numBytes, fptr); - dataRead += numBytes; - numElems = numBytes / 2; - - // 16bit samples, swap byte order if necessary - _swap16Buffer((unsigned short *)buffer, numElems); - } - - return numElems; -} - - - -int WavInFile::read(float *buffer, int maxElems) -{ - short *temp = new short[maxElems]; - int num; - int i; - double fscale; - - num = read(temp, maxElems); - - fscale = 1.0 / 32768.0; - // convert to floats, scale to range [-1..+1[ - for (i = 0; i < num; i ++) - { - buffer[i] = (float)(fscale * (double)temp[i]); - } - - delete[] temp; - - return num; -} - - -int WavInFile::eof() const -{ - // return true if all data has been read or file eof has reached - return (dataRead == header.data.data_len || feof(fptr)); -} - - - -// test if character code is between a white space ' ' and little 'z' -static int isAlpha(char c) -{ - return (c >= ' ' && c <= 'z') ? 1 : 0; -} - - -// test if all characters are between a white space ' ' and little 'z' -static int isAlphaStr(const char *str) -{ - char c; - - c = str[0]; - while (c) - { - if (isAlpha(c) == 0) return 0; - str ++; - c = str[0]; - } - - return 1; -} - - -int WavInFile::readRIFFBlock() -{ - if (fread(&(header.riff), sizeof(WavRiff), 1, fptr) != 1) return -1; - - // swap 32bit data byte order if necessary - _swap32((unsigned int &)header.riff.package_len); - - // header.riff.riff_char should equal to 'RIFF'); - if (memcmp(riffStr, header.riff.riff_char, 4) != 0) return -1; - // header.riff.wave should equal to 'WAVE' - if (memcmp(waveStr, header.riff.wave, 4) != 0) return -1; - - return 0; -} - - - - -int WavInFile::readHeaderBlock() -{ - char label[5]; - string sLabel; - - // lead label string - if (fread(label, 1, 4, fptr) !=4) return -1; - label[4] = 0; - - if (isAlphaStr(label) == 0) return -1; // not a valid label - - // Decode blocks according to their label - if (strcmp(label, fmtStr) == 0) - { - int nLen, nDump; - - // 'fmt ' block - memcpy(header.format.fmt, fmtStr, 4); - - // read length of the format field - if (fread(&nLen, sizeof(int), 1, fptr) != 1) return -1; - // swap byte order if necessary - _swap32((unsigned int &)nLen); // int format_len; - header.format.format_len = nLen; - - // calculate how much length differs from expected - nDump = nLen - ((int)sizeof(header.format) - 8); - - // if format_len is larger than expected, read only as much data as we've space for - if (nDump > 0) - { - nLen = sizeof(header.format) - 8; - } - - // read data - if (fread(&(header.format.fixed), nLen, 1, fptr) != 1) return -1; - - // swap byte order if necessary - _swap16((unsigned short &)header.format.fixed); // short int fixed; - _swap16((unsigned short &)header.format.channel_number); // short int channel_number; - _swap32((unsigned int &)header.format.sample_rate); // int sample_rate; - _swap32((unsigned int &)header.format.byte_rate); // int byte_rate; - _swap16((unsigned short &)header.format.byte_per_sample); // short int byte_per_sample; - _swap16((unsigned short &)header.format.bits_per_sample); // short int bits_per_sample; - - // if format_len is larger than expected, skip the extra data - if (nDump > 0) - { - fseek(fptr, nDump, SEEK_CUR); - } - - return 0; - } - else if (strcmp(label, dataStr) == 0) - { - // 'data' block - memcpy(header.data.data_field, dataStr, 4); - if (fread(&(header.data.data_len), sizeof(uint), 1, fptr) != 1) return -1; - - // swap byte order if necessary - _swap32((unsigned int &)header.data.data_len); - - return 1; - } - else - { - uint len, i; - uint temp; - // unknown block - - // read length - if (fread(&len, sizeof(len), 1, fptr) != 1) return -1; - // scan through the block - for (i = 0; i < len; i ++) - { - if (fread(&temp, 1, 1, fptr) != 1) return -1; - if (feof(fptr)) return -1; // unexpected eof - } - } - return 0; -} - - -int WavInFile::readWavHeaders() -{ - int res; - - memset(&header, 0, sizeof(header)); - - res = readRIFFBlock(); - if (res) return 1; - // read header blocks until data block is found - do - { - // read header blocks - res = readHeaderBlock(); - if (res < 0) return 1; // error in file structure - } while (res == 0); - // check that all required tags are legal - return checkCharTags(); -} - - -uint WavInFile::getNumChannels() const -{ - return header.format.channel_number; -} - - -uint WavInFile::getNumBits() const -{ - return header.format.bits_per_sample; -} - - -uint WavInFile::getBytesPerSample() const -{ - return getNumChannels() * getNumBits() / 8; -} - - -uint WavInFile::getSampleRate() const -{ - return header.format.sample_rate; -} - - - -uint WavInFile::getDataSizeInBytes() const -{ - return header.data.data_len; -} - - -uint WavInFile::getNumSamples() const -{ - if (header.format.byte_per_sample == 0) return 0; - return header.data.data_len / (unsigned short)header.format.byte_per_sample; -} - - -uint WavInFile::getLengthMS() const -{ - uint numSamples; - uint sampleRate; - - numSamples = getNumSamples(); - sampleRate = getSampleRate(); - - assert(numSamples < UINT_MAX / 1000); - return (1000 * numSamples / sampleRate); -} - - -////////////////////////////////////////////////////////////////////////////// -// -// Class WavOutFile -// - -WavOutFile::WavOutFile(const char *fileName, int sampleRate, int bits, int channels) -{ - bytesWritten = 0; - fptr = fopen(fileName, "wb"); - if (fptr == NULL) - { - string msg = "Error : Unable to open file \""; - msg += fileName; - msg += "\" for writing."; - //pmsg = msg.c_str; - throw runtime_error(msg); - } - - fillInHeader(sampleRate, bits, channels); - writeHeader(); -} - - -WavOutFile::WavOutFile(FILE *file, int sampleRate, int bits, int channels) -{ - bytesWritten = 0; - fptr = file; - if (fptr == NULL) - { - string msg = "Error : Unable to access output file stream."; - throw runtime_error(msg); - } - - fillInHeader(sampleRate, bits, channels); - writeHeader(); -} - - - -WavOutFile::~WavOutFile() -{ - finishHeader(); - if (fptr) fclose(fptr); - fptr = NULL; -} - - - -void WavOutFile::fillInHeader(uint sampleRate, uint bits, uint channels) -{ - // fill in the 'riff' part.. - - // copy string 'RIFF' to riff_char - memcpy(&(header.riff.riff_char), riffStr, 4); - // package_len unknown so far - header.riff.package_len = 0; - // copy string 'WAVE' to wave - memcpy(&(header.riff.wave), waveStr, 4); - - - // fill in the 'format' part.. - - // copy string 'fmt ' to fmt - memcpy(&(header.format.fmt), fmtStr, 4); - - header.format.format_len = 0x10; - header.format.fixed = 1; - header.format.channel_number = (short)channels; - header.format.sample_rate = (int)sampleRate; - header.format.bits_per_sample = (short)bits; - header.format.byte_per_sample = (short)(bits * channels / 8); - header.format.byte_rate = header.format.byte_per_sample * (int)sampleRate; - header.format.sample_rate = (int)sampleRate; - - // fill in the 'data' part.. - - // copy string 'data' to data_field - memcpy(&(header.data.data_field), dataStr, 4); - // data_len unknown so far - header.data.data_len = 0; -} - - -void WavOutFile::finishHeader() -{ - // supplement the file length into the header structure - header.riff.package_len = bytesWritten + 36; - header.data.data_len = bytesWritten; - - writeHeader(); -} - - - -void WavOutFile::writeHeader() -{ - WavHeader hdrTemp; - int res; - - // swap byte order if necessary - hdrTemp = header; - _swap32((unsigned int &)hdrTemp.riff.package_len); - _swap32((unsigned int &)hdrTemp.format.format_len); - _swap16((unsigned short &)hdrTemp.format.fixed); - _swap16((unsigned short &)hdrTemp.format.channel_number); - _swap32((unsigned int &)hdrTemp.format.sample_rate); - _swap32((unsigned int &)hdrTemp.format.byte_rate); - _swap16((unsigned short &)hdrTemp.format.byte_per_sample); - _swap16((unsigned short &)hdrTemp.format.bits_per_sample); - _swap32((unsigned int &)hdrTemp.data.data_len); - - // write the supplemented header in the beginning of the file - fseek(fptr, 0, SEEK_SET); - res = fwrite(&hdrTemp, sizeof(hdrTemp), 1, fptr); - if (res != 1) - { - throw runtime_error("Error while writing to a wav file."); - } - - // jump back to the end of the file - fseek(fptr, 0, SEEK_END); -} - - - -void WavOutFile::write(const char *buffer, int numElems) -{ - int res; - - if (header.format.bits_per_sample != 8) - { - throw runtime_error("Error: WavOutFile::write(const char*, int) accepts only 8bit samples."); - } - assert(sizeof(char) == 1); - - res = fwrite(buffer, 1, numElems, fptr); - if (res != numElems) - { - throw runtime_error("Error while writing to a wav file."); - } - - bytesWritten += numElems; -} - - -void WavOutFile::write(const short *buffer, int numElems) -{ - int res; - - // 16 bit samples - if (numElems < 1) return; // nothing to do - - if (header.format.bits_per_sample == 8) - { - int i; - char *temp = new char[numElems]; - // convert from 16bit format to 8bit format - for (i = 0; i < numElems; i ++) - { - temp[i] = buffer[i] >> 8; - } - // write in 8bit format - write(temp, numElems); - delete[] temp; - } - else - { - // 16bit format - unsigned short *pTemp = new unsigned short[numElems]; - - assert(header.format.bits_per_sample == 16); - - // allocate temp buffer to swap byte order if necessary - memcpy(pTemp, buffer, numElems * 2); - _swap16Buffer(pTemp, numElems); - - res = fwrite(pTemp, 2, numElems, fptr); - - delete[] pTemp; - - if (res != numElems) - { - throw runtime_error("Error while writing to a wav file."); - } - bytesWritten += 2 * numElems; - } -} - - -void WavOutFile::write(const float *buffer, int numElems) -{ - int i; - short *temp = new short[numElems]; - int iTemp; - - // convert to 16 bit integer - for (i = 0; i < numElems; i ++) - { - // convert to integer - iTemp = (int)(32768.0f * buffer[i]); - - // saturate - if (iTemp < -32768) iTemp = -32768; - if (iTemp > 32767) iTemp = 32767; - temp[i] = (short)iTemp; - } - - write(temp, numElems); - - delete[] temp; -} diff --git a/3rdparty/soundtouch/build.sh b/3rdparty/soundtouch/build.sh deleted file mode 100644 index d9db6858d6..0000000000 --- a/3rdparty/soundtouch/build.sh +++ /dev/null @@ -1,28 +0,0 @@ -#!/bin/sh - -curdir=`pwd` - -echo ----------------- -echo Building SoundTouch -echo ----------------- - -if [ $# -gt 0 ] && [ $1 = "all" ] -then - -aclocal -automake -a -autoconf -./configure -make clean -make install - -else -make $@ -fi - -if [ $? -ne 0 ] -then -exit 1 -fi - -#cp libZeroSPU2*.so* ${PCSX2PLUGINS} diff --git a/3rdparty/soundtouch/configure.ac b/3rdparty/soundtouch/configure.ac deleted file mode 100644 index 458551d5e8..0000000000 --- a/3rdparty/soundtouch/configure.ac +++ /dev/null @@ -1,37 +0,0 @@ -# -*- Autoconf -*- -# Process this file with autoconf to produce a configure script. - -#AC_PREREQ([2.63]) -AC_INIT([FULL-PACKAGE-NAME], [VERSION], [BUG-REPORT-ADDRESS]) -AM_INIT_AUTOMAKE -AC_CONFIG_SRCDIR([BPMDetect.h]) - -# Checks for programs. -AC_PROG_CXX -AC_PROG_CC -AC_PROG_RANLIB - -CFLAGS= -CPPFLAGS= -CXXFLAGS= -CCASFLAGS= - -CFLAGS+=" -m32 " -CPPFLAGS+=" -m32 " -CXXFLAGS+=" -m32 " -CCASFLAGS+=" -m32 " - -# Checks for header files. -AC_CHECK_HEADERS([limits.h memory.h stdlib.h string.h]) - -# Checks for typedefs, structures, and compiler characteristics. -AC_C_INLINE -AC_C_RESTRICT -AC_TYPE_SIZE_T -AC_HEADER_STDBOOL - -# Checks for library functions. -AC_CHECK_FUNCS([memmove memset]) - -AC_CONFIG_FILES([Makefile]) -AC_OUTPUT diff --git a/3rdparty/soundtouch/cpu_detect_x86_gcc.cpp b/3rdparty/soundtouch/cpu_detect_x86_gcc.cpp deleted file mode 100644 index dbb79236bc..0000000000 --- a/3rdparty/soundtouch/cpu_detect_x86_gcc.cpp +++ /dev/null @@ -1,134 +0,0 @@ -//////////////////////////////////////////////////////////////////////////////// -/// -/// Generic version of the x86 CPU extension detection routine. -/// -/// This file is for GNU & other non-Windows compilers, see 'cpu_detect_x86_win.cpp' -/// for the Microsoft compiler version. -/// -/// Author : Copyright (c) Olli Parviainen -/// Author e-mail : oparviai 'at' iki.fi -/// SoundTouch WWW: http://www.surina.net/soundtouch -/// -//////////////////////////////////////////////////////////////////////////////// -// -// Last changed : $Date: 2011-09-02 15:56:11 -0300 (sex, 02 set 2011) $ -// File revision : $Revision: 4 $ -// -// $Id: cpu_detect_x86_gcc.cpp 131 2011-09-02 18:56:11Z oparviai $ -// -//////////////////////////////////////////////////////////////////////////////// -// -// License : -// -// SoundTouch audio processing library -// Copyright (c) Olli Parviainen -// -// This library is free software; you can redistribute it and/or -// modify it under the terms of the GNU Lesser General Public -// License as published by the Free Software Foundation; either -// version 2.1 of the License, or (at your option) any later version. -// -// This library is distributed in the hope that it will be useful, -// but WITHOUT ANY WARRANTY; without even the implied warranty of -// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU -// Lesser General Public License for more details. -// -// You should have received a copy of the GNU Lesser General Public -// License along with this library; if not, write to the Free Software -// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA -// -//////////////////////////////////////////////////////////////////////////////// - -#include "cpu_detect.h" -#include "STTypes.h" - -////////////////////////////////////////////////////////////////////////////// -// -// processor instructions extension detection routines -// -////////////////////////////////////////////////////////////////////////////// - -// Flag variable indicating whick ISA extensions are disabled (for debugging) -static uint _dwDisabledISA = 0x00; // 0xffffffff; //<- use this to disable all extensions - -// Disables given set of instruction extensions. See SUPPORT_... defines. -void disableExtensions(uint dwDisableMask) -{ - _dwDisabledISA = dwDisableMask; -} - - - -/// Checks which instruction set extensions are supported by the CPU. -uint detectCPUextensions(void) -{ -#if (!(SOUNDTOUCH_ALLOW_X86_OPTIMIZATIONS) || !(__GNUC__)) - - return 0; // always disable extensions on non-x86 platforms. - -#else - uint res = 0; - - if (_dwDisabledISA == 0xffffffff) return 0; - - asm volatile( -#ifndef __x86_64__ - // Check if 'cpuid' instructions is available by toggling eflags bit 21. - // Skip this for x86-64 as they always have cpuid while stack manipulation - // differs from 16/32bit ISA. - "\n\txor %%esi, %%esi" // clear %%esi = result register - - "\n\tpushf" // save eflags to stack - "\n\tmovl (%%esp), %%eax" // load eax from stack (with eflags) - "\n\tmovl %%eax, %%ecx" // save the original eflags values to ecx - "\n\txor $0x00200000, %%eax" // toggle bit 21 - "\n\tmovl %%eax, (%%esp)" // store toggled eflags to stack - "\n\tpopf" // load eflags from stack - "\n\tpushf" // save updated eflags to stack - "\n\tmovl (%%esp), %%eax" // load eax from stack - "\n\tpopf" // pop stack to restore esp - "\n\txor %%edx, %%edx" // clear edx for defaulting no mmx - "\n\tcmp %%ecx, %%eax" // compare to original eflags values - "\n\tjz end" // jumps to 'end' if cpuid not present -#endif // __x86_64__ - - // cpuid instruction available, test for presence of mmx instructions - - "\n\tmovl $1, %%eax" - "\n\tcpuid" - "\n\ttest $0x00800000, %%edx" - "\n\tjz end" // branch if MMX not available - - "\n\tor $0x01, %%esi" // otherwise add MMX support bit - - "\n\ttest $0x02000000, %%edx" - "\n\tjz test3DNow" // branch if SSE not available - - "\n\tor $0x08, %%esi" // otherwise add SSE support bit - - "\n\ttest3DNow:" - // test for precense of AMD extensions - "\n\tmov $0x80000000, %%eax" - "\n\tcpuid" - "\n\tcmp $0x80000000, %%eax" - "\n\tjbe end" // branch if no AMD extensions detected - - // test for precense of 3DNow! extension - "\n\tmov $0x80000001, %%eax" - "\n\tcpuid" - "\n\ttest $0x80000000, %%edx" - "\n\tjz end" // branch if 3DNow! not detected - - "\n\tor $0x02, %%esi" // otherwise add 3DNow support bit - - "\n\tend:" - - "\n\tmov %%esi, %0" - - : "=r" (res) - : /* no inputs */ - : "%edx", "%eax", "%ecx", "%esi" ); - - return res & ~_dwDisabledISA; -#endif -} diff --git a/3rdparty/soundtouch/cpu_detect_x86_win.cpp b/3rdparty/soundtouch/cpu_detect_x86_win.cpp deleted file mode 100644 index 666c7b0700..0000000000 --- a/3rdparty/soundtouch/cpu_detect_x86_win.cpp +++ /dev/null @@ -1,137 +0,0 @@ -//////////////////////////////////////////////////////////////////////////////// -/// -/// Win32 version of the x86 CPU detect routine. -/// -/// This file is to be compiled in Windows platform with Microsoft Visual C++ -/// Compiler. Please see 'cpu_detect_x86_gcc.cpp' for the gcc compiler version -/// for all GNU platforms. -/// -/// Author : Copyright (c) Olli Parviainen -/// Author e-mail : oparviai 'at' iki.fi -/// SoundTouch WWW: http://www.surina.net/soundtouch -/// -//////////////////////////////////////////////////////////////////////////////// -// -// Last changed : $Date: 2011-07-17 07:58:40 -0300 (dom, 17 jul 2011) $ -// File revision : $Revision: 4 $ -// -// $Id: cpu_detect_x86_win.cpp 127 2011-07-17 10:58:40Z oparviai $ -// -//////////////////////////////////////////////////////////////////////////////// -// -// License : -// -// SoundTouch audio processing library -// Copyright (c) Olli Parviainen -// -// This library is free software; you can redistribute it and/or -// modify it under the terms of the GNU Lesser General Public -// License as published by the Free Software Foundation; either -// version 2.1 of the License, or (at your option) any later version. -// -// This library is distributed in the hope that it will be useful, -// but WITHOUT ANY WARRANTY; without even the implied warranty of -// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU -// Lesser General Public License for more details. -// -// You should have received a copy of the GNU Lesser General Public -// License along with this library; if not, write to the Free Software -// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA -// -//////////////////////////////////////////////////////////////////////////////// - -#include "cpu_detect.h" - -#include "STTypes.h" - -////////////////////////////////////////////////////////////////////////////// -// -// processor instructions extension detection routines -// -////////////////////////////////////////////////////////////////////////////// - -// Flag variable indicating whick ISA extensions are disabled (for debugging) -static uint _dwDisabledISA = 0x00; // 0xffffffff; //<- use this to disable all extensions - - -// Disables given set of instruction extensions. See SUPPORT_... defines. -void disableExtensions(uint dwDisableMask) -{ - _dwDisabledISA = dwDisableMask; -} - - - -/// Checks which instruction set extensions are supported by the CPU. -uint detectCPUextensions(void) -{ - uint res = 0; - - if (_dwDisabledISA == 0xffffffff) return 0; - -#ifndef _M_X64 - // 32bit compilation, detect CPU capabilities with inline assembler. - __asm - { - ; check if 'cpuid' instructions is available by toggling eflags bit 21 - ; - xor esi, esi ; clear esi = result register - - pushfd ; save eflags to stack - mov eax,dword ptr [esp] ; load eax from stack (with eflags) - mov ecx, eax ; save the original eflags values to ecx - xor eax, 0x00200000 ; toggle bit 21 - mov dword ptr [esp],eax ; store toggled eflags to stack - popfd ; load eflags from stack - - pushfd ; save updated eflags to stack - mov eax,dword ptr [esp] ; load eax from stack - popfd ; pop stack to restore stack pointer - - xor edx, edx ; clear edx for defaulting no mmx - cmp eax, ecx ; compare to original eflags values - jz end ; jumps to 'end' if cpuid not present - - ; cpuid instruction available, test for presence of mmx instructions - mov eax, 1 - cpuid - test edx, 0x00800000 - jz end ; branch if MMX not available - - or esi, SUPPORT_MMX ; otherwise add MMX support bit - - test edx, 0x02000000 - jz test3DNow ; branch if SSE not available - - or esi, SUPPORT_SSE ; otherwise add SSE support bit - - test3DNow: - ; test for precense of AMD extensions - mov eax, 0x80000000 - cpuid - cmp eax, 0x80000000 - jbe end ; branch if no AMD extensions detected - - ; test for precense of 3DNow! extension - mov eax, 0x80000001 - cpuid - test edx, 0x80000000 - jz end ; branch if 3DNow! not detected - - or esi, SUPPORT_3DNOW ; otherwise add 3DNow support bit - - end: - - mov res, esi - } - -#else - - // Visual C++ 64bit compilation doesn't support inline assembler. However, - // all x64 compatible CPUs support MMX & SSE extensions. - res = SUPPORT_MMX | SUPPORT_SSE | SUPPORT_SSE2; - -#endif - - return res & ~_dwDisabledISA; -} diff --git a/3rdparty/soundtouch/depcomp b/3rdparty/soundtouch/depcomp deleted file mode 120000 index 50adcba306..0000000000 --- a/3rdparty/soundtouch/depcomp +++ /dev/null @@ -1 +0,0 @@ -/usr/share/automake-1.10/depcomp \ No newline at end of file diff --git a/3rdparty/soundtouch/install-sh b/3rdparty/soundtouch/install-sh deleted file mode 120000 index 8272958b56..0000000000 --- a/3rdparty/soundtouch/install-sh +++ /dev/null @@ -1 +0,0 @@ -/usr/share/automake-1.10/install-sh \ No newline at end of file diff --git a/3rdparty/soundtouch/missing b/3rdparty/soundtouch/missing deleted file mode 120000 index 1f0fe88e65..0000000000 --- a/3rdparty/soundtouch/missing +++ /dev/null @@ -1 +0,0 @@ -/usr/share/automake-1.10/missing \ No newline at end of file diff --git a/3rdparty/soundtouch/BPMDetect.h b/3rdparty/soundtouch/soundtouch/BPMDetect.h similarity index 98% rename from 3rdparty/soundtouch/BPMDetect.h rename to 3rdparty/soundtouch/soundtouch/BPMDetect.h index 88628def06..35ec5b6115 100644 --- a/3rdparty/soundtouch/BPMDetect.h +++ b/3rdparty/soundtouch/soundtouch/BPMDetect.h @@ -26,7 +26,7 @@ /// //////////////////////////////////////////////////////////////////////////////// // -// Last changed : $Date: 2012-08-30 16:53:44 -0300 (qui, 30 ago 2012) $ +// Last changed : $Date: 2012-08-30 19:53:44 +0000 (Thu, 30 Aug 2012) $ // File revision : $Revision: 4 $ // // $Id: BPMDetect.h 150 2012-08-30 19:53:44Z oparviai $ diff --git a/3rdparty/soundtouch/FIFOSampleBuffer.h b/3rdparty/soundtouch/soundtouch/FIFOSampleBuffer.h similarity index 96% rename from 3rdparty/soundtouch/FIFOSampleBuffer.h rename to 3rdparty/soundtouch/soundtouch/FIFOSampleBuffer.h index 5f1eb5f3da..6d2fd59f65 100644 --- a/3rdparty/soundtouch/FIFOSampleBuffer.h +++ b/3rdparty/soundtouch/soundtouch/FIFOSampleBuffer.h @@ -15,10 +15,10 @@ /// //////////////////////////////////////////////////////////////////////////////// // -// Last changed : $Date: 2012-06-13 16:29:53 -0300 (qua, 13 jun 2012) $ +// Last changed : $Date: 2014-01-05 21:40:22 +0000 (Sun, 05 Jan 2014) $ // File revision : $Revision: 4 $ // -// $Id: FIFOSampleBuffer.h 143 2012-06-13 19:29:53Z oparviai $ +// $Id: FIFOSampleBuffer.h 177 2014-01-05 21:40:22Z oparviai $ // //////////////////////////////////////////////////////////////////////////////// // @@ -162,6 +162,12 @@ public: /// Sets number of channels, 1 = mono, 2 = stereo. void setChannels(int numChannels); + /// Get number of channels + int getChannels() + { + return channels; + } + /// Returns nonzero if there aren't any samples available for outputting. virtual int isEmpty() const; diff --git a/3rdparty/soundtouch/FIFOSamplePipe.h b/3rdparty/soundtouch/soundtouch/FIFOSamplePipe.h similarity index 99% rename from 3rdparty/soundtouch/FIFOSamplePipe.h rename to 3rdparty/soundtouch/soundtouch/FIFOSamplePipe.h index 805e92597e..cd3191c1af 100644 --- a/3rdparty/soundtouch/FIFOSamplePipe.h +++ b/3rdparty/soundtouch/soundtouch/FIFOSamplePipe.h @@ -17,7 +17,7 @@ /// //////////////////////////////////////////////////////////////////////////////// // -// Last changed : $Date: 2012-06-13 16:29:53 -0300 (qua, 13 jun 2012) $ +// Last changed : $Date: 2012-06-13 19:29:53 +0000 (Wed, 13 Jun 2012) $ // File revision : $Revision: 4 $ // // $Id: FIFOSamplePipe.h 143 2012-06-13 19:29:53Z oparviai $ diff --git a/3rdparty/soundtouch/STTypes.h b/3rdparty/soundtouch/soundtouch/STTypes.h similarity index 91% rename from 3rdparty/soundtouch/STTypes.h rename to 3rdparty/soundtouch/soundtouch/STTypes.h index 2c4584a142..3f95947f5d 100644 --- a/3rdparty/soundtouch/STTypes.h +++ b/3rdparty/soundtouch/soundtouch/STTypes.h @@ -8,10 +8,10 @@ /// //////////////////////////////////////////////////////////////////////////////// // -// Last changed : $Date: 2012-12-28 12:53:56 -0200 (sex, 28 dez 2012) $ +// Last changed : $Date: 2015-05-18 15:25:07 +0000 (Mon, 18 May 2015) $ // File revision : $Revision: 3 $ // -// $Id: STTypes.h 162 2012-12-28 14:53:56Z oparviai $ +// $Id: STTypes.h 215 2015-05-18 15:25:07Z oparviai $ // //////////////////////////////////////////////////////////////////////////////// // @@ -60,16 +60,6 @@ typedef unsigned long ulong; #include "soundtouch_config.h" #endif -#ifndef _WINDEF_ - // if these aren't defined already by Windows headers, define now - - typedef int BOOL; - - #define FALSE 0 - #define TRUE 1 - -#endif // _WINDEF_ - namespace soundtouch { @@ -78,7 +68,14 @@ namespace soundtouch //#undef SOUNDTOUCH_INTEGER_SAMPLES //#undef SOUNDTOUCH_FLOAT_SAMPLES - #if (defined(__SOFTFP__)) + /// If following flag is defined, always uses multichannel processing + /// routines also for mono and stero sound. This is for routine testing + /// purposes; output should be same with either routines, yet disabling + /// the dedicated mono/stereo processing routines will result in slower + /// runtime performance so recommendation is to keep this off. + // #define USE_MULTICH_ALWAYS + + #if (defined(__SOFTFP__) && defined(ANDROID)) // For Android compilation: Force use of Integer samples in case that // compilation uses soft-floating point emulation - soft-fp is way too slow #undef SOUNDTOUCH_FLOAT_SAMPLES @@ -175,6 +172,7 @@ namespace soundtouch #else // use c++ standard exceptions #include + #include #define ST_THROW_RT_ERROR(x) {throw std::runtime_error(x);} #endif diff --git a/3rdparty/soundtouch/SoundTouch.h b/3rdparty/soundtouch/soundtouch/SoundTouch.h similarity index 96% rename from 3rdparty/soundtouch/SoundTouch.h rename to 3rdparty/soundtouch/soundtouch/SoundTouch.h index 6ae0e4a829..f15c65c0e3 100644 --- a/3rdparty/soundtouch/SoundTouch.h +++ b/3rdparty/soundtouch/soundtouch/SoundTouch.h @@ -41,10 +41,10 @@ /// //////////////////////////////////////////////////////////////////////////////// // -// Last changed : $Date: 2012-12-28 17:32:59 -0200 (sex, 28 dez 2012) $ +// Last changed : $Date: 2015-05-18 15:28:41 +0000 (Mon, 18 May 2015) $ // File revision : $Revision: 4 $ // -// $Id: SoundTouch.h 163 2012-12-28 19:32:59Z oparviai $ +// $Id: SoundTouch.h 216 2015-05-18 15:28:41Z oparviai $ // //////////////////////////////////////////////////////////////////////////////// // @@ -79,10 +79,10 @@ namespace soundtouch { /// Soundtouch library version string -#define SOUNDTOUCH_VERSION "1.7.1" +#define SOUNDTOUCH_VERSION "1.9.0" /// SoundTouch library version id -#define SOUNDTOUCH_VERSION_ID (10701) +#define SOUNDTOUCH_VERSION_ID (10900) // // Available setting IDs for the 'setSetting' & 'get_setting' functions: @@ -160,7 +160,7 @@ private: float virtualPitch; /// Flag: Has sample rate been set? - BOOL bSrateSet; + bool bSrateSet; /// Calculates effective rate & tempo valuescfrom 'virtualRate', 'virtualTempo' and /// 'virtualPitch' parameters. @@ -247,8 +247,8 @@ public: /// Changes a setting controlling the processing system behaviour. See the /// 'SETTING_...' defines for available setting ID's. /// - /// \return 'TRUE' if the setting was succesfully changed - BOOL setSetting(int settingId, ///< Setting ID number. see SETTING_... defines. + /// \return 'true' if the setting was succesfully changed + bool setSetting(int settingId, ///< Setting ID number. see SETTING_... defines. int value ///< New setting value. ); diff --git a/3rdparty/soundtouch/soundtouch_config.h b/3rdparty/soundtouch/soundtouch_config.h deleted file mode 100644 index f768fd1640..0000000000 --- a/3rdparty/soundtouch/soundtouch_config.h +++ /dev/null @@ -1,7 +0,0 @@ - -#ifndef SOUNDTOUCH_CONFIG_H_INCLUDED -#define SOUNDTOUCH_CONFIG_H_INCLUDED - - - -#endif // SOUNDTOUCH_CONFIG_H_INCLUDED diff --git a/3rdparty/soundtouch/source/SoundStretch/WavFile.cpp b/3rdparty/soundtouch/source/SoundStretch/WavFile.cpp new file mode 100644 index 0000000000..22fbaf1b1b --- /dev/null +++ b/3rdparty/soundtouch/source/SoundStretch/WavFile.cpp @@ -0,0 +1,997 @@ + //////////////////////////////////////////////////////////////////////////////// +/// +/// Classes for easy reading & writing of WAV sound files. +/// +/// For big-endian CPU, define _BIG_ENDIAN_ during compile-time to correctly +/// parse the WAV files with such processors. +/// +/// Admittingly, more complete WAV reader routines may exist in public domain, +/// but the reason for 'yet another' one is that those generic WAV reader +/// libraries are exhaustingly large and cumbersome! Wanted to have something +/// simpler here, i.e. something that's not already larger than rest of the +/// SoundTouch/SoundStretch program... +/// +/// Author : Copyright (c) Olli Parviainen +/// Author e-mail : oparviai 'at' iki.fi +/// SoundTouch WWW: http://www.surina.net/soundtouch +/// +//////////////////////////////////////////////////////////////////////////////// +// +// Last changed : $Date: 2014-10-05 16:20:24 +0000 (Sun, 05 Oct 2014) $ +// File revision : $Revision: 4 $ +// +// $Id: WavFile.cpp 200 2014-10-05 16:20:24Z oparviai $ +// +//////////////////////////////////////////////////////////////////////////////// +// +// License : +// +// SoundTouch audio processing library +// Copyright (c) Olli Parviainen +// +// This library is free software; you can redistribute it and/or +// modify it under the terms of the GNU Lesser General Public +// License as published by the Free Software Foundation; either +// version 2.1 of the License, or (at your option) any later version. +// +// This library is distributed in the hope that it will be useful, +// but WITHOUT ANY WARRANTY; without even the implied warranty of +// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU +// Lesser General Public License for more details. +// +// You should have received a copy of the GNU Lesser General Public +// License along with this library; if not, write to the Free Software +// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA +// +//////////////////////////////////////////////////////////////////////////////// + +#include +#include +#include +#include +#include +#include + +#include "WavFile.h" +#include "STTypes.h" + +using namespace std; + +static const char riffStr[] = "RIFF"; +static const char waveStr[] = "WAVE"; +static const char fmtStr[] = "fmt "; +static const char factStr[] = "fact"; +static const char dataStr[] = "data"; + + +////////////////////////////////////////////////////////////////////////////// +// +// Helper functions for swapping byte order to correctly read/write WAV files +// with big-endian CPU's: Define compile-time definition _BIG_ENDIAN_ to +// turn-on the conversion if it appears necessary. +// +// For example, Intel x86 is little-endian and doesn't require conversion, +// while PowerPC of Mac's and many other RISC cpu's are big-endian. + +#ifdef BYTE_ORDER + // In gcc compiler detect the byte order automatically + #if BYTE_ORDER == BIG_ENDIAN + // big-endian platform. + #define _BIG_ENDIAN_ + #endif +#endif + +#ifdef _BIG_ENDIAN_ + // big-endian CPU, swap bytes in 16 & 32 bit words + + // helper-function to swap byte-order of 32bit integer + static inline int _swap32(int &dwData) + { + dwData = ((dwData >> 24) & 0x000000FF) | + ((dwData >> 8) & 0x0000FF00) | + ((dwData << 8) & 0x00FF0000) | + ((dwData << 24) & 0xFF000000); + return dwData; + } + + // helper-function to swap byte-order of 16bit integer + static inline short _swap16(short &wData) + { + wData = ((wData >> 8) & 0x00FF) | + ((wData << 8) & 0xFF00); + return wData; + } + + // helper-function to swap byte-order of buffer of 16bit integers + static inline void _swap16Buffer(short *pData, int numWords) + { + int i; + + for (i = 0; i < numWords; i ++) + { + pData[i] = _swap16(pData[i]); + } + } + +#else // BIG_ENDIAN + // little-endian CPU, WAV file is ok as such + + // dummy helper-function + static inline int _swap32(int &dwData) + { + // do nothing + return dwData; + } + + // dummy helper-function + static inline short _swap16(short &wData) + { + // do nothing + return wData; + } + + // dummy helper-function + static inline void _swap16Buffer(short *pData, int numBytes) + { + // do nothing + } + +#endif // BIG_ENDIAN + + +////////////////////////////////////////////////////////////////////////////// +// +// Class WavFileBase +// + +WavFileBase::WavFileBase() +{ + convBuff = NULL; + convBuffSize = 0; +} + + +WavFileBase::~WavFileBase() +{ + delete[] convBuff; + convBuffSize = 0; +} + + +/// Get pointer to conversion buffer of at min. given size +void *WavFileBase::getConvBuffer(int sizeBytes) +{ + if (convBuffSize < sizeBytes) + { + delete[] convBuff; + + convBuffSize = (sizeBytes + 15) & -8; // round up to following 8-byte bounday + convBuff = new char[convBuffSize]; + } + return convBuff; +} + + +////////////////////////////////////////////////////////////////////////////// +// +// Class WavInFile +// + +WavInFile::WavInFile(const char *fileName) +{ + // Try to open the file for reading + fptr = fopen(fileName, "rb"); + if (fptr == NULL) + { + // didn't succeed + string msg = "Error : Unable to open file \""; + msg += fileName; + msg += "\" for reading."; + ST_THROW_RT_ERROR(msg.c_str()); + } + + init(); +} + + +WavInFile::WavInFile(FILE *file) +{ + // Try to open the file for reading + fptr = file; + if (!file) + { + // didn't succeed + string msg = "Error : Unable to access input stream for reading"; + ST_THROW_RT_ERROR(msg.c_str()); + } + + init(); +} + + +/// Init the WAV file stream +void WavInFile::init() +{ + int hdrsOk; + + // assume file stream is already open + assert(fptr); + + // Read the file headers + hdrsOk = readWavHeaders(); + if (hdrsOk != 0) + { + // Something didn't match in the wav file headers + string msg = "Input file is corrupt or not a WAV file"; + ST_THROW_RT_ERROR(msg.c_str()); + } + + /* Ignore 'fixed' field value as 32bit signed linear data can have other value than 1. + if (header.format.fixed != 1) + { + string msg = "Input file uses unsupported encoding."; + ST_THROW_RT_ERROR(msg.c_str()); + } + */ + + dataRead = 0; +} + + + +WavInFile::~WavInFile() +{ + if (fptr) fclose(fptr); + fptr = NULL; +} + + + +void WavInFile::rewind() +{ + int hdrsOk; + + fseek(fptr, 0, SEEK_SET); + hdrsOk = readWavHeaders(); + assert(hdrsOk == 0); + dataRead = 0; +} + + +int WavInFile::checkCharTags() const +{ + // header.format.fmt should equal to 'fmt ' + if (memcmp(fmtStr, header.format.fmt, 4) != 0) return -1; + // header.data.data_field should equal to 'data' + if (memcmp(dataStr, header.data.data_field, 4) != 0) return -1; + + return 0; +} + + +int WavInFile::read(unsigned char *buffer, int maxElems) +{ + int numBytes; + uint afterDataRead; + + // ensure it's 8 bit format + if (header.format.bits_per_sample != 8) + { + ST_THROW_RT_ERROR("Error: WavInFile::read(char*, int) works only with 8bit samples."); + } + assert(sizeof(char) == 1); + + numBytes = maxElems; + afterDataRead = dataRead + numBytes; + if (afterDataRead > header.data.data_len) + { + // Don't read more samples than are marked available in header + numBytes = (int)header.data.data_len - (int)dataRead; + assert(numBytes >= 0); + } + + assert(buffer); + numBytes = (int)fread(buffer, 1, numBytes, fptr); + dataRead += numBytes; + + return numBytes; +} + + +int WavInFile::read(short *buffer, int maxElems) +{ + unsigned int afterDataRead; + int numBytes; + int numElems; + + assert(buffer); + switch (header.format.bits_per_sample) + { + case 8: + { + // 8 bit format + unsigned char *temp = (unsigned char*)getConvBuffer(maxElems); + int i; + + numElems = read(temp, maxElems); + // convert from 8 to 16 bit + for (i = 0; i < numElems; i ++) + { + buffer[i] = (short)(((short)temp[i] - 128) * 256); + } + break; + } + + case 16: + { + // 16 bit format + + assert(sizeof(short) == 2); + + numBytes = maxElems * 2; + afterDataRead = dataRead + numBytes; + if (afterDataRead > header.data.data_len) + { + // Don't read more samples than are marked available in header + numBytes = (int)header.data.data_len - (int)dataRead; + assert(numBytes >= 0); + } + + numBytes = (int)fread(buffer, 1, numBytes, fptr); + dataRead += numBytes; + numElems = numBytes / 2; + + // 16bit samples, swap byte order if necessary + _swap16Buffer((short *)buffer, numElems); + break; + } + + default: + { + stringstream ss; + ss << "\nOnly 8/16 bit sample WAV files supported in integer compilation. Can't open WAV file with "; + ss << (int)header.format.bits_per_sample; + ss << " bit sample format. "; + ST_THROW_RT_ERROR(ss.str().c_str()); + } + }; + + return numElems; +} + + +/// Read data in float format. Notice that when reading in float format +/// 8/16/24/32 bit sample formats are supported +int WavInFile::read(float *buffer, int maxElems) +{ + unsigned int afterDataRead; + int numBytes; + int numElems; + int bytesPerSample; + + assert(buffer); + + bytesPerSample = header.format.bits_per_sample / 8; + if ((bytesPerSample < 1) || (bytesPerSample > 4)) + { + stringstream ss; + ss << "\nOnly 8/16/24/32 bit sample WAV files supported. Can't open WAV file with "; + ss << (int)header.format.bits_per_sample; + ss << " bit sample format. "; + ST_THROW_RT_ERROR(ss.str().c_str()); + } + + numBytes = maxElems * bytesPerSample; + afterDataRead = dataRead + numBytes; + if (afterDataRead > header.data.data_len) + { + // Don't read more samples than are marked available in header + numBytes = (int)header.data.data_len - (int)dataRead; + assert(numBytes >= 0); + } + + // read raw data into temporary buffer + char *temp = (char*)getConvBuffer(numBytes); + numBytes = (int)fread(temp, 1, numBytes, fptr); + dataRead += numBytes; + + numElems = numBytes / bytesPerSample; + + // swap byte ordert & convert to float, depending on sample format + switch (bytesPerSample) + { + case 1: + { + unsigned char *temp2 = (unsigned char*)temp; + double conv = 1.0 / 128.0; + for (int i = 0; i < numElems; i ++) + { + buffer[i] = (float)(temp2[i] * conv - 1.0); + } + break; + } + + case 2: + { + short *temp2 = (short*)temp; + double conv = 1.0 / 32768.0; + for (int i = 0; i < numElems; i ++) + { + short value = temp2[i]; + buffer[i] = (float)(_swap16(value) * conv); + } + break; + } + + case 3: + { + char *temp2 = (char *)temp; + double conv = 1.0 / 8388608.0; + for (int i = 0; i < numElems; i ++) + { + int value = *((int*)temp2); + value = _swap32(value) & 0x00ffffff; // take 24 bits + value |= (value & 0x00800000) ? 0xff000000 : 0; // extend minus sign bits + buffer[i] = (float)(value * conv); + temp2 += 3; + } + break; + } + + case 4: + { + int *temp2 = (int *)temp; + double conv = 1.0 / 2147483648.0; + assert(sizeof(int) == 4); + for (int i = 0; i < numElems; i ++) + { + int value = temp2[i]; + buffer[i] = (float)(_swap32(value) * conv); + } + break; + } + } + + return numElems; +} + + +int WavInFile::eof() const +{ + // return true if all data has been read or file eof has reached + return (dataRead == header.data.data_len || feof(fptr)); +} + + + +// test if character code is between a white space ' ' and little 'z' +static int isAlpha(char c) +{ + return (c >= ' ' && c <= 'z') ? 1 : 0; +} + + +// test if all characters are between a white space ' ' and little 'z' +static int isAlphaStr(const char *str) +{ + char c; + + c = str[0]; + while (c) + { + if (isAlpha(c) == 0) return 0; + str ++; + c = str[0]; + } + + return 1; +} + + +int WavInFile::readRIFFBlock() +{ + if (fread(&(header.riff), sizeof(WavRiff), 1, fptr) != 1) return -1; + + // swap 32bit data byte order if necessary + _swap32((int &)header.riff.package_len); + + // header.riff.riff_char should equal to 'RIFF'); + if (memcmp(riffStr, header.riff.riff_char, 4) != 0) return -1; + // header.riff.wave should equal to 'WAVE' + if (memcmp(waveStr, header.riff.wave, 4) != 0) return -1; + + return 0; +} + + + + +int WavInFile::readHeaderBlock() +{ + char label[5]; + string sLabel; + + // lead label string + if (fread(label, 1, 4, fptr) !=4) return -1; + label[4] = 0; + + if (isAlphaStr(label) == 0) return -1; // not a valid label + + // Decode blocks according to their label + if (strcmp(label, fmtStr) == 0) + { + int nLen, nDump; + + // 'fmt ' block + memcpy(header.format.fmt, fmtStr, 4); + + // read length of the format field + if (fread(&nLen, sizeof(int), 1, fptr) != 1) return -1; + // swap byte order if necessary + _swap32(nLen); // int format_len; + header.format.format_len = nLen; + + // calculate how much length differs from expected + nDump = nLen - ((int)sizeof(header.format) - 8); + + // if format_len is larger than expected, read only as much data as we've space for + if (nDump > 0) + { + nLen = sizeof(header.format) - 8; + } + + // read data + if (fread(&(header.format.fixed), nLen, 1, fptr) != 1) return -1; + + // swap byte order if necessary + _swap16(header.format.fixed); // short int fixed; + _swap16(header.format.channel_number); // short int channel_number; + _swap32((int &)header.format.sample_rate); // int sample_rate; + _swap32((int &)header.format.byte_rate); // int byte_rate; + _swap16(header.format.byte_per_sample); // short int byte_per_sample; + _swap16(header.format.bits_per_sample); // short int bits_per_sample; + + // if format_len is larger than expected, skip the extra data + if (nDump > 0) + { + fseek(fptr, nDump, SEEK_CUR); + } + + return 0; + } + else if (strcmp(label, factStr) == 0) + { + int nLen, nDump; + + // 'fact' block + memcpy(header.fact.fact_field, factStr, 4); + + // read length of the fact field + if (fread(&nLen, sizeof(int), 1, fptr) != 1) return -1; + // swap byte order if necessary + _swap32(nLen); // int fact_len; + header.fact.fact_len = nLen; + + // calculate how much length differs from expected + nDump = nLen - ((int)sizeof(header.fact) - 8); + + // if format_len is larger than expected, read only as much data as we've space for + if (nDump > 0) + { + nLen = sizeof(header.fact) - 8; + } + + // read data + if (fread(&(header.fact.fact_sample_len), nLen, 1, fptr) != 1) return -1; + + // swap byte order if necessary + _swap32((int &)header.fact.fact_sample_len); // int sample_length; + + // if fact_len is larger than expected, skip the extra data + if (nDump > 0) + { + fseek(fptr, nDump, SEEK_CUR); + } + + return 0; + } + else if (strcmp(label, dataStr) == 0) + { + // 'data' block + memcpy(header.data.data_field, dataStr, 4); + if (fread(&(header.data.data_len), sizeof(uint), 1, fptr) != 1) return -1; + + // swap byte order if necessary + _swap32((int &)header.data.data_len); + + return 1; + } + else + { + uint len, i; + uint temp; + // unknown block + + // read length + if (fread(&len, sizeof(len), 1, fptr) != 1) return -1; + // scan through the block + for (i = 0; i < len; i ++) + { + if (fread(&temp, 1, 1, fptr) != 1) return -1; + if (feof(fptr)) return -1; // unexpected eof + } + } + return 0; +} + + +int WavInFile::readWavHeaders() +{ + int res; + + memset(&header, 0, sizeof(header)); + + res = readRIFFBlock(); + if (res) return 1; + // read header blocks until data block is found + do + { + // read header blocks + res = readHeaderBlock(); + if (res < 0) return 1; // error in file structure + } while (res == 0); + // check that all required tags are legal + return checkCharTags(); +} + + +uint WavInFile::getNumChannels() const +{ + return header.format.channel_number; +} + + +uint WavInFile::getNumBits() const +{ + return header.format.bits_per_sample; +} + + +uint WavInFile::getBytesPerSample() const +{ + return getNumChannels() * getNumBits() / 8; +} + + +uint WavInFile::getSampleRate() const +{ + return header.format.sample_rate; +} + + + +uint WavInFile::getDataSizeInBytes() const +{ + return header.data.data_len; +} + + +uint WavInFile::getNumSamples() const +{ + if (header.format.byte_per_sample == 0) return 0; + if (header.format.fixed > 1) return header.fact.fact_sample_len; + return header.data.data_len / (unsigned short)header.format.byte_per_sample; +} + + +uint WavInFile::getLengthMS() const +{ + double numSamples; + double sampleRate; + + numSamples = (double)getNumSamples(); + sampleRate = (double)getSampleRate(); + + return (uint)(1000.0 * numSamples / sampleRate + 0.5); +} + + +/// Returns how many milliseconds of audio have so far been read from the file +uint WavInFile::getElapsedMS() const +{ + return (uint)(1000.0 * (double)dataRead / (double)header.format.byte_rate); +} + + + +////////////////////////////////////////////////////////////////////////////// +// +// Class WavOutFile +// + +WavOutFile::WavOutFile(const char *fileName, int sampleRate, int bits, int channels) +{ + bytesWritten = 0; + fptr = fopen(fileName, "wb"); + if (fptr == NULL) + { + string msg = "Error : Unable to open file \""; + msg += fileName; + msg += "\" for writing."; + //pmsg = msg.c_str; + ST_THROW_RT_ERROR(msg.c_str()); + } + + fillInHeader(sampleRate, bits, channels); + writeHeader(); +} + + +WavOutFile::WavOutFile(FILE *file, int sampleRate, int bits, int channels) +{ + bytesWritten = 0; + fptr = file; + if (fptr == NULL) + { + string msg = "Error : Unable to access output file stream."; + ST_THROW_RT_ERROR(msg.c_str()); + } + + fillInHeader(sampleRate, bits, channels); + writeHeader(); +} + + + +WavOutFile::~WavOutFile() +{ + finishHeader(); + if (fptr) fclose(fptr); + fptr = NULL; +} + + + +void WavOutFile::fillInHeader(uint sampleRate, uint bits, uint channels) +{ + // fill in the 'riff' part.. + + // copy string 'RIFF' to riff_char + memcpy(&(header.riff.riff_char), riffStr, 4); + // package_len unknown so far + header.riff.package_len = 0; + // copy string 'WAVE' to wave + memcpy(&(header.riff.wave), waveStr, 4); + + // fill in the 'format' part.. + + // copy string 'fmt ' to fmt + memcpy(&(header.format.fmt), fmtStr, 4); + + header.format.format_len = 0x10; + header.format.fixed = 1; + header.format.channel_number = (short)channels; + header.format.sample_rate = (int)sampleRate; + header.format.bits_per_sample = (short)bits; + header.format.byte_per_sample = (short)(bits * channels / 8); + header.format.byte_rate = header.format.byte_per_sample * (int)sampleRate; + header.format.sample_rate = (int)sampleRate; + + // fill in the 'fact' part... + memcpy(&(header.fact.fact_field), factStr, 4); + header.fact.fact_len = 4; + header.fact.fact_sample_len = 0; + + // fill in the 'data' part.. + + // copy string 'data' to data_field + memcpy(&(header.data.data_field), dataStr, 4); + // data_len unknown so far + header.data.data_len = 0; +} + + +void WavOutFile::finishHeader() +{ + // supplement the file length into the header structure + header.riff.package_len = bytesWritten + sizeof(WavHeader) - sizeof(WavRiff) + 4; + header.data.data_len = bytesWritten; + header.fact.fact_sample_len = bytesWritten / header.format.byte_per_sample; + + writeHeader(); +} + + + +void WavOutFile::writeHeader() +{ + WavHeader hdrTemp; + int res; + + // swap byte order if necessary + hdrTemp = header; + _swap32((int &)hdrTemp.riff.package_len); + _swap32((int &)hdrTemp.format.format_len); + _swap16((short &)hdrTemp.format.fixed); + _swap16((short &)hdrTemp.format.channel_number); + _swap32((int &)hdrTemp.format.sample_rate); + _swap32((int &)hdrTemp.format.byte_rate); + _swap16((short &)hdrTemp.format.byte_per_sample); + _swap16((short &)hdrTemp.format.bits_per_sample); + _swap32((int &)hdrTemp.data.data_len); + _swap32((int &)hdrTemp.fact.fact_len); + _swap32((int &)hdrTemp.fact.fact_sample_len); + + // write the supplemented header in the beginning of the file + fseek(fptr, 0, SEEK_SET); + res = (int)fwrite(&hdrTemp, sizeof(hdrTemp), 1, fptr); + if (res != 1) + { + ST_THROW_RT_ERROR("Error while writing to a wav file."); + } + + // jump back to the end of the file + fseek(fptr, 0, SEEK_END); +} + + + +void WavOutFile::write(const unsigned char *buffer, int numElems) +{ + int res; + + if (header.format.bits_per_sample != 8) + { + ST_THROW_RT_ERROR("Error: WavOutFile::write(const char*, int) accepts only 8bit samples."); + } + assert(sizeof(char) == 1); + + res = (int)fwrite(buffer, 1, numElems, fptr); + if (res != numElems) + { + ST_THROW_RT_ERROR("Error while writing to a wav file."); + } + + bytesWritten += numElems; +} + + + +void WavOutFile::write(const short *buffer, int numElems) +{ + int res; + + // 16 bit samples + if (numElems < 1) return; // nothing to do + + switch (header.format.bits_per_sample) + { + case 8: + { + int i; + unsigned char *temp = (unsigned char *)getConvBuffer(numElems); + // convert from 16bit format to 8bit format + for (i = 0; i < numElems; i ++) + { + temp[i] = (unsigned char)(buffer[i] / 256 + 128); + } + // write in 8bit format + write(temp, numElems); + break; + } + + case 16: + { + // 16bit format + + // use temp buffer to swap byte order if necessary + short *pTemp = (short *)getConvBuffer(numElems * sizeof(short)); + memcpy(pTemp, buffer, numElems * 2); + _swap16Buffer(pTemp, numElems); + + res = (int)fwrite(pTemp, 2, numElems, fptr); + + if (res != numElems) + { + ST_THROW_RT_ERROR("Error while writing to a wav file."); + } + bytesWritten += 2 * numElems; + break; + } + + default: + { + stringstream ss; + ss << "\nOnly 8/16 bit sample WAV files supported in integer compilation. Can't open WAV file with "; + ss << (int)header.format.bits_per_sample; + ss << " bit sample format. "; + ST_THROW_RT_ERROR(ss.str().c_str()); + } + } +} + + +/// Convert from float to integer and saturate +inline int saturate(float fvalue, float minval, float maxval) +{ + if (fvalue > maxval) + { + fvalue = maxval; + } + else if (fvalue < minval) + { + fvalue = minval; + } + return (int)fvalue; +} + + +void WavOutFile::write(const float *buffer, int numElems) +{ + int numBytes; + int bytesPerSample; + + if (numElems == 0) return; + + bytesPerSample = header.format.bits_per_sample / 8; + numBytes = numElems * bytesPerSample; + short *temp = (short*)getConvBuffer(numBytes); + + switch (bytesPerSample) + { + case 1: + { + unsigned char *temp2 = (unsigned char *)temp; + for (int i = 0; i < numElems; i ++) + { + temp2[i] = (unsigned char)saturate(buffer[i] * 128.0f + 128.0f, 0.0f, 255.0f); + } + break; + } + + case 2: + { + short *temp2 = (short *)temp; + for (int i = 0; i < numElems; i ++) + { + short value = (short)saturate(buffer[i] * 32768.0f, -32768.0f, 32767.0f); + temp2[i] = _swap16(value); + } + break; + } + + case 3: + { + char *temp2 = (char *)temp; + for (int i = 0; i < numElems; i ++) + { + int value = saturate(buffer[i] * 8388608.0f, -8388608.0f, 8388607.0f); + *((int*)temp2) = _swap32(value); + temp2 += 3; + } + break; + } + + case 4: + { + int *temp2 = (int *)temp; + for (int i = 0; i < numElems; i ++) + { + int value = saturate(buffer[i] * 2147483648.0f, -2147483648.0f, 2147483647.0f); + temp2[i] = _swap32(value); + } + break; + } + + default: + assert(false); + } + + int res = (int)fwrite(temp, 1, numBytes, fptr); + + if (res != numBytes) + { + ST_THROW_RT_ERROR("Error while writing to a wav file."); + } + bytesWritten += numBytes; +} diff --git a/3rdparty/soundtouch/WavFile.h b/3rdparty/soundtouch/source/SoundStretch/WavFile.h similarity index 82% rename from 3rdparty/soundtouch/WavFile.h rename to 3rdparty/soundtouch/source/SoundStretch/WavFile.h index 5ce62b1b82..2670e9ef4b 100644 --- a/3rdparty/soundtouch/WavFile.h +++ b/3rdparty/soundtouch/source/SoundStretch/WavFile.h @@ -4,10 +4,10 @@ /// /// For big-endian CPU, define BIG_ENDIAN during compile-time to correctly /// parse the WAV files with such processors. -/// -/// Admittingly, more complete WAV reader routines may exist in public domain, but +/// +/// Admittingly, more complete WAV reader routines may exist in public domain, but /// the reason for 'yet another' one is that those generic WAV reader libraries are -/// exhaustingly large and cumbersome! Wanted to have something simpler here, i.e. +/// exhaustingly large and cumbersome! Wanted to have something simpler here, i.e. /// something that's not already larger than rest of the SoundTouch/SoundStretch program... /// /// Author : Copyright (c) Olli Parviainen @@ -16,10 +16,10 @@ /// //////////////////////////////////////////////////////////////////////////////// // -// Last changed : $Date: 2009-02-21 18:00:14 +0200 (Sat, 21 Feb 2009) $ +// Last changed : $Date: 2014-10-05 16:20:24 +0000 (Sun, 05 Oct 2014) $ // File revision : $Revision: 4 $ // -// $Id: WavFile.h 63 2009-02-21 16:00:14Z oparviai $ +// $Id: WavFile.h 200 2014-10-05 16:20:24Z oparviai $ // //////////////////////////////////////////////////////////////////////////////// // @@ -51,11 +51,11 @@ #ifndef uint typedef unsigned int uint; -#endif +#endif /// WAV audio file 'riff' section header -typedef struct +typedef struct { char riff_char[4]; int package_len; @@ -63,7 +63,7 @@ typedef struct } WavRiff; /// WAV audio file 'format' section header -typedef struct +typedef struct { char fmt[4]; int format_len; @@ -75,8 +75,16 @@ typedef struct short bits_per_sample; } WavFormat; +/// WAV audio file 'fact' section header +typedef struct +{ + char fact_field[4]; + int fact_len; + uint fact_sample_len; +} WavFact; + /// WAV audio file 'data' section header -typedef struct +typedef struct { char data_field[4]; uint data_len; @@ -84,23 +92,44 @@ typedef struct /// WAV audio file header -typedef struct +typedef struct { WavRiff riff; WavFormat format; + WavFact fact; WavData data; } WavHeader; +/// Base class for processing WAV audio files. +class WavFileBase +{ +private: + /// Conversion working buffer; + char *convBuff; + int convBuffSize; + +protected: + WavFileBase(); + virtual ~WavFileBase(); + + /// Get pointer to conversion buffer of at min. given size + void *getConvBuffer(int sizeByte); +}; + + /// Class for reading WAV audio files. -class WavInFile +class WavInFile : protected WavFileBase { private: /// File pointer. FILE *fptr; + /// Position within the audio stream + long position; + /// Counter of how many bytes of sample data have been read from the file. - uint dataRead; + long dataRead; /// WAV header information WavHeader header; @@ -142,7 +171,7 @@ public: /// Get number of bits per sample, i.e. 8 or 16. uint getNumBits() const; - /// Get sample data size in bytes. Ahem, this should return same information as + /// Get sample data size in bytes. Ahem, this should return same information as /// 'getBytesPerSample'... uint getDataSizeInBytes() const; @@ -151,22 +180,27 @@ public: /// Get number of bytes per audio sample (e.g. 16bit stereo = 4 bytes/sample) uint getBytesPerSample() const; - + /// Get number of audio channels in the file (1=mono, 2=stereo) uint getNumChannels() const; /// Get the audio file length in milliseconds uint getLengthMS() const; + /// Returns how many milliseconds of audio have so far been read from the file + /// + /// \return elapsed duration in milliseconds + uint getElapsedMS() const; + /// Reads audio samples from the WAV file. This routine works only for 8 bit samples. - /// Reads given number of elements from the file or if end-of-file reached, as many + /// Reads given number of elements from the file or if end-of-file reached, as many /// elements as are left in the file. /// /// \return Number of 8-bit integers read from the file. - int read(char *buffer, int maxElems); + int read(unsigned char *buffer, int maxElems); - /// Reads audio samples from the WAV file to 16 bit integer format. Reads given number - /// of elements from the file or if end-of-file reached, as many elements as are + /// Reads audio samples from the WAV file to 16 bit integer format. Reads given number + /// of elements from the file or if end-of-file reached, as many elements as are /// left in the file. /// /// \return Number of 16-bit integers read from the file. @@ -174,9 +208,10 @@ public: int maxElems ///< Size of 'buffer' array (number of array elements). ); - /// Reads audio samples from the WAV file to floating point format, converting + /// Reads audio samples from the WAV file to floating point format, converting /// sample values to range [-1,1[. Reads given number of elements from the file /// or if end-of-file reached, as many elements as are left in the file. + /// Notice that reading in float format supports 8/16/24/32bit sample formats. /// /// \return Number of elements read from the file. int read(float *buffer, ///< Pointer to buffer where to read data. @@ -192,7 +227,7 @@ public: /// Class for writing WAV audio files. -class WavOutFile +class WavOutFile : protected WavFileBase { private: /// Pointer to the WAV file @@ -215,7 +250,7 @@ private: void writeHeader(); public: - /// Constructor: Creates a new WAV file. Throws a 'runtime_error' exception + /// Constructor: Creates a new WAV file. Throws a 'runtime_error' exception /// if file creation fails. WavOutFile(const char *fileName, ///< Filename int sampleRate, ///< Sample rate (e.g. 44100 etc) @@ -228,10 +263,10 @@ public: /// Destructor: Finalizes & closes the WAV file. ~WavOutFile(); - /// Write data to WAV file. This function works only with 8bit samples. + /// Write data to WAV file. This function works only with 8bit samples. /// Throws a 'runtime_error' exception if writing to file fails. - void write(const char *buffer, ///< Pointer to sample data buffer. - int numElems ///< How many array items are to be written to file. + void write(const unsigned char *buffer, ///< Pointer to sample data buffer. + int numElems ///< How many array items are to be written to file. ); /// Write data to WAV file. Throws a 'runtime_error' exception if writing to diff --git a/3rdparty/soundtouch/AAFilter.cpp b/3rdparty/soundtouch/source/SoundTouch/AAFilter.cpp similarity index 73% rename from 3rdparty/soundtouch/AAFilter.cpp rename to 3rdparty/soundtouch/source/SoundTouch/AAFilter.cpp index 860f7d5223..ac4ec20e14 100644 --- a/3rdparty/soundtouch/AAFilter.cpp +++ b/3rdparty/soundtouch/source/SoundTouch/AAFilter.cpp @@ -12,10 +12,10 @@ /// //////////////////////////////////////////////////////////////////////////////// // -// Last changed : $Date: 2009-01-11 09:34:24 -0200 (dom, 11 jan 2009) $ +// Last changed : $Date: 2014-01-05 21:40:22 +0000 (Sun, 05 Jan 2014) $ // File revision : $Revision: 4 $ // -// $Id: AAFilter.cpp 45 2009-01-11 11:34:24Z oparviai $ +// $Id: AAFilter.cpp 177 2014-01-05 21:40:22Z oparviai $ // //////////////////////////////////////////////////////////////////////////////// // @@ -52,6 +52,30 @@ using namespace soundtouch; #define PI 3.141592655357989 #define TWOPI (2 * PI) +// define this to save AA filter coefficients to a file +// #define _DEBUG_SAVE_AAFILTER_COEFFICIENTS 1 + +#ifdef _DEBUG_SAVE_AAFILTER_COEFFICIENTS + #include + + static void _DEBUG_SAVE_AAFIR_COEFFS(SAMPLETYPE *coeffs, int len) + { + FILE *fptr = fopen("aa_filter_coeffs.txt", "wt"); + if (fptr == NULL) return; + + for (int i = 0; i < len; i ++) + { + double temp = coeffs[i]; + fprintf(fptr, "%lf\n", temp); + } + fclose(fptr); + } + +#else + #define _DEBUG_SAVE_AAFIR_COEFFS(x, y) +#endif + + /***************************************************************************** * * Implementation of the class 'AAFilter' @@ -99,7 +123,7 @@ void AAFilter::calculateCoeffs() { uint i; double cntTemp, temp, tempCoeff,h, w; - double fc2, wc; + double wc; double scaleCoeff, sum; double *work; SAMPLETYPE *coeffs; @@ -112,8 +136,7 @@ void AAFilter::calculateCoeffs() work = new double[length]; coeffs = new SAMPLETYPE[length]; - fc2 = 2.0 * cutoffFreq; - wc = PI * fc2; + wc = 2.0 * PI * cutoffFreq; tempCoeff = TWOPI / (double)length; sum = 0; @@ -124,7 +147,7 @@ void AAFilter::calculateCoeffs() temp = cntTemp * wc; if (temp != 0) { - h = fc2 * sin(temp) / temp; // sinc function + h = sin(temp) / temp; // sinc function } else { @@ -153,17 +176,21 @@ void AAFilter::calculateCoeffs() for (i = 0; i < length; i ++) { - // scale & round to nearest integer temp = work[i] * scaleCoeff; +//#if SOUNDTOUCH_INTEGER_SAMPLES + // scale & round to nearest integer temp += (temp >= 0) ? 0.5 : -0.5; // ensure no overfloods assert(temp >= -32768 && temp <= 32767); +//#endif coeffs[i] = (SAMPLETYPE)temp; } // Set coefficients. Use divide factor 14 => divide result by 2^14 = 16384 pFIR->setCoefficients(coeffs, length, 14); + _DEBUG_SAVE_AAFIR_COEFFS(coeffs, length); + delete[] work; delete[] coeffs; } @@ -178,6 +205,31 @@ uint AAFilter::evaluate(SAMPLETYPE *dest, const SAMPLETYPE *src, uint numSamples } +/// Applies the filter to the given src & dest pipes, so that processed amount of +/// samples get removed from src, and produced amount added to dest +/// Note : The amount of outputted samples is by value of 'filter length' +/// smaller than the amount of input samples. +uint AAFilter::evaluate(FIFOSampleBuffer &dest, FIFOSampleBuffer &src) const +{ + SAMPLETYPE *pdest; + const SAMPLETYPE *psrc; + uint numSrcSamples; + uint result; + int numChannels = src.getChannels(); + + assert(numChannels == dest.getChannels()); + + numSrcSamples = src.numSamples(); + psrc = src.ptrBegin(); + pdest = dest.ptrEnd(numSrcSamples); + result = pFIR->evaluate(pdest, psrc, numSrcSamples, numChannels); + src.receiveSamples(result); + dest.putSamples(result); + + return result; +} + + uint AAFilter::getLength() const { return pFIR->getLength(); diff --git a/3rdparty/soundtouch/AAFilter.h b/3rdparty/soundtouch/source/SoundTouch/AAFilter.h similarity index 84% rename from 3rdparty/soundtouch/AAFilter.h rename to 3rdparty/soundtouch/source/SoundTouch/AAFilter.h index 6b885e371c..f1b5f2a554 100644 --- a/3rdparty/soundtouch/AAFilter.h +++ b/3rdparty/soundtouch/source/SoundTouch/AAFilter.h @@ -13,10 +13,10 @@ /// //////////////////////////////////////////////////////////////////////////////// // -// Last changed : $Date: 2008-02-10 14:26:55 -0200 (dom, 10 fev 2008) $ +// Last changed : $Date: 2014-01-07 19:41:23 +0000 (Tue, 07 Jan 2014) $ // File revision : $Revision: 4 $ // -// $Id: AAFilter.h 11 2008-02-10 16:26:55Z oparviai $ +// $Id: AAFilter.h 187 2014-01-07 19:41:23Z oparviai $ // //////////////////////////////////////////////////////////////////////////////// // @@ -45,6 +45,7 @@ #define AAFilter_H #include "STTypes.h" +#include "FIFOSampleBuffer.h" namespace soundtouch { @@ -84,6 +85,14 @@ public: const SAMPLETYPE *src, uint numSamples, uint numChannels) const; + + /// Applies the filter to the given src & dest pipes, so that processed amount of + /// samples get removed from src, and produced amount added to dest + /// Note : The amount of outputted samples is by value of 'filter length' + /// smaller than the amount of input samples. + uint evaluate(FIFOSampleBuffer &dest, + FIFOSampleBuffer &src) const; + }; } diff --git a/3rdparty/soundtouch/BPMDetect.cpp b/3rdparty/soundtouch/source/SoundTouch/BPMDetect.cpp similarity index 98% rename from 3rdparty/soundtouch/BPMDetect.cpp rename to 3rdparty/soundtouch/source/SoundTouch/BPMDetect.cpp index 6f3cf04daa..c17884266c 100644 --- a/3rdparty/soundtouch/BPMDetect.cpp +++ b/3rdparty/soundtouch/source/SoundTouch/BPMDetect.cpp @@ -26,10 +26,10 @@ /// //////////////////////////////////////////////////////////////////////////////// // -// Last changed : $Date: 2012-08-30 16:45:25 -0300 (qui, 30 ago 2012) $ +// Last changed : $Date: 2015-02-21 21:24:29 +0000 (Sat, 21 Feb 2015) $ // File revision : $Revision: 4 $ // -// $Id: BPMDetect.cpp 149 2012-08-30 19:45:25Z oparviai $ +// $Id: BPMDetect.cpp 202 2015-02-21 21:24:29Z oparviai $ // //////////////////////////////////////////////////////////////////////////////// // @@ -226,6 +226,7 @@ void BPMDetect::updateXCorr(int process_samples) assert(buffer->numSamples() >= (uint)(process_samples + windowLen)); pBuffer = buffer->ptrBegin(); + #pragma omp parallel for for (offs = windowStart; offs < windowLen; offs ++) { LONG_SAMPLETYPE sum; diff --git a/3rdparty/soundtouch/FIFOSampleBuffer.cpp b/3rdparty/soundtouch/source/SoundTouch/FIFOSampleBuffer.cpp similarity index 99% rename from 3rdparty/soundtouch/FIFOSampleBuffer.cpp rename to 3rdparty/soundtouch/source/SoundTouch/FIFOSampleBuffer.cpp index 80314d81f9..4e75c8a433 100644 --- a/3rdparty/soundtouch/FIFOSampleBuffer.cpp +++ b/3rdparty/soundtouch/source/SoundTouch/FIFOSampleBuffer.cpp @@ -15,7 +15,7 @@ /// //////////////////////////////////////////////////////////////////////////////// // -// Last changed : $Date: 2012-11-08 16:53:01 -0200 (qui, 08 nov 2012) $ +// Last changed : $Date: 2012-11-08 18:53:01 +0000 (Thu, 08 Nov 2012) $ // File revision : $Revision: 4 $ // // $Id: FIFOSampleBuffer.cpp 160 2012-11-08 18:53:01Z oparviai $ diff --git a/3rdparty/soundtouch/FIRFilter.cpp b/3rdparty/soundtouch/source/SoundTouch/FIRFilter.cpp similarity index 76% rename from 3rdparty/soundtouch/FIRFilter.cpp rename to 3rdparty/soundtouch/source/SoundTouch/FIRFilter.cpp index 13a1896ce7..4a1c23fdd2 100644 --- a/3rdparty/soundtouch/FIRFilter.cpp +++ b/3rdparty/soundtouch/source/SoundTouch/FIRFilter.cpp @@ -11,10 +11,10 @@ /// //////////////////////////////////////////////////////////////////////////////// // -// Last changed : $Date: 2011-09-02 15:56:11 -0300 (sex, 02 set 2011) $ +// Last changed : $Date: 2015-02-21 21:24:29 +0000 (Sat, 21 Feb 2015) $ // File revision : $Revision: 4 $ // -// $Id: FIRFilter.cpp 131 2011-09-02 18:56:11Z oparviai $ +// $Id: FIRFilter.cpp 202 2015-02-21 21:24:29Z oparviai $ // //////////////////////////////////////////////////////////////////////////////// // @@ -72,8 +72,7 @@ FIRFilter::~FIRFilter() // Usual C-version of the filter routine for stereo sound uint FIRFilter::evaluateFilterStereo(SAMPLETYPE *dest, const SAMPLETYPE *src, uint numSamples) const { - uint i, j, end; - LONG_SAMPLETYPE suml, sumr; + int j, end; #ifdef SOUNDTOUCH_FLOAT_SAMPLES // when using floating point samples, use a scaler instead of a divider // because division is much slower operation than multiplying. @@ -87,9 +86,12 @@ uint FIRFilter::evaluateFilterStereo(SAMPLETYPE *dest, const SAMPLETYPE *src, ui end = 2 * (numSamples - length); + #pragma omp parallel for for (j = 0; j < end; j += 2) { const SAMPLETYPE *ptr; + LONG_SAMPLETYPE suml, sumr; + uint i; suml = sumr = 0; ptr = src + j; @@ -130,28 +132,31 @@ uint FIRFilter::evaluateFilterStereo(SAMPLETYPE *dest, const SAMPLETYPE *src, ui // Usual C-version of the filter routine for mono sound uint FIRFilter::evaluateFilterMono(SAMPLETYPE *dest, const SAMPLETYPE *src, uint numSamples) const { - uint i, j, end; - LONG_SAMPLETYPE sum; + int j, end; #ifdef SOUNDTOUCH_FLOAT_SAMPLES // when using floating point samples, use a scaler instead of a divider // because division is much slower operation than multiplying. double dScaler = 1.0 / (double)resultDivider; #endif - assert(length != 0); end = numSamples - length; + #pragma omp parallel for for (j = 0; j < end; j ++) { + const SAMPLETYPE *pSrc = src + j; + LONG_SAMPLETYPE sum; + uint i; + sum = 0; for (i = 0; i < length; i += 4) { // loop is unrolled by factor of 4 here for efficiency - sum += src[i + 0] * filterCoeffs[i + 0] + - src[i + 1] * filterCoeffs[i + 1] + - src[i + 2] * filterCoeffs[i + 2] + - src[i + 3] * filterCoeffs[i + 3]; + sum += pSrc[i + 0] * filterCoeffs[i + 0] + + pSrc[i + 1] * filterCoeffs[i + 1] + + pSrc[i + 2] * filterCoeffs[i + 2] + + pSrc[i + 3] * filterCoeffs[i + 3]; } #ifdef SOUNDTOUCH_INTEGER_SAMPLES sum >>= resultDivFactor; @@ -161,12 +166,67 @@ uint FIRFilter::evaluateFilterMono(SAMPLETYPE *dest, const SAMPLETYPE *src, uint sum *= dScaler; #endif // SOUNDTOUCH_INTEGER_SAMPLES dest[j] = (SAMPLETYPE)sum; - src ++; } return end; } +uint FIRFilter::evaluateFilterMulti(SAMPLETYPE *dest, const SAMPLETYPE *src, uint numSamples, uint numChannels) +{ + int j, end; + +#ifdef SOUNDTOUCH_FLOAT_SAMPLES + // when using floating point samples, use a scaler instead of a divider + // because division is much slower operation than multiplying. + double dScaler = 1.0 / (double)resultDivider; +#endif + + assert(length != 0); + assert(src != NULL); + assert(dest != NULL); + assert(filterCoeffs != NULL); + assert(numChannels < 16); + + end = numChannels * (numSamples - length); + + #pragma omp parallel for + for (j = 0; j < end; j += numChannels) + { + const SAMPLETYPE *ptr; + LONG_SAMPLETYPE sums[16]; + uint c, i; + + for (c = 0; c < numChannels; c ++) + { + sums[c] = 0; + } + + ptr = src + j; + + for (i = 0; i < length; i ++) + { + SAMPLETYPE coef=filterCoeffs[i]; + for (c = 0; c < numChannels; c ++) + { + sums[c] += ptr[0] * coef; + ptr ++; + } + } + + for (c = 0; c < numChannels; c ++) + { +#ifdef SOUNDTOUCH_INTEGER_SAMPLES + sums[c] >>= resultDivFactor; +#else + sums[c] *= dScaler; +#endif // SOUNDTOUCH_INTEGER_SAMPLES + dest[j+c] = (SAMPLETYPE)sums[c]; + } + } + return numSamples - length; +} + + // Set filter coeffiecients and length. // // Throws an exception if filter length isn't divisible by 8 @@ -199,18 +259,27 @@ uint FIRFilter::getLength() const // // Note : The amount of outputted samples is by value of 'filter_length' // smaller than the amount of input samples. -uint FIRFilter::evaluate(SAMPLETYPE *dest, const SAMPLETYPE *src, uint numSamples, uint numChannels) const +uint FIRFilter::evaluate(SAMPLETYPE *dest, const SAMPLETYPE *src, uint numSamples, uint numChannels) { - assert(numChannels == 1 || numChannels == 2); - assert(length > 0); assert(lengthDiv8 * 8 == length); + if (numSamples < length) return 0; - if (numChannels == 2) + +#ifndef USE_MULTICH_ALWAYS + if (numChannels == 1) + { + return evaluateFilterMono(dest, src, numSamples); + } + else if (numChannels == 2) { return evaluateFilterStereo(dest, src, numSamples); - } else { - return evaluateFilterMono(dest, src, numSamples); + } + else +#endif // USE_MULTICH_ALWAYS + { + assert(numChannels > 0); + return evaluateFilterMulti(dest, src, numSamples, numChannels); } } diff --git a/3rdparty/soundtouch/FIRFilter.h b/3rdparty/soundtouch/source/SoundTouch/FIRFilter.h similarity index 94% rename from 3rdparty/soundtouch/FIRFilter.h rename to 3rdparty/soundtouch/source/SoundTouch/FIRFilter.h index b593167452..70ba97cfe5 100644 --- a/3rdparty/soundtouch/FIRFilter.h +++ b/3rdparty/soundtouch/source/SoundTouch/FIRFilter.h @@ -11,10 +11,10 @@ /// //////////////////////////////////////////////////////////////////////////////// // -// Last changed : $Date: 2011-02-13 17:13:57 -0200 (dom, 13 fev 2011) $ +// Last changed : $Date: 2015-02-21 21:24:29 +0000 (Sat, 21 Feb 2015) $ // File revision : $Revision: 4 $ // -// $Id: FIRFilter.h 104 2011-02-13 19:13:57Z oparviai $ +// $Id: FIRFilter.h 202 2015-02-21 21:24:29Z oparviai $ // //////////////////////////////////////////////////////////////////////////////// // @@ -71,6 +71,7 @@ protected: virtual uint evaluateFilterMono(SAMPLETYPE *dest, const SAMPLETYPE *src, uint numSamples) const; + virtual uint evaluateFilterMulti(SAMPLETYPE *dest, const SAMPLETYPE *src, uint numSamples, uint numChannels); public: FIRFilter(); @@ -90,7 +91,7 @@ public: uint evaluate(SAMPLETYPE *dest, const SAMPLETYPE *src, uint numSamples, - uint numChannels) const; + uint numChannels); uint getLength() const; diff --git a/3rdparty/soundtouch/source/SoundTouch/InterpolateCubic.cpp b/3rdparty/soundtouch/source/SoundTouch/InterpolateCubic.cpp new file mode 100644 index 0000000000..8aa7374c74 --- /dev/null +++ b/3rdparty/soundtouch/source/SoundTouch/InterpolateCubic.cpp @@ -0,0 +1,200 @@ +//////////////////////////////////////////////////////////////////////////////// +/// +/// Cubic interpolation routine. +/// +/// Author : Copyright (c) Olli Parviainen +/// Author e-mail : oparviai 'at' iki.fi +/// SoundTouch WWW: http://www.surina.net/soundtouch +/// +//////////////////////////////////////////////////////////////////////////////// +// +// $Id: InterpolateCubic.cpp 179 2014-01-06 18:41:42Z oparviai $ +// +//////////////////////////////////////////////////////////////////////////////// +// +// License : +// +// SoundTouch audio processing library +// Copyright (c) Olli Parviainen +// +// This library is free software; you can redistribute it and/or +// modify it under the terms of the GNU Lesser General Public +// License as published by the Free Software Foundation; either +// version 2.1 of the License, or (at your option) any later version. +// +// This library is distributed in the hope that it will be useful, +// but WITHOUT ANY WARRANTY; without even the implied warranty of +// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU +// Lesser General Public License for more details. +// +// You should have received a copy of the GNU Lesser General Public +// License along with this library; if not, write to the Free Software +// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA +// +//////////////////////////////////////////////////////////////////////////////// + +#include +#include +#include "InterpolateCubic.h" +#include "STTypes.h" + +using namespace soundtouch; + +// cubic interpolation coefficients +static const float _coeffs[]= +{ -0.5f, 1.0f, -0.5f, 0.0f, + 1.5f, -2.5f, 0.0f, 1.0f, + -1.5f, 2.0f, 0.5f, 0.0f, + 0.5f, -0.5f, 0.0f, 0.0f}; + + +InterpolateCubic::InterpolateCubic() +{ + fract = 0; +} + + +void InterpolateCubic::resetRegisters() +{ + fract = 0; +} + + +/// Transpose mono audio. Returns number of produced output samples, and +/// updates "srcSamples" to amount of consumed source samples +int InterpolateCubic::transposeMono(SAMPLETYPE *pdest, + const SAMPLETYPE *psrc, + int &srcSamples) +{ + int i; + int srcSampleEnd = srcSamples - 4; + int srcCount = 0; + + i = 0; + while (srcCount < srcSampleEnd) + { + float out; + const float x3 = 1.0f; + const float x2 = (float)fract; // x + const float x1 = x2*x2; // x^2 + const float x0 = x1*x2; // x^3 + float y0, y1, y2, y3; + + assert(fract < 1.0); + + y0 = _coeffs[0] * x0 + _coeffs[1] * x1 + _coeffs[2] * x2 + _coeffs[3] * x3; + y1 = _coeffs[4] * x0 + _coeffs[5] * x1 + _coeffs[6] * x2 + _coeffs[7] * x3; + y2 = _coeffs[8] * x0 + _coeffs[9] * x1 + _coeffs[10] * x2 + _coeffs[11] * x3; + y3 = _coeffs[12] * x0 + _coeffs[13] * x1 + _coeffs[14] * x2 + _coeffs[15] * x3; + + out = y0 * psrc[0] + y1 * psrc[1] + y2 * psrc[2] + y3 * psrc[3]; + + pdest[i] = (SAMPLETYPE)out; + i ++; + + // update position fraction + fract += rate; + // update whole positions + int whole = (int)fract; + fract -= whole; + psrc += whole; + srcCount += whole; + } + srcSamples = srcCount; + return i; +} + + +/// Transpose stereo audio. Returns number of produced output samples, and +/// updates "srcSamples" to amount of consumed source samples +int InterpolateCubic::transposeStereo(SAMPLETYPE *pdest, + const SAMPLETYPE *psrc, + int &srcSamples) +{ + int i; + int srcSampleEnd = srcSamples - 4; + int srcCount = 0; + + i = 0; + while (srcCount < srcSampleEnd) + { + const float x3 = 1.0f; + const float x2 = (float)fract; // x + const float x1 = x2*x2; // x^2 + const float x0 = x1*x2; // x^3 + float y0, y1, y2, y3; + float out0, out1; + + assert(fract < 1.0); + + y0 = _coeffs[0] * x0 + _coeffs[1] * x1 + _coeffs[2] * x2 + _coeffs[3] * x3; + y1 = _coeffs[4] * x0 + _coeffs[5] * x1 + _coeffs[6] * x2 + _coeffs[7] * x3; + y2 = _coeffs[8] * x0 + _coeffs[9] * x1 + _coeffs[10] * x2 + _coeffs[11] * x3; + y3 = _coeffs[12] * x0 + _coeffs[13] * x1 + _coeffs[14] * x2 + _coeffs[15] * x3; + + out0 = y0 * psrc[0] + y1 * psrc[2] + y2 * psrc[4] + y3 * psrc[6]; + out1 = y0 * psrc[1] + y1 * psrc[3] + y2 * psrc[5] + y3 * psrc[7]; + + pdest[2*i] = (SAMPLETYPE)out0; + pdest[2*i+1] = (SAMPLETYPE)out1; + i ++; + + // update position fraction + fract += rate; + // update whole positions + int whole = (int)fract; + fract -= whole; + psrc += 2*whole; + srcCount += whole; + } + srcSamples = srcCount; + return i; +} + + +/// Transpose multi-channel audio. Returns number of produced output samples, and +/// updates "srcSamples" to amount of consumed source samples +int InterpolateCubic::transposeMulti(SAMPLETYPE *pdest, + const SAMPLETYPE *psrc, + int &srcSamples) +{ + int i; + int srcSampleEnd = srcSamples - 4; + int srcCount = 0; + + i = 0; + while (srcCount < srcSampleEnd) + { + const float x3 = 1.0f; + const float x2 = (float)fract; // x + const float x1 = x2*x2; // x^2 + const float x0 = x1*x2; // x^3 + float y0, y1, y2, y3; + + assert(fract < 1.0); + + y0 = _coeffs[0] * x0 + _coeffs[1] * x1 + _coeffs[2] * x2 + _coeffs[3] * x3; + y1 = _coeffs[4] * x0 + _coeffs[5] * x1 + _coeffs[6] * x2 + _coeffs[7] * x3; + y2 = _coeffs[8] * x0 + _coeffs[9] * x1 + _coeffs[10] * x2 + _coeffs[11] * x3; + y3 = _coeffs[12] * x0 + _coeffs[13] * x1 + _coeffs[14] * x2 + _coeffs[15] * x3; + + for (int c = 0; c < numChannels; c ++) + { + float out; + out = y0 * psrc[c] + y1 * psrc[c + numChannels] + y2 * psrc[c + 2 * numChannels] + y3 * psrc[c + 3 * numChannels]; + pdest[0] = (SAMPLETYPE)out; + pdest ++; + } + i ++; + + // update position fraction + fract += rate; + // update whole positions + int whole = (int)fract; + fract -= whole; + psrc += numChannels*whole; + srcCount += whole; + } + srcSamples = srcCount; + return i; +} diff --git a/3rdparty/soundtouch/source/SoundTouch/InterpolateCubic.h b/3rdparty/soundtouch/source/SoundTouch/InterpolateCubic.h new file mode 100644 index 0000000000..e0e302b233 --- /dev/null +++ b/3rdparty/soundtouch/source/SoundTouch/InterpolateCubic.h @@ -0,0 +1,67 @@ +//////////////////////////////////////////////////////////////////////////////// +/// +/// Cubic interpolation routine. +/// +/// Author : Copyright (c) Olli Parviainen +/// Author e-mail : oparviai 'at' iki.fi +/// SoundTouch WWW: http://www.surina.net/soundtouch +/// +//////////////////////////////////////////////////////////////////////////////// +// +// $Id: InterpolateCubic.h 179 2014-01-06 18:41:42Z oparviai $ +// +//////////////////////////////////////////////////////////////////////////////// +// +// License : +// +// SoundTouch audio processing library +// Copyright (c) Olli Parviainen +// +// This library is free software; you can redistribute it and/or +// modify it under the terms of the GNU Lesser General Public +// License as published by the Free Software Foundation; either +// version 2.1 of the License, or (at your option) any later version. +// +// This library is distributed in the hope that it will be useful, +// but WITHOUT ANY WARRANTY; without even the implied warranty of +// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU +// Lesser General Public License for more details. +// +// You should have received a copy of the GNU Lesser General Public +// License along with this library; if not, write to the Free Software +// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA +// +//////////////////////////////////////////////////////////////////////////////// + +#ifndef _InterpolateCubic_H_ +#define _InterpolateCubic_H_ + +#include "RateTransposer.h" +#include "STTypes.h" + +namespace soundtouch +{ + +class InterpolateCubic : public TransposerBase +{ +protected: + virtual void resetRegisters(); + virtual int transposeMono(SAMPLETYPE *dest, + const SAMPLETYPE *src, + int &srcSamples); + virtual int transposeStereo(SAMPLETYPE *dest, + const SAMPLETYPE *src, + int &srcSamples); + virtual int transposeMulti(SAMPLETYPE *dest, + const SAMPLETYPE *src, + int &srcSamples); + + float fract; + +public: + InterpolateCubic(); +}; + +} + +#endif diff --git a/3rdparty/soundtouch/source/SoundTouch/InterpolateLinear.cpp b/3rdparty/soundtouch/source/SoundTouch/InterpolateLinear.cpp new file mode 100644 index 0000000000..ae26e69a1e --- /dev/null +++ b/3rdparty/soundtouch/source/SoundTouch/InterpolateLinear.cpp @@ -0,0 +1,299 @@ +//////////////////////////////////////////////////////////////////////////////// +/// +/// Linear interpolation algorithm. +/// +/// Author : Copyright (c) Olli Parviainen +/// Author e-mail : oparviai 'at' iki.fi +/// SoundTouch WWW: http://www.surina.net/soundtouch +/// +//////////////////////////////////////////////////////////////////////////////// +// +// $Id: InterpolateLinear.cpp 180 2014-01-06 19:16:02Z oparviai $ +// +//////////////////////////////////////////////////////////////////////////////// +// +// License : +// +// SoundTouch audio processing library +// Copyright (c) Olli Parviainen +// +// This library is free software; you can redistribute it and/or +// modify it under the terms of the GNU Lesser General Public +// License as published by the Free Software Foundation; either +// version 2.1 of the License, or (at your option) any later version. +// +// This library is distributed in the hope that it will be useful, +// but WITHOUT ANY WARRANTY; without even the implied warranty of +// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU +// Lesser General Public License for more details. +// +// You should have received a copy of the GNU Lesser General Public +// License along with this library; if not, write to the Free Software +// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA +// +//////////////////////////////////////////////////////////////////////////////// + +#include +#include +#include "InterpolateLinear.h" + +using namespace soundtouch; + +////////////////////////////////////////////////////////////////////////////// +// +// InterpolateLinearInteger - integer arithmetic implementation +// + +/// fixed-point interpolation routine precision +#define SCALE 65536 + + +// Constructor +InterpolateLinearInteger::InterpolateLinearInteger() : TransposerBase() +{ + // Notice: use local function calling syntax for sake of clarity, + // to indicate the fact that C++ constructor can't call virtual functions. + resetRegisters(); + setRate(1.0f); +} + + +void InterpolateLinearInteger::resetRegisters() +{ + iFract = 0; +} + + +// Transposes the sample rate of the given samples using linear interpolation. +// 'Mono' version of the routine. Returns the number of samples returned in +// the "dest" buffer +int InterpolateLinearInteger::transposeMono(SAMPLETYPE *dest, const SAMPLETYPE *src, int &srcSamples) +{ + int i; + int srcSampleEnd = srcSamples - 1; + int srcCount = 0; + + i = 0; + while (srcCount < srcSampleEnd) + { + LONG_SAMPLETYPE temp; + + assert(iFract < SCALE); + + temp = (SCALE - iFract) * src[0] + iFract * src[1]; + dest[i] = (SAMPLETYPE)(temp / SCALE); + i++; + + iFract += iRate; + + int iWhole = iFract / SCALE; + iFract -= iWhole * SCALE; + srcCount += iWhole; + src += iWhole; + } + srcSamples = srcCount; + + return i; +} + + +// Transposes the sample rate of the given samples using linear interpolation. +// 'Stereo' version of the routine. Returns the number of samples returned in +// the "dest" buffer +int InterpolateLinearInteger::transposeStereo(SAMPLETYPE *dest, const SAMPLETYPE *src, int &srcSamples) +{ + int i; + int srcSampleEnd = srcSamples - 1; + int srcCount = 0; + + i = 0; + while (srcCount < srcSampleEnd) + { + LONG_SAMPLETYPE temp0; + LONG_SAMPLETYPE temp1; + + assert(iFract < SCALE); + + temp0 = (SCALE - iFract) * src[0] + iFract * src[2]; + temp1 = (SCALE - iFract) * src[1] + iFract * src[3]; + dest[0] = (SAMPLETYPE)(temp0 / SCALE); + dest[1] = (SAMPLETYPE)(temp1 / SCALE); + dest += 2; + i++; + + iFract += iRate; + + int iWhole = iFract / SCALE; + iFract -= iWhole * SCALE; + srcCount += iWhole; + src += 2*iWhole; + } + srcSamples = srcCount; + + return i; +} + + +int InterpolateLinearInteger::transposeMulti(SAMPLETYPE *dest, const SAMPLETYPE *src, int &srcSamples) +{ + int i; + int srcSampleEnd = srcSamples - 1; + int srcCount = 0; + + i = 0; + while (srcCount < srcSampleEnd) + { + LONG_SAMPLETYPE temp, vol1; + + assert(iFract < SCALE); + vol1 = (SCALE - iFract); + for (int c = 0; c < numChannels; c ++) + { + temp = vol1 * src[c] + iFract * src[c + numChannels]; + dest[0] = (SAMPLETYPE)(temp / SCALE); + dest ++; + } + i++; + + iFract += iRate; + + int iWhole = iFract / SCALE; + iFract -= iWhole * SCALE; + srcCount += iWhole; + src += iWhole * numChannels; + } + srcSamples = srcCount; + + return i; +} + + +// Sets new target iRate. Normal iRate = 1.0, smaller values represent slower +// iRate, larger faster iRates. +void InterpolateLinearInteger::setRate(float newRate) +{ + iRate = (int)(newRate * SCALE + 0.5f); + TransposerBase::setRate(newRate); +} + + +////////////////////////////////////////////////////////////////////////////// +// +// InterpolateLinearFloat - floating point arithmetic implementation +// +////////////////////////////////////////////////////////////////////////////// + + +// Constructor +InterpolateLinearFloat::InterpolateLinearFloat() : TransposerBase() +{ + // Notice: use local function calling syntax for sake of clarity, + // to indicate the fact that C++ constructor can't call virtual functions. + resetRegisters(); + setRate(1.0f); +} + + +void InterpolateLinearFloat::resetRegisters() +{ + fract = 0; +} + + +// Transposes the sample rate of the given samples using linear interpolation. +// 'Mono' version of the routine. Returns the number of samples returned in +// the "dest" buffer +int InterpolateLinearFloat::transposeMono(SAMPLETYPE *dest, const SAMPLETYPE *src, int &srcSamples) +{ + int i; + int srcSampleEnd = srcSamples - 1; + int srcCount = 0; + + i = 0; + while (srcCount < srcSampleEnd) + { + double out; + assert(fract < 1.0); + + out = (1.0 - fract) * src[0] + fract * src[1]; + dest[i] = (SAMPLETYPE)out; + i ++; + + // update position fraction + fract += rate; + // update whole positions + int whole = (int)fract; + fract -= whole; + src += whole; + srcCount += whole; + } + srcSamples = srcCount; + return i; +} + + +// Transposes the sample rate of the given samples using linear interpolation. +// 'Mono' version of the routine. Returns the number of samples returned in +// the "dest" buffer +int InterpolateLinearFloat::transposeStereo(SAMPLETYPE *dest, const SAMPLETYPE *src, int &srcSamples) +{ + int i; + int srcSampleEnd = srcSamples - 1; + int srcCount = 0; + + i = 0; + while (srcCount < srcSampleEnd) + { + double out0, out1; + assert(fract < 1.0); + + out0 = (1.0 - fract) * src[0] + fract * src[2]; + out1 = (1.0 - fract) * src[1] + fract * src[3]; + dest[2*i] = (SAMPLETYPE)out0; + dest[2*i+1] = (SAMPLETYPE)out1; + i ++; + + // update position fraction + fract += rate; + // update whole positions + int whole = (int)fract; + fract -= whole; + src += 2*whole; + srcCount += whole; + } + srcSamples = srcCount; + return i; +} + + +int InterpolateLinearFloat::transposeMulti(SAMPLETYPE *dest, const SAMPLETYPE *src, int &srcSamples) +{ + int i; + int srcSampleEnd = srcSamples - 1; + int srcCount = 0; + + i = 0; + while (srcCount < srcSampleEnd) + { + float temp, vol1; + + vol1 = (1.0f- fract); + for (int c = 0; c < numChannels; c ++) + { + temp = vol1 * src[c] + fract * src[c + numChannels]; + *dest = (SAMPLETYPE)temp; + dest ++; + } + i++; + + fract += rate; + + int iWhole = (int)fract; + fract -= iWhole; + srcCount += iWhole; + src += iWhole * numChannels; + } + srcSamples = srcCount; + + return i; +} diff --git a/3rdparty/soundtouch/source/SoundTouch/InterpolateLinear.h b/3rdparty/soundtouch/source/SoundTouch/InterpolateLinear.h new file mode 100644 index 0000000000..b76299f889 --- /dev/null +++ b/3rdparty/soundtouch/source/SoundTouch/InterpolateLinear.h @@ -0,0 +1,92 @@ +//////////////////////////////////////////////////////////////////////////////// +/// +/// Linear interpolation routine. +/// +/// Author : Copyright (c) Olli Parviainen +/// Author e-mail : oparviai 'at' iki.fi +/// SoundTouch WWW: http://www.surina.net/soundtouch +/// +//////////////////////////////////////////////////////////////////////////////// +// +// $Id: InterpolateLinear.h 179 2014-01-06 18:41:42Z oparviai $ +// +//////////////////////////////////////////////////////////////////////////////// +// +// License : +// +// SoundTouch audio processing library +// Copyright (c) Olli Parviainen +// +// This library is free software; you can redistribute it and/or +// modify it under the terms of the GNU Lesser General Public +// License as published by the Free Software Foundation; either +// version 2.1 of the License, or (at your option) any later version. +// +// This library is distributed in the hope that it will be useful, +// but WITHOUT ANY WARRANTY; without even the implied warranty of +// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU +// Lesser General Public License for more details. +// +// You should have received a copy of the GNU Lesser General Public +// License along with this library; if not, write to the Free Software +// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA +// +//////////////////////////////////////////////////////////////////////////////// + +#ifndef _InterpolateLinear_H_ +#define _InterpolateLinear_H_ + +#include "RateTransposer.h" +#include "STTypes.h" + +namespace soundtouch +{ + +/// Linear transposer class that uses integer arithmetics +class InterpolateLinearInteger : public TransposerBase +{ +protected: + int iFract; + int iRate; + + virtual void resetRegisters(); + + virtual int transposeMono(SAMPLETYPE *dest, + const SAMPLETYPE *src, + int &srcSamples); + virtual int transposeStereo(SAMPLETYPE *dest, + const SAMPLETYPE *src, + int &srcSamples); + virtual int transposeMulti(SAMPLETYPE *dest, const SAMPLETYPE *src, int &srcSamples); +public: + InterpolateLinearInteger(); + + /// Sets new target rate. Normal rate = 1.0, smaller values represent slower + /// rate, larger faster rates. + virtual void setRate(float newRate); +}; + + +/// Linear transposer class that uses floating point arithmetics +class InterpolateLinearFloat : public TransposerBase +{ +protected: + float fract; + + virtual void resetRegisters(); + + virtual int transposeMono(SAMPLETYPE *dest, + const SAMPLETYPE *src, + int &srcSamples); + virtual int transposeStereo(SAMPLETYPE *dest, + const SAMPLETYPE *src, + int &srcSamples); + virtual int transposeMulti(SAMPLETYPE *dest, const SAMPLETYPE *src, int &srcSamples); + +public: + InterpolateLinearFloat(); +}; + +} + +#endif diff --git a/3rdparty/soundtouch/source/SoundTouch/InterpolateShannon.cpp b/3rdparty/soundtouch/source/SoundTouch/InterpolateShannon.cpp new file mode 100644 index 0000000000..1085fd14cb --- /dev/null +++ b/3rdparty/soundtouch/source/SoundTouch/InterpolateShannon.cpp @@ -0,0 +1,185 @@ +//////////////////////////////////////////////////////////////////////////////// +/// +/// Sample interpolation routine using 8-tap band-limited Shannon interpolation +/// with kaiser window. +/// +/// Notice. This algorithm is remarkably much heavier than linear or cubic +/// interpolation, and not remarkably better than cubic algorithm. Thus mostly +/// for experimental purposes +/// +/// Author : Copyright (c) Olli Parviainen +/// Author e-mail : oparviai 'at' iki.fi +/// SoundTouch WWW: http://www.surina.net/soundtouch +/// +//////////////////////////////////////////////////////////////////////////////// +// +// $Id: InterpolateShannon.cpp 195 2014-04-06 15:57:21Z oparviai $ +// +//////////////////////////////////////////////////////////////////////////////// +// +// License : +// +// SoundTouch audio processing library +// Copyright (c) Olli Parviainen +// +// This library is free software; you can redistribute it and/or +// modify it under the terms of the GNU Lesser General Public +// License as published by the Free Software Foundation; either +// version 2.1 of the License, or (at your option) any later version. +// +// This library is distributed in the hope that it will be useful, +// but WITHOUT ANY WARRANTY; without even the implied warranty of +// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU +// Lesser General Public License for more details. +// +// You should have received a copy of the GNU Lesser General Public +// License along with this library; if not, write to the Free Software +// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA +// +//////////////////////////////////////////////////////////////////////////////// + +#include +#include "InterpolateShannon.h" +#include "STTypes.h" + +using namespace soundtouch; + + +/// Kaiser window with beta = 2.0 +/// Values scaled down by 5% to avoid overflows +static const double _kaiser8[8] = +{ + 0.41778693317814, + 0.64888025049173, + 0.83508562409944, + 0.93887857733412, + 0.93887857733412, + 0.83508562409944, + 0.64888025049173, + 0.41778693317814 +}; + + +InterpolateShannon::InterpolateShannon() +{ + fract = 0; +} + + +void InterpolateShannon::resetRegisters() +{ + fract = 0; +} + + +#define PI 3.1415926536 +#define sinc(x) (sin(PI * (x)) / (PI * (x))) + +/// Transpose mono audio. Returns number of produced output samples, and +/// updates "srcSamples" to amount of consumed source samples +int InterpolateShannon::transposeMono(SAMPLETYPE *pdest, + const SAMPLETYPE *psrc, + int &srcSamples) +{ + int i; + int srcSampleEnd = srcSamples - 8; + int srcCount = 0; + + i = 0; + while (srcCount < srcSampleEnd) + { + double out; + assert(fract < 1.0); + + out = psrc[0] * sinc(-3.0 - fract) * _kaiser8[0]; + out += psrc[1] * sinc(-2.0 - fract) * _kaiser8[1]; + out += psrc[2] * sinc(-1.0 - fract) * _kaiser8[2]; + if (fract < 1e-6) + { + out += psrc[3] * _kaiser8[3]; // sinc(0) = 1 + } + else + { + out += psrc[3] * sinc(- fract) * _kaiser8[3]; + } + out += psrc[4] * sinc( 1.0 - fract) * _kaiser8[4]; + out += psrc[5] * sinc( 2.0 - fract) * _kaiser8[5]; + out += psrc[6] * sinc( 3.0 - fract) * _kaiser8[6]; + out += psrc[7] * sinc( 4.0 - fract) * _kaiser8[7]; + + pdest[i] = (SAMPLETYPE)out; + i ++; + + // update position fraction + fract += rate; + // update whole positions + int whole = (int)fract; + fract -= whole; + psrc += whole; + srcCount += whole; + } + srcSamples = srcCount; + return i; +} + + +/// Transpose stereo audio. Returns number of produced output samples, and +/// updates "srcSamples" to amount of consumed source samples +int InterpolateShannon::transposeStereo(SAMPLETYPE *pdest, + const SAMPLETYPE *psrc, + int &srcSamples) +{ + int i; + int srcSampleEnd = srcSamples - 8; + int srcCount = 0; + + i = 0; + while (srcCount < srcSampleEnd) + { + double out0, out1, w; + assert(fract < 1.0); + + w = sinc(-3.0 - fract) * _kaiser8[0]; + out0 = psrc[0] * w; out1 = psrc[1] * w; + w = sinc(-2.0 - fract) * _kaiser8[1]; + out0 += psrc[2] * w; out1 += psrc[3] * w; + w = sinc(-1.0 - fract) * _kaiser8[2]; + out0 += psrc[4] * w; out1 += psrc[5] * w; + w = _kaiser8[3] * ((fract < 1e-5) ? 1.0 : sinc(- fract)); // sinc(0) = 1 + out0 += psrc[6] * w; out1 += psrc[7] * w; + w = sinc( 1.0 - fract) * _kaiser8[4]; + out0 += psrc[8] * w; out1 += psrc[9] * w; + w = sinc( 2.0 - fract) * _kaiser8[5]; + out0 += psrc[10] * w; out1 += psrc[11] * w; + w = sinc( 3.0 - fract) * _kaiser8[6]; + out0 += psrc[12] * w; out1 += psrc[13] * w; + w = sinc( 4.0 - fract) * _kaiser8[7]; + out0 += psrc[14] * w; out1 += psrc[15] * w; + + pdest[2*i] = (SAMPLETYPE)out0; + pdest[2*i+1] = (SAMPLETYPE)out1; + i ++; + + // update position fraction + fract += rate; + // update whole positions + int whole = (int)fract; + fract -= whole; + psrc += 2*whole; + srcCount += whole; + } + srcSamples = srcCount; + return i; +} + + +/// Transpose stereo audio. Returns number of produced output samples, and +/// updates "srcSamples" to amount of consumed source samples +int InterpolateShannon::transposeMulti(SAMPLETYPE *pdest, + const SAMPLETYPE *psrc, + int &srcSamples) +{ + // not implemented + assert(false); + return 0; +} diff --git a/3rdparty/soundtouch/source/SoundTouch/InterpolateShannon.h b/3rdparty/soundtouch/source/SoundTouch/InterpolateShannon.h new file mode 100644 index 0000000000..701640f7db --- /dev/null +++ b/3rdparty/soundtouch/source/SoundTouch/InterpolateShannon.h @@ -0,0 +1,72 @@ +//////////////////////////////////////////////////////////////////////////////// +/// +/// Sample interpolation routine using 8-tap band-limited Shannon interpolation +/// with kaiser window. +/// +/// Notice. This algorithm is remarkably much heavier than linear or cubic +/// interpolation, and not remarkably better than cubic algorithm. Thus mostly +/// for experimental purposes +/// +/// Author : Copyright (c) Olli Parviainen +/// Author e-mail : oparviai 'at' iki.fi +/// SoundTouch WWW: http://www.surina.net/soundtouch +/// +//////////////////////////////////////////////////////////////////////////////// +// +// $Id: InterpolateShannon.h 179 2014-01-06 18:41:42Z oparviai $ +// +//////////////////////////////////////////////////////////////////////////////// +// +// License : +// +// SoundTouch audio processing library +// Copyright (c) Olli Parviainen +// +// This library is free software; you can redistribute it and/or +// modify it under the terms of the GNU Lesser General Public +// License as published by the Free Software Foundation; either +// version 2.1 of the License, or (at your option) any later version. +// +// This library is distributed in the hope that it will be useful, +// but WITHOUT ANY WARRANTY; without even the implied warranty of +// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU +// Lesser General Public License for more details. +// +// You should have received a copy of the GNU Lesser General Public +// License along with this library; if not, write to the Free Software +// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA +// +//////////////////////////////////////////////////////////////////////////////// + +#ifndef _InterpolateShannon_H_ +#define _InterpolateShannon_H_ + +#include "RateTransposer.h" +#include "STTypes.h" + +namespace soundtouch +{ + +class InterpolateShannon : public TransposerBase +{ +protected: + void resetRegisters(); + int transposeMono(SAMPLETYPE *dest, + const SAMPLETYPE *src, + int &srcSamples); + int transposeStereo(SAMPLETYPE *dest, + const SAMPLETYPE *src, + int &srcSamples); + int transposeMulti(SAMPLETYPE *dest, + const SAMPLETYPE *src, + int &srcSamples); + + float fract; + +public: + InterpolateShannon(); +}; + +} + +#endif diff --git a/3rdparty/soundtouch/PeakFinder.cpp b/3rdparty/soundtouch/source/SoundTouch/PeakFinder.cpp similarity index 93% rename from 3rdparty/soundtouch/PeakFinder.cpp rename to 3rdparty/soundtouch/source/SoundTouch/PeakFinder.cpp index cc6a81d0a6..3c4c1f518f 100644 --- a/3rdparty/soundtouch/PeakFinder.cpp +++ b/3rdparty/soundtouch/source/SoundTouch/PeakFinder.cpp @@ -11,10 +11,10 @@ /// //////////////////////////////////////////////////////////////////////////////// // -// Last changed : $Date: 2012-12-28 17:52:47 -0200 (sex, 28 dez 2012) $ +// Last changed : $Date: 2015-05-18 15:22:02 +0000 (Mon, 18 May 2015) $ // File revision : $Revision: 4 $ // -// $Id: PeakFinder.cpp 164 2012-12-28 19:52:47Z oparviai $ +// $Id: PeakFinder.cpp 213 2015-05-18 15:22:02Z oparviai $ // //////////////////////////////////////////////////////////////////////////////// // @@ -192,11 +192,21 @@ double PeakFinder::getPeakCenter(const float *data, int peakpos) const gp1 = findGround(data, peakpos, -1); gp2 = findGround(data, peakpos, 1); - groundLevel = 0.5f * (data[gp1] + data[gp2]); peakLevel = data[peakpos]; - // calculate 70%-level of the peak - cutLevel = 0.70f * peakLevel + 0.30f * groundLevel; + if (gp1 == gp2) + { + // avoid rounding errors when all are equal + assert(gp1 == peakpos); + cutLevel = groundLevel = peakLevel; + } else { + // get average of the ground levels + groundLevel = 0.5f * (data[gp1] + data[gp2]); + + // calculate 70%-level of the peak + cutLevel = 0.70f * peakLevel + 0.30f * groundLevel; + } + // find mid-level crossings crosspos1 = findCrossingLevel(data, cutLevel, peakpos, -1); crosspos2 = findCrossingLevel(data, cutLevel, peakpos, 1); diff --git a/3rdparty/soundtouch/PeakFinder.h b/3rdparty/soundtouch/source/SoundTouch/PeakFinder.h similarity index 98% rename from 3rdparty/soundtouch/PeakFinder.h rename to 3rdparty/soundtouch/source/SoundTouch/PeakFinder.h index c2bbb6e95f..0bd448fe70 100644 --- a/3rdparty/soundtouch/PeakFinder.h +++ b/3rdparty/soundtouch/source/SoundTouch/PeakFinder.h @@ -9,7 +9,7 @@ /// //////////////////////////////////////////////////////////////////////////////// // -// Last changed : $Date: 2011-12-30 18:33:46 -0200 (sex, 30 dez 2011) $ +// Last changed : $Date: 2011-12-30 20:33:46 +0000 (Fri, 30 Dec 2011) $ // File revision : $Revision: 4 $ // // $Id: PeakFinder.h 132 2011-12-30 20:33:46Z oparviai $ diff --git a/3rdparty/soundtouch/source/SoundTouch/RateTransposer.cpp b/3rdparty/soundtouch/source/SoundTouch/RateTransposer.cpp new file mode 100644 index 0000000000..f1e3fd043b --- /dev/null +++ b/3rdparty/soundtouch/source/SoundTouch/RateTransposer.cpp @@ -0,0 +1,302 @@ +//////////////////////////////////////////////////////////////////////////////// +/// +/// Sample rate transposer. Changes sample rate by using linear interpolation +/// together with anti-alias filtering (first order interpolation with anti- +/// alias filtering should be quite adequate for this application) +/// +/// Author : Copyright (c) Olli Parviainen +/// Author e-mail : oparviai 'at' iki.fi +/// SoundTouch WWW: http://www.surina.net/soundtouch +/// +//////////////////////////////////////////////////////////////////////////////// +// +// Last changed : $Date: 2014-04-06 15:57:21 +0000 (Sun, 06 Apr 2014) $ +// File revision : $Revision: 4 $ +// +// $Id: RateTransposer.cpp 195 2014-04-06 15:57:21Z oparviai $ +// +//////////////////////////////////////////////////////////////////////////////// +// +// License : +// +// SoundTouch audio processing library +// Copyright (c) Olli Parviainen +// +// This library is free software; you can redistribute it and/or +// modify it under the terms of the GNU Lesser General Public +// License as published by the Free Software Foundation; either +// version 2.1 of the License, or (at your option) any later version. +// +// This library is distributed in the hope that it will be useful, +// but WITHOUT ANY WARRANTY; without even the implied warranty of +// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU +// Lesser General Public License for more details. +// +// You should have received a copy of the GNU Lesser General Public +// License along with this library; if not, write to the Free Software +// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA +// +//////////////////////////////////////////////////////////////////////////////// + +#include +#include +#include +#include +#include "RateTransposer.h" +#include "InterpolateLinear.h" +#include "InterpolateCubic.h" +#include "InterpolateShannon.h" +#include "AAFilter.h" + +using namespace soundtouch; + +// Define default interpolation algorithm here +TransposerBase::ALGORITHM TransposerBase::algorithm = TransposerBase::CUBIC; + + +// Constructor +RateTransposer::RateTransposer() : FIFOProcessor(&outputBuffer) +{ + bUseAAFilter = true; + + // Instantiates the anti-alias filter + pAAFilter = new AAFilter(64); + pTransposer = TransposerBase::newInstance(); +} + + + +RateTransposer::~RateTransposer() +{ + delete pAAFilter; + delete pTransposer; +} + + + +/// Enables/disables the anti-alias filter. Zero to disable, nonzero to enable +void RateTransposer::enableAAFilter(bool newMode) +{ + bUseAAFilter = newMode; +} + + +/// Returns nonzero if anti-alias filter is enabled. +bool RateTransposer::isAAFilterEnabled() const +{ + return bUseAAFilter; +} + + +AAFilter *RateTransposer::getAAFilter() +{ + return pAAFilter; +} + + + +// Sets new target iRate. Normal iRate = 1.0, smaller values represent slower +// iRate, larger faster iRates. +void RateTransposer::setRate(float newRate) +{ + double fCutoff; + + pTransposer->setRate(newRate); + + // design a new anti-alias filter + if (newRate > 1.0f) + { + fCutoff = 0.5f / newRate; + } + else + { + fCutoff = 0.5f * newRate; + } + pAAFilter->setCutoffFreq(fCutoff); +} + + +// Adds 'nSamples' pcs of samples from the 'samples' memory position into +// the input of the object. +void RateTransposer::putSamples(const SAMPLETYPE *samples, uint nSamples) +{ + processSamples(samples, nSamples); +} + + +// Transposes sample rate by applying anti-alias filter to prevent folding. +// Returns amount of samples returned in the "dest" buffer. +// The maximum amount of samples that can be returned at a time is set by +// the 'set_returnBuffer_size' function. +void RateTransposer::processSamples(const SAMPLETYPE *src, uint nSamples) +{ + uint count; + + if (nSamples == 0) return; + + // Store samples to input buffer + inputBuffer.putSamples(src, nSamples); + + // If anti-alias filter is turned off, simply transpose without applying + // the filter + if (bUseAAFilter == false) + { + count = pTransposer->transpose(outputBuffer, inputBuffer); + return; + } + + assert(pAAFilter); + + // Transpose with anti-alias filter + if (pTransposer->rate < 1.0f) + { + // If the parameter 'Rate' value is smaller than 1, first transpose + // the samples and then apply the anti-alias filter to remove aliasing. + + // Transpose the samples, store the result to end of "midBuffer" + pTransposer->transpose(midBuffer, inputBuffer); + + // Apply the anti-alias filter for transposed samples in midBuffer + pAAFilter->evaluate(outputBuffer, midBuffer); + } + else + { + // If the parameter 'Rate' value is larger than 1, first apply the + // anti-alias filter to remove high frequencies (prevent them from folding + // over the lover frequencies), then transpose. + + // Apply the anti-alias filter for samples in inputBuffer + pAAFilter->evaluate(midBuffer, inputBuffer); + + // Transpose the AA-filtered samples in "midBuffer" + pTransposer->transpose(outputBuffer, midBuffer); + } +} + + +// Sets the number of channels, 1 = mono, 2 = stereo +void RateTransposer::setChannels(int nChannels) +{ + assert(nChannels > 0); + + if (pTransposer->numChannels == nChannels) return; + pTransposer->setChannels(nChannels); + + inputBuffer.setChannels(nChannels); + midBuffer.setChannels(nChannels); + outputBuffer.setChannels(nChannels); +} + + +// Clears all the samples in the object +void RateTransposer::clear() +{ + outputBuffer.clear(); + midBuffer.clear(); + inputBuffer.clear(); +} + + +// Returns nonzero if there aren't any samples available for outputting. +int RateTransposer::isEmpty() const +{ + int res; + + res = FIFOProcessor::isEmpty(); + if (res == 0) return 0; + return inputBuffer.isEmpty(); +} + + +////////////////////////////////////////////////////////////////////////////// +// +// TransposerBase - Base class for interpolation +// + +// static function to set interpolation algorithm +void TransposerBase::setAlgorithm(TransposerBase::ALGORITHM a) +{ + TransposerBase::algorithm = a; +} + + +// Transposes the sample rate of the given samples using linear interpolation. +// Returns the number of samples returned in the "dest" buffer +int TransposerBase::transpose(FIFOSampleBuffer &dest, FIFOSampleBuffer &src) +{ + int numSrcSamples = src.numSamples(); + int sizeDemand = (int)((float)numSrcSamples / rate) + 8; + int numOutput; + SAMPLETYPE *psrc = src.ptrBegin(); + SAMPLETYPE *pdest = dest.ptrEnd(sizeDemand); + +#ifndef USE_MULTICH_ALWAYS + if (numChannels == 1) + { + numOutput = transposeMono(pdest, psrc, numSrcSamples); + } + else if (numChannels == 2) + { + numOutput = transposeStereo(pdest, psrc, numSrcSamples); + } + else +#endif // USE_MULTICH_ALWAYS + { + assert(numChannels > 0); + numOutput = transposeMulti(pdest, psrc, numSrcSamples); + } + dest.putSamples(numOutput); + src.receiveSamples(numSrcSamples); + return numOutput; +} + + +TransposerBase::TransposerBase() +{ + numChannels = 0; + rate = 1.0f; +} + + +TransposerBase::~TransposerBase() +{ +} + + +void TransposerBase::setChannels(int channels) +{ + numChannels = channels; + resetRegisters(); +} + + +void TransposerBase::setRate(float newRate) +{ + rate = newRate; +} + + +// static factory function +TransposerBase *TransposerBase::newInstance() +{ +#ifdef SOUNDTOUCH_INTEGER_SAMPLES + // Notice: For integer arithmetics support only linear algorithm (due to simplest calculus) + return ::new InterpolateLinearInteger; +#else + switch (algorithm) + { + case LINEAR: + return new InterpolateLinearFloat; + + case CUBIC: + return new InterpolateCubic; + + case SHANNON: + return new InterpolateShannon; + + default: + assert(false); + return NULL; + } +#endif +} diff --git a/3rdparty/soundtouch/RateTransposer.h b/3rdparty/soundtouch/source/SoundTouch/RateTransposer.h similarity index 72% rename from 3rdparty/soundtouch/RateTransposer.h rename to 3rdparty/soundtouch/source/SoundTouch/RateTransposer.h index 8374a0f834..fad6d65718 100644 --- a/3rdparty/soundtouch/RateTransposer.h +++ b/3rdparty/soundtouch/source/SoundTouch/RateTransposer.h @@ -14,10 +14,10 @@ /// //////////////////////////////////////////////////////////////////////////////// // -// Last changed : $Date: 2009-02-21 13:00:14 -0300 (sáb, 21 fev 2009) $ +// Last changed : $Date: 2014-04-06 15:57:21 +0000 (Sun, 06 Apr 2014) $ // File revision : $Revision: 4 $ // -// $Id: RateTransposer.h 63 2009-02-21 16:00:14Z oparviai $ +// $Id: RateTransposer.h 195 2014-04-06 15:57:21Z oparviai $ // //////////////////////////////////////////////////////////////////////////////// // @@ -55,50 +55,71 @@ namespace soundtouch { +/// Abstract base class for transposer implementations (linear, advanced vs integer, float etc) +class TransposerBase +{ +public: + enum ALGORITHM { + LINEAR = 0, + CUBIC, + SHANNON + }; + +protected: + virtual void resetRegisters() = 0; + + virtual int transposeMono(SAMPLETYPE *dest, + const SAMPLETYPE *src, + int &srcSamples) = 0; + virtual int transposeStereo(SAMPLETYPE *dest, + const SAMPLETYPE *src, + int &srcSamples) = 0; + virtual int transposeMulti(SAMPLETYPE *dest, + const SAMPLETYPE *src, + int &srcSamples) = 0; + + static ALGORITHM algorithm; + +public: + float rate; + int numChannels; + + TransposerBase(); + virtual ~TransposerBase(); + + virtual int transpose(FIFOSampleBuffer &dest, FIFOSampleBuffer &src); + virtual void setRate(float newRate); + virtual void setChannels(int channels); + + // static factory function + static TransposerBase *newInstance(); + + // static function to set interpolation algorithm + static void setAlgorithm(ALGORITHM a); +}; + + /// A common linear samplerate transposer class. /// -/// Note: Use function "RateTransposer::newInstance()" to create a new class -/// instance instead of the "new" operator; that function automatically -/// chooses a correct implementation depending on if integer or floating -/// arithmetics are to be used. class RateTransposer : public FIFOProcessor { protected: /// Anti-alias filter object AAFilter *pAAFilter; - - float fRate; - - int numChannels; + TransposerBase *pTransposer; /// Buffer for collecting samples to feed the anti-alias filter between /// two batches - FIFOSampleBuffer storeBuffer; + FIFOSampleBuffer inputBuffer; /// Buffer for keeping samples between transposing & anti-alias filter - FIFOSampleBuffer tempBuffer; + FIFOSampleBuffer midBuffer; /// Output sample buffer FIFOSampleBuffer outputBuffer; - BOOL bUseAAFilter; + bool bUseAAFilter; - virtual void resetRegisters() = 0; - - virtual uint transposeStereo(SAMPLETYPE *dest, - const SAMPLETYPE *src, - uint numSamples) = 0; - virtual uint transposeMono(SAMPLETYPE *dest, - const SAMPLETYPE *src, - uint numSamples) = 0; - inline uint transpose(SAMPLETYPE *dest, - const SAMPLETYPE *src, - uint numSamples); - - void downsample(const SAMPLETYPE *src, - uint numSamples); - void upsample(const SAMPLETYPE *src, - uint numSamples); /// Transposes sample rate by applying anti-alias filter to prevent folding. /// Returns amount of samples returned in the "dest" buffer. @@ -107,34 +128,33 @@ protected: void processSamples(const SAMPLETYPE *src, uint numSamples); - public: RateTransposer(); virtual ~RateTransposer(); /// Operator 'new' is overloaded so that it automatically creates a suitable instance /// depending on if we're to use integer or floating point arithmetics. - static void *operator new(size_t s); +// static void *operator new(size_t s); /// Use this function instead of "new" operator to create a new instance of this class. /// This function automatically chooses a correct implementation, depending on if /// integer ot floating point arithmetics are to be used. - static RateTransposer *newInstance(); +// static RateTransposer *newInstance(); /// Returns the output buffer object FIFOSamplePipe *getOutput() { return &outputBuffer; }; /// Returns the store buffer object - FIFOSamplePipe *getStore() { return &storeBuffer; }; +// FIFOSamplePipe *getStore() { return &storeBuffer; }; /// Return anti-alias filter object AAFilter *getAAFilter(); /// Enables/disables the anti-alias filter. Zero to disable, nonzero to enable - void enableAAFilter(BOOL newMode); + void enableAAFilter(bool newMode); /// Returns nonzero if anti-alias filter is enabled. - BOOL isAAFilterEnabled() const; + bool isAAFilterEnabled() const; /// Sets new target rate. Normal rate = 1.0, smaller values represent slower /// rate, larger faster rates. diff --git a/3rdparty/soundtouch/SoundTouch.cpp b/3rdparty/soundtouch/source/SoundTouch/SoundTouch.cpp similarity index 94% rename from 3rdparty/soundtouch/SoundTouch.cpp rename to 3rdparty/soundtouch/source/SoundTouch/SoundTouch.cpp index c66c16c54a..a9d23fc3c3 100644 --- a/3rdparty/soundtouch/SoundTouch.cpp +++ b/3rdparty/soundtouch/source/SoundTouch/SoundTouch.cpp @@ -41,10 +41,10 @@ /// //////////////////////////////////////////////////////////////////////////////// // -// Last changed : $Date: 2012-06-13 16:29:53 -0300 (qua, 13 jun 2012) $ +// Last changed : $Date: 2014-10-08 15:26:57 +0000 (Wed, 08 Oct 2014) $ // File revision : $Revision: 4 $ // -// $Id: SoundTouch.cpp 143 2012-06-13 19:29:53Z oparviai $ +// $Id: SoundTouch.cpp 201 2014-10-08 15:26:57Z oparviai $ // //////////////////////////////////////////////////////////////////////////////// // @@ -97,7 +97,7 @@ SoundTouch::SoundTouch() { // Initialize rate transposer and tempo changer instances - pRateTransposer = RateTransposer::newInstance(); + pRateTransposer = new RateTransposer(); pTDStretch = TDStretch::newInstance(); setOutPipe(pTDStretch); @@ -111,7 +111,7 @@ SoundTouch::SoundTouch() calcEffectiveRateAndTempo(); channels = 0; - bSrateSet = FALSE; + bSrateSet = false; } @@ -143,10 +143,11 @@ uint SoundTouch::getVersionId() // Sets the number of channels, 1 = mono, 2 = stereo void SoundTouch::setChannels(uint numChannels) { - if (numChannels != 1 && numChannels != 2) + /*if (numChannels != 1 && numChannels != 2) { - ST_THROW_RT_ERROR("Illegal number of channels"); - } + //ST_THROW_RT_ERROR("Illegal number of channels"); + return; + }*/ channels = numChannels; pRateTransposer->setChannels((int)numChannels); pTDStretch->setChannels((int)numChannels); @@ -254,7 +255,7 @@ void SoundTouch::calcEffectiveRateAndTempo() tempoOut = pTDStretch->getOutput(); tempoOut->moveSamples(*output); // move samples in pitch transposer's store buffer to tempo changer's input - pTDStretch->moveSamples(*pRateTransposer->getStore()); + // deprecated : pTDStretch->moveSamples(*pRateTransposer->getStore()); output = pTDStretch; } @@ -282,7 +283,7 @@ void SoundTouch::calcEffectiveRateAndTempo() // Sets sample rate. void SoundTouch::setSampleRate(uint srate) { - bSrateSet = TRUE; + bSrateSet = true; // set sample rate, leave other tempo changer parameters as they are. pTDStretch->setParameters((int)srate); } @@ -292,7 +293,7 @@ void SoundTouch::setSampleRate(uint srate) // the input of the object. void SoundTouch::putSamples(const SAMPLETYPE *samples, uint nSamples) { - if (bSrateSet == FALSE) + if (bSrateSet == false) { ST_THROW_RT_ERROR("SoundTouch : Sample rate not defined"); } @@ -347,8 +348,8 @@ void SoundTouch::flush() int i; int nUnprocessed; int nOut; - SAMPLETYPE buff[64*2]; // note: allocate 2*64 to cater 64 sample frames of stereo sound - + SAMPLETYPE *buff = new SAMPLETYPE[64 * channels]; + // check how many samples still await processing, and scale // that by tempo & rate to get expected output sample count nUnprocessed = numUnprocessedSamples(); @@ -377,6 +378,8 @@ void SoundTouch::flush() } } + delete[] buff; + // Clear working buffers pRateTransposer->clear(); pTDStretch->clearInput(); @@ -387,7 +390,7 @@ void SoundTouch::flush() // Changes a setting controlling the processing system behaviour. See the // 'SETTING_...' defines for available setting ID's. -BOOL SoundTouch::setSetting(int settingId, int value) +bool SoundTouch::setSetting(int settingId, int value) { int sampleRate, sequenceMs, seekWindowMs, overlapMs; @@ -398,36 +401,36 @@ BOOL SoundTouch::setSetting(int settingId, int value) { case SETTING_USE_AA_FILTER : // enables / disabless anti-alias filter - pRateTransposer->enableAAFilter((value != 0) ? TRUE : FALSE); - return TRUE; + pRateTransposer->enableAAFilter((value != 0) ? true : false); + return true; case SETTING_AA_FILTER_LENGTH : // sets anti-alias filter length pRateTransposer->getAAFilter()->setLength(value); - return TRUE; + return true; case SETTING_USE_QUICKSEEK : // enables / disables tempo routine quick seeking algorithm - pTDStretch->enableQuickSeek((value != 0) ? TRUE : FALSE); - return TRUE; + pTDStretch->enableQuickSeek((value != 0) ? true : false); + return true; case SETTING_SEQUENCE_MS: // change time-stretch sequence duration parameter pTDStretch->setParameters(sampleRate, value, seekWindowMs, overlapMs); - return TRUE; + return true; case SETTING_SEEKWINDOW_MS: // change time-stretch seek window length parameter pTDStretch->setParameters(sampleRate, sequenceMs, value, overlapMs); - return TRUE; + return true; case SETTING_OVERLAP_MS: // change time-stretch overlap length parameter pTDStretch->setParameters(sampleRate, sequenceMs, seekWindowMs, value); - return TRUE; + return true; default : - return FALSE; + return false; } } diff --git a/3rdparty/soundtouch/TDStretch.cpp b/3rdparty/soundtouch/source/SoundTouch/TDStretch.cpp similarity index 78% rename from 3rdparty/soundtouch/TDStretch.cpp rename to 3rdparty/soundtouch/source/SoundTouch/TDStretch.cpp index 8fa598f61c..aa26e538ed 100644 --- a/3rdparty/soundtouch/TDStretch.cpp +++ b/3rdparty/soundtouch/source/SoundTouch/TDStretch.cpp @@ -13,10 +13,10 @@ /// //////////////////////////////////////////////////////////////////////////////// // -// Last changed : $Date: 2012-11-08 16:53:01 -0200 (qui, 08 nov 2012) $ +// Last changed : $Date: 2015-02-22 15:07:12 +0000 (Sun, 22 Feb 2015) $ // File revision : $Revision: 1.12 $ // -// $Id: TDStretch.cpp 160 2012-11-08 18:53:01Z oparviai $ +// $Id: TDStretch.cpp 205 2015-02-22 15:07:12Z oparviai $ // //////////////////////////////////////////////////////////////////////////////// // @@ -51,8 +51,6 @@ #include "cpu_detect.h" #include "TDStretch.h" -#include - using namespace soundtouch; #define max(x, y) (((x) > (y)) ? (x) : (y)) @@ -86,15 +84,15 @@ static const short _scanOffsets[5][24]={ TDStretch::TDStretch() : FIFOProcessor(&outputBuffer) { - bQuickSeek = FALSE; + bQuickSeek = false; channels = 2; pMidBuffer = NULL; pMidBufferUnaligned = NULL; overlapLength = 0; - bAutoSeqSetting = TRUE; - bAutoSeekSetting = TRUE; + bAutoSeqSetting = true; + bAutoSeekSetting = true; // outDebt = 0; skipFract = 0; @@ -134,23 +132,23 @@ void TDStretch::setParameters(int aSampleRate, int aSequenceMS, if (aSequenceMS > 0) { this->sequenceMs = aSequenceMS; - bAutoSeqSetting = FALSE; + bAutoSeqSetting = false; } else if (aSequenceMS == 0) { // if zero, use automatic setting - bAutoSeqSetting = TRUE; + bAutoSeqSetting = true; } if (aSeekWindowMS > 0) { this->seekWindowMs = aSeekWindowMS; - bAutoSeekSetting = FALSE; + bAutoSeekSetting = false; } else if (aSeekWindowMS == 0) { // if zero, use automatic setting - bAutoSeekSetting = TRUE; + bAutoSeekSetting = true; } calcSeqParameters(); @@ -159,7 +157,6 @@ void TDStretch::setParameters(int aSampleRate, int aSequenceMS, // set tempo to recalculate 'sampleReq' setTempo(tempo); - } @@ -212,7 +209,7 @@ void TDStretch::overlapMono(SAMPLETYPE *pOutput, const SAMPLETYPE *pInput) const void TDStretch::clearMidBuffer() { - memset(pMidBuffer, 0, 2 * sizeof(SAMPLETYPE) * overlapLength); + memset(pMidBuffer, 0, channels * sizeof(SAMPLETYPE) * overlapLength); } @@ -234,14 +231,14 @@ void TDStretch::clear() // Enables/disables the quick position seeking algorithm. Zero to disable, nonzero // to enable -void TDStretch::enableQuickSeek(BOOL enable) +void TDStretch::enableQuickSeek(bool enable) { bQuickSeek = enable; } // Returns nonzero if the quick seeking algorithm is enabled. -BOOL TDStretch::isQuickSeekEnabled() const +bool TDStretch::isQuickSeekEnabled() const { return bQuickSeek; } @@ -265,13 +262,22 @@ int TDStretch::seekBestOverlapPosition(const SAMPLETYPE *refPos) // of 'ovlPos'. inline void TDStretch::overlap(SAMPLETYPE *pOutput, const SAMPLETYPE *pInput, uint ovlPos) const { - if (channels == 2) +#ifndef USE_MULTICH_ALWAYS + if (channels == 1) + { + // mono sound. + overlapMono(pOutput, pInput + ovlPos); + } + else if (channels == 2) { // stereo sound overlapStereo(pOutput, pInput + 2 * ovlPos); - } else { - // mono sound. - overlapMono(pOutput, pInput + ovlPos); + } + else +#endif // USE_MULTICH_ALWAYS + { + assert(channels > 0); + overlapMulti(pOutput, pInput + channels * ovlPos); } } @@ -286,19 +292,32 @@ inline void TDStretch::overlap(SAMPLETYPE *pOutput, const SAMPLETYPE *pInput, ui int TDStretch::seekBestOverlapPositionFull(const SAMPLETYPE *refPos) { int bestOffs; - double bestCorr, corr; + double bestCorr; int i; + double norm; bestCorr = FLT_MIN; bestOffs = 0; // Scans for the best correlation value by testing each possible position // over the permitted range. - for (i = 0; i < seekLength; i ++) + bestCorr = calcCrossCorr(refPos, pMidBuffer, norm); + + #pragma omp parallel for + for (i = 1; i < seekLength; i ++) { - // Calculates correlation value for the mixing position corresponding - // to 'i' - corr = calcCrossCorr(refPos + channels * i, pMidBuffer); + double corr; + // Calculates correlation value for the mixing position corresponding to 'i' +#ifdef _OPENMP + // in parallel OpenMP mode, can't use norm accumulator version as parallel executor won't + // iterate the loop in sequential order + corr = calcCrossCorr(refPos + channels * i, pMidBuffer, norm); +#else + // In non-parallel version call "calcCrossCorrAccumulate" that is otherwise same + // as "calcCrossCorr", but saves time by reusing & updating previously stored + // "norm" value + corr = calcCrossCorrAccumulate(refPos + channels * i, pMidBuffer, norm); +#endif // heuristic rule to slightly favour values close to mid of the range double tmp = (double)(2 * i - seekLength) / (double)seekLength; corr = ((corr + 0.1) * (1.0 - 0.25 * tmp * tmp)); @@ -306,8 +325,15 @@ int TDStretch::seekBestOverlapPositionFull(const SAMPLETYPE *refPos) // Checks for the highest correlation value if (corr > bestCorr) { - bestCorr = corr; - bestOffs = i; + // For optimal performance, enter critical section only in case that best value found. + // in such case repeat 'if' condition as it's possible that parallel execution may have + // updated the bestCorr value in the mean time + #pragma omp critical + if (corr > bestCorr) + { + bestCorr = corr; + bestOffs = i; + } } } // clear cross correlation routine state if necessary (is so e.g. in MMX routines). @@ -346,12 +372,13 @@ int TDStretch::seekBestOverlapPositionQuick(const SAMPLETYPE *refPos) j = 0; while (_scanOffsets[scanCount][j]) { + double norm; tempOffset = corrOffset + _scanOffsets[scanCount][j]; if (tempOffset >= seekLength) break; // Calculates correlation value for the mixing position corresponding // to 'tempOffset' - corr = (double)calcCrossCorr(refPos + channels * tempOffset, pMidBuffer); + corr = (double)calcCrossCorr(refPos + channels * tempOffset, pMidBuffer, norm); // heuristic rule to slightly favour values close to mid of the range double tmp = (double)(2 * tempOffset - seekLength) / seekLength; corr = ((corr + 0.1) * (1.0 - 0.25 * tmp * tmp)); @@ -458,11 +485,15 @@ void TDStretch::setChannels(int numChannels) { assert(numChannels > 0); if (channels == numChannels) return; - assert(numChannels == 1 || numChannels == 2); +// assert(numChannels == 1 || numChannels == 2); channels = numChannels; inputBuffer.setChannels(channels); outputBuffer.setChannels(channels); + + // re-init overlap/buffer + overlapLength=0; + setParameters(sampleRate); } @@ -498,7 +529,6 @@ void TDStretch::processNominalTempo() } */ -#include // Processes as many processing frames of the samples 'inputBuffer', store // the result into 'outputBuffer' @@ -588,7 +618,7 @@ void TDStretch::acceptNewOverlapLength(int newOverlapLength) { delete[] pMidBufferUnaligned; - pMidBufferUnaligned = new SAMPLETYPE[overlapLength * 2 + 16 / sizeof(SAMPLETYPE)]; + pMidBufferUnaligned = new SAMPLETYPE[overlapLength * channels + 16 / sizeof(SAMPLETYPE)]; // ensure that 'pMidBuffer' is aligned to 16 byte boundary for efficiency pMidBuffer = (SAMPLETYPE *)SOUNDTOUCH_ALIGN_POINTER_16(pMidBufferUnaligned); @@ -666,6 +696,27 @@ void TDStretch::overlapStereo(short *poutput, const short *input) const } } + +// Overlaps samples in 'midBuffer' with the samples in 'input'. The 'Multi' +// version of the routine. +void TDStretch::overlapMulti(SAMPLETYPE *poutput, const SAMPLETYPE *input) const +{ + SAMPLETYPE m1=(SAMPLETYPE)0; + SAMPLETYPE m2; + int i=0; + + for (m2 = (SAMPLETYPE)overlapLength; m2; m2 --) + { + for (int c = 0; c < channels; c ++) + { + poutput[i] = (input[i] * m1 + pMidBuffer[i] * m2) / overlapLength; + i++; + } + + m1++; + } +} + // Calculates the x having the closest 2^x value for the given value static int _getClosest2Power(double value) { @@ -699,32 +750,72 @@ void TDStretch::calculateOverlapLength(int aoverlapMs) } -double TDStretch::calcCrossCorr(const short *mixingPos, const short *compare) const +double TDStretch::calcCrossCorr(const short *mixingPos, const short *compare, double &norm) const { long corr; - long norm; + long lnorm; int i; - corr = norm = 0; + corr = lnorm = 0; // Same routine for stereo and mono. For stereo, unroll loop for better // efficiency and gives slightly better resolution against rounding. // For mono it same routine, just unrolls loop by factor of 4 for (i = 0; i < channels * overlapLength; i += 4) { corr += (mixingPos[i] * compare[i] + - mixingPos[i + 1] * compare[i + 1] + - mixingPos[i + 2] * compare[i + 2] + + mixingPos[i + 1] * compare[i + 1]) >> overlapDividerBits; // notice: do intermediate division here to avoid integer overflow + corr += (mixingPos[i + 2] * compare[i + 2] + mixingPos[i + 3] * compare[i + 3]) >> overlapDividerBits; - norm += (mixingPos[i] * mixingPos[i] + - mixingPos[i + 1] * mixingPos[i + 1] + - mixingPos[i + 2] * mixingPos[i + 2] + - mixingPos[i + 3] * mixingPos[i + 3]) >> overlapDividerBits; + lnorm += (mixingPos[i] * mixingPos[i] + + mixingPos[i + 1] * mixingPos[i + 1]) >> overlapDividerBits; // notice: do intermediate division here to avoid integer overflow + lnorm += (mixingPos[i + 2] * mixingPos[i + 2] + + mixingPos[i + 3] * mixingPos[i + 3]) >> overlapDividerBits; } // Normalize result by dividing by sqrt(norm) - this step is easiest // done using floating point operation - if (norm == 0) norm = 1; // to avoid div by zero - return (double)corr / sqrt((double)norm); + norm = (double)lnorm; + return (double)corr / sqrt((norm < 1e-9) ? 1.0 : norm); +} + + +/// Update cross-correlation by accumulating "norm" coefficient by previously calculated value +double TDStretch::calcCrossCorrAccumulate(const short *mixingPos, const short *compare, double &norm) const +{ + long corr; + long lnorm; + int i; + + // cancel first normalizer tap from previous round + lnorm = 0; + for (i = 1; i <= channels; i ++) + { + lnorm -= (mixingPos[-i] * mixingPos[-i]) >> overlapDividerBits; + } + + corr = 0; + // Same routine for stereo and mono. For stereo, unroll loop for better + // efficiency and gives slightly better resolution against rounding. + // For mono it same routine, just unrolls loop by factor of 4 + for (i = 0; i < channels * overlapLength; i += 4) + { + corr += (mixingPos[i] * compare[i] + + mixingPos[i + 1] * compare[i + 1]) >> overlapDividerBits; // notice: do intermediate division here to avoid integer overflow + corr += (mixingPos[i + 2] * compare[i + 2] + + mixingPos[i + 3] * compare[i + 3]) >> overlapDividerBits; + } + + // update normalizer with last samples of this round + for (int j = 0; j < channels; j ++) + { + i --; + lnorm += (mixingPos[i] * mixingPos[i]) >> overlapDividerBits; + } + norm += (double)lnorm; + + // Normalize result by dividing by sqrt(norm) - this step is easiest + // done using floating point operation + return (double)corr / sqrt((norm < 1e-9) ? 1.0 : norm); } #endif // SOUNDTOUCH_INTEGER_SAMPLES @@ -760,6 +851,34 @@ void TDStretch::overlapStereo(float *pOutput, const float *pInput) const } +// Overlaps samples in 'midBuffer' with the samples in 'input'. +void TDStretch::overlapMulti(float *pOutput, const float *pInput) const +{ + int i; + float fScale; + float f1; + float f2; + + fScale = 1.0f / (float)overlapLength; + + f1 = 0; + f2 = 1.0f; + + i=0; + for (int i2 = 0; i2 < overlapLength; i2 ++) + { + // note: Could optimize this slightly by taking into account that always channels > 2 + for (int c = 0; c < channels; c ++) + { + pOutput[i] = pInput[i] * f1 + pMidBuffer[i] * f2; + i++; + } + f1 += fScale; + f2 -= fScale; + } +} + + /// Calculates overlapInMsec period length in samples. void TDStretch::calculateOverlapLength(int overlapInMsec) { @@ -776,7 +895,8 @@ void TDStretch::calculateOverlapLength(int overlapInMsec) } -double TDStretch::calcCrossCorr(const float *mixingPos, const float *compare) const +/// Calculate cross-correlation +double TDStretch::calcCrossCorr(const float *mixingPos, const float *compare, double &anorm) const { double corr; double norm; @@ -801,8 +921,44 @@ double TDStretch::calcCrossCorr(const float *mixingPos, const float *compare) co mixingPos[i + 3] * mixingPos[i + 3]; } - if (norm < 1e-9) norm = 1.0; // to avoid div by zero - return corr / sqrt(norm); + anorm = norm; + return corr / sqrt((norm < 1e-9 ? 1.0 : norm)); } + +/// Update cross-correlation by accumulating "norm" coefficient by previously calculated value +double TDStretch::calcCrossCorrAccumulate(const float *mixingPos, const float *compare, double &norm) const +{ + double corr; + int i; + + corr = 0; + + // cancel first normalizer tap from previous round + for (i = 1; i <= channels; i ++) + { + norm -= mixingPos[-i] * mixingPos[-i]; + } + + // Same routine for stereo and mono. For Stereo, unroll by factor of 2. + // For mono it's same routine yet unrollsd by factor of 4. + for (i = 0; i < channels * overlapLength; i += 4) + { + corr += mixingPos[i] * compare[i] + + mixingPos[i + 1] * compare[i + 1] + + mixingPos[i + 2] * compare[i + 2] + + mixingPos[i + 3] * compare[i + 3]; + } + + // update normalizer with last samples of this round + for (int j = 0; j < channels; j ++) + { + i --; + norm += mixingPos[i] * mixingPos[i]; + } + + return corr / sqrt((norm < 1e-9 ? 1.0 : norm)); +} + + #endif // SOUNDTOUCH_FLOAT_SAMPLES diff --git a/3rdparty/soundtouch/TDStretch.h b/3rdparty/soundtouch/source/SoundTouch/TDStretch.h similarity index 92% rename from 3rdparty/soundtouch/TDStretch.h rename to 3rdparty/soundtouch/source/SoundTouch/TDStretch.h index 6861251014..b390736913 100644 --- a/3rdparty/soundtouch/TDStretch.h +++ b/3rdparty/soundtouch/source/SoundTouch/TDStretch.h @@ -13,10 +13,10 @@ /// //////////////////////////////////////////////////////////////////////////////// // -// Last changed : $Date: 2012-04-01 16:49:30 -0300 (dom, 01 abr 2012) $ +// Last changed : $Date: 2014-04-06 15:57:21 +0000 (Sun, 06 Apr 2014) $ // File revision : $Revision: 4 $ // -// $Id: TDStretch.h 137 2012-04-01 19:49:30Z oparviai $ +// $Id: TDStretch.h 195 2014-04-06 15:57:21Z oparviai $ // //////////////////////////////////////////////////////////////////////////////// // @@ -125,21 +125,22 @@ protected: float skipFract; FIFOSampleBuffer outputBuffer; FIFOSampleBuffer inputBuffer; - BOOL bQuickSeek; + bool bQuickSeek; int sampleRate; int sequenceMs; int seekWindowMs; int overlapMs; - BOOL bAutoSeqSetting; - BOOL bAutoSeekSetting; + bool bAutoSeqSetting; + bool bAutoSeekSetting; void acceptNewOverlapLength(int newOverlapLength); virtual void clearCrossCorrState(); void calculateOverlapLength(int overlapMs); - virtual double calcCrossCorr(const SAMPLETYPE *mixingPos, const SAMPLETYPE *compare) const; + virtual double calcCrossCorr(const SAMPLETYPE *mixingPos, const SAMPLETYPE *compare, double &norm) const; + virtual double calcCrossCorrAccumulate(const SAMPLETYPE *mixingPos, const SAMPLETYPE *compare, double &norm) const; virtual int seekBestOverlapPositionFull(const SAMPLETYPE *refPos); virtual int seekBestOverlapPositionQuick(const SAMPLETYPE *refPos); @@ -147,6 +148,7 @@ protected: virtual void overlapStereo(SAMPLETYPE *output, const SAMPLETYPE *input) const; virtual void overlapMono(SAMPLETYPE *output, const SAMPLETYPE *input) const; + virtual void overlapMulti(SAMPLETYPE *output, const SAMPLETYPE *input) const; void clearMidBuffer(); void overlap(SAMPLETYPE *output, const SAMPLETYPE *input, uint ovlPos) const; @@ -193,10 +195,10 @@ public: /// Enables/disables the quick position seeking algorithm. Zero to disable, /// nonzero to enable - void enableQuickSeek(BOOL enable); + void enableQuickSeek(bool enable); /// Returns nonzero if the quick seeking algorithm is enabled. - BOOL isQuickSeekEnabled() const; + bool isQuickSeekEnabled() const; /// Sets routine control parameters. These control are certain time constants /// defining how the sound is stretched to the desired duration. @@ -247,7 +249,8 @@ public: class TDStretchMMX : public TDStretch { protected: - double calcCrossCorr(const short *mixingPos, const short *compare) const; + double calcCrossCorr(const short *mixingPos, const short *compare, double &norm) const; + double calcCrossCorrAccumulate(const short *mixingPos, const short *compare, double &norm) const; virtual void overlapStereo(short *output, const short *input) const; virtual void clearCrossCorrState(); }; @@ -259,7 +262,8 @@ public: class TDStretchSSE : public TDStretch { protected: - double calcCrossCorr(const float *mixingPos, const float *compare) const; + double calcCrossCorr(const float *mixingPos, const float *compare, double &norm) const; + double calcCrossCorrAccumulate(const float *mixingPos, const float *compare, double &norm) const; }; #endif /// SOUNDTOUCH_ALLOW_SSE diff --git a/3rdparty/soundtouch/cpu_detect.h b/3rdparty/soundtouch/source/SoundTouch/cpu_detect.h similarity index 97% rename from 3rdparty/soundtouch/cpu_detect.h rename to 3rdparty/soundtouch/source/SoundTouch/cpu_detect.h index 809f841b3d..e7582e8da3 100644 --- a/3rdparty/soundtouch/cpu_detect.h +++ b/3rdparty/soundtouch/source/SoundTouch/cpu_detect.h @@ -12,7 +12,7 @@ /// //////////////////////////////////////////////////////////////////////////////// // -// Last changed : $Date: 2008-02-10 14:26:55 -0200 (dom, 10 fev 2008) $ +// Last changed : $Date: 2008-02-10 16:26:55 +0000 (Sun, 10 Feb 2008) $ // File revision : $Revision: 4 $ // // $Id: cpu_detect.h 11 2008-02-10 16:26:55Z oparviai $ diff --git a/3rdparty/soundtouch/cpu_detect_x86.cpp b/3rdparty/soundtouch/source/SoundTouch/cpu_detect_x86.cpp similarity index 90% rename from 3rdparty/soundtouch/cpu_detect_x86.cpp rename to 3rdparty/soundtouch/source/SoundTouch/cpu_detect_x86.cpp index 0526102c51..e9a0e20041 100644 --- a/3rdparty/soundtouch/cpu_detect_x86.cpp +++ b/3rdparty/soundtouch/source/SoundTouch/cpu_detect_x86.cpp @@ -11,10 +11,10 @@ /// //////////////////////////////////////////////////////////////////////////////// // -// Last changed : $Date: 2012-11-08 16:44:37 -0200 (qui, 08 nov 2012) $ +// Last changed : $Date: 2014-01-07 18:24:28 +0000 (Tue, 07 Jan 2014) $ // File revision : $Revision: 4 $ // -// $Id: cpu_detect_x86.cpp 159 2012-11-08 18:44:37Z oparviai $ +// $Id: cpu_detect_x86.cpp 183 2014-01-07 18:24:28Z oparviai $ // //////////////////////////////////////////////////////////////////////////////// // @@ -42,19 +42,20 @@ #include "cpu_detect.h" #include "STTypes.h" + #if defined(SOUNDTOUCH_ALLOW_X86_OPTIMIZATIONS) - #if defined(__GNUC__) && defined(__i386__) - // gcc - #include "cpuid.h" - #elif defined(_M_IX86) - // windows non-gcc - #include - #define bit_MMX (1 << 23) - #define bit_SSE (1 << 25) - #define bit_SSE2 (1 << 26) - #endif + #if defined(__GNUC__) && defined(__i386__) + // gcc + #include "cpuid.h" + #elif defined(_M_IX86) + // windows non-gcc + #include + #endif + #define bit_MMX (1 << 23) + #define bit_SSE (1 << 25) + #define bit_SSE2 (1 << 26) #endif diff --git a/3rdparty/soundtouch/mmx_optimized.cpp b/3rdparty/soundtouch/source/SoundTouch/mmx_optimized.cpp similarity index 74% rename from 3rdparty/soundtouch/mmx_optimized.cpp rename to 3rdparty/soundtouch/source/SoundTouch/mmx_optimized.cpp index 15d8af1b76..9062026399 100644 --- a/3rdparty/soundtouch/mmx_optimized.cpp +++ b/3rdparty/soundtouch/source/SoundTouch/mmx_optimized.cpp @@ -20,10 +20,10 @@ /// //////////////////////////////////////////////////////////////////////////////// // -// Last changed : $Date: 2012-11-08 16:53:01 -0200 (qui, 08 nov 2012) $ +// Last changed : $Date: 2015-02-22 15:10:38 +0000 (Sun, 22 Feb 2015) $ // File revision : $Revision: 4 $ // -// $Id: mmx_optimized.cpp 160 2012-11-08 18:53:01Z oparviai $ +// $Id: mmx_optimized.cpp 206 2015-02-22 15:10:38Z oparviai $ // //////////////////////////////////////////////////////////////////////////////// // @@ -68,7 +68,7 @@ using namespace soundtouch; // Calculates cross correlation of two buffers -double TDStretchMMX::calcCrossCorr(const short *pV1, const short *pV2) const +double TDStretchMMX::calcCrossCorr(const short *pV1, const short *pV2, double &dnorm) const { const __m64 *pVec1, *pVec2; __m64 shifter; @@ -93,19 +93,19 @@ double TDStretchMMX::calcCrossCorr(const short *pV1, const short *pV2) const // _mm_add_pi32 : 2*32bit add // _m_psrad : 32bit right-shift - temp = _mm_add_pi32(_mm_madd_pi16(pVec1[0], pVec2[0]), - _mm_madd_pi16(pVec1[1], pVec2[1])); - temp2 = _mm_add_pi32(_mm_madd_pi16(pVec1[0], pVec1[0]), - _mm_madd_pi16(pVec1[1], pVec1[1])); - accu = _mm_add_pi32(accu, _mm_sra_pi32(temp, shifter)); - normaccu = _mm_add_pi32(normaccu, _mm_sra_pi32(temp2, shifter)); + temp = _mm_add_pi32(_mm_sra_pi32(_mm_madd_pi16(pVec1[0], pVec2[0]), shifter), + _mm_sra_pi32(_mm_madd_pi16(pVec1[1], pVec2[1]), shifter)); + temp2 = _mm_add_pi32(_mm_sra_pi32(_mm_madd_pi16(pVec1[0], pVec1[0]), shifter), + _mm_sra_pi32(_mm_madd_pi16(pVec1[1], pVec1[1]), shifter)); + accu = _mm_add_pi32(accu, temp); + normaccu = _mm_add_pi32(normaccu, temp2); - temp = _mm_add_pi32(_mm_madd_pi16(pVec1[2], pVec2[2]), - _mm_madd_pi16(pVec1[3], pVec2[3])); - temp2 = _mm_add_pi32(_mm_madd_pi16(pVec1[2], pVec1[2]), - _mm_madd_pi16(pVec1[3], pVec1[3])); - accu = _mm_add_pi32(accu, _mm_sra_pi32(temp, shifter)); - normaccu = _mm_add_pi32(normaccu, _mm_sra_pi32(temp2, shifter)); + temp = _mm_add_pi32(_mm_sra_pi32(_mm_madd_pi16(pVec1[2], pVec2[2]), shifter), + _mm_sra_pi32(_mm_madd_pi16(pVec1[3], pVec2[3]), shifter)); + temp2 = _mm_add_pi32(_mm_sra_pi32(_mm_madd_pi16(pVec1[2], pVec1[2]), shifter), + _mm_sra_pi32(_mm_madd_pi16(pVec1[3], pVec1[3]), shifter)); + accu = _mm_add_pi32(accu, temp); + normaccu = _mm_add_pi32(normaccu, temp2); pVec1 += 4; pVec2 += 4; @@ -125,14 +125,81 @@ double TDStretchMMX::calcCrossCorr(const short *pV1, const short *pV2) const // Normalize result by dividing by sqrt(norm) - this step is easiest // done using floating point operation - if (norm == 0) norm = 1; // to avoid div by zero + dnorm = (double)norm; - return (double)corr / sqrt((double)norm); + return (double)corr / sqrt(dnorm < 1e-9 ? 1.0 : dnorm); // Note: Warning about the missing EMMS instruction is harmless // as it'll be called elsewhere. } +/// Update cross-correlation by accumulating "norm" coefficient by previously calculated value +double TDStretchMMX::calcCrossCorrAccumulate(const short *pV1, const short *pV2, double &dnorm) const +{ + const __m64 *pVec1, *pVec2; + __m64 shifter; + __m64 accu; + long corr, lnorm; + int i; + + // cancel first normalizer tap from previous round + lnorm = 0; + for (i = 1; i <= channels; i ++) + { + lnorm -= (pV1[-i] * pV1[-i]) >> overlapDividerBits; + } + + pVec1 = (__m64*)pV1; + pVec2 = (__m64*)pV2; + + shifter = _m_from_int(overlapDividerBits); + accu = _mm_setzero_si64(); + + // Process 4 parallel sets of 2 * stereo samples or 4 * mono samples + // during each round for improved CPU-level parallellization. + for (i = 0; i < channels * overlapLength / 16; i ++) + { + __m64 temp; + + // dictionary of instructions: + // _m_pmaddwd : 4*16bit multiply-add, resulting two 32bits = [a0*b0+a1*b1 ; a2*b2+a3*b3] + // _mm_add_pi32 : 2*32bit add + // _m_psrad : 32bit right-shift + + temp = _mm_add_pi32(_mm_sra_pi32(_mm_madd_pi16(pVec1[0], pVec2[0]), shifter), + _mm_sra_pi32(_mm_madd_pi16(pVec1[1], pVec2[1]), shifter)); + accu = _mm_add_pi32(accu, temp); + + temp = _mm_add_pi32(_mm_sra_pi32(_mm_madd_pi16(pVec1[2], pVec2[2]), shifter), + _mm_sra_pi32(_mm_madd_pi16(pVec1[3], pVec2[3]), shifter)); + accu = _mm_add_pi32(accu, temp); + + pVec1 += 4; + pVec2 += 4; + } + + // copy hi-dword of mm0 to lo-dword of mm1, then sum mmo+mm1 + // and finally store the result into the variable "corr" + + accu = _mm_add_pi32(accu, _mm_srli_si64(accu, 32)); + corr = _m_to_int(accu); + + // Clear MMS state + _m_empty(); + + // update normalizer with last samples of this round + pV1 = (short *)pVec1; + for (int j = 1; j <= channels; j ++) + { + lnorm += (pV1[-j] * pV1[-j]) >> overlapDividerBits; + } + dnorm += (double)lnorm; + + // Normalize result by dividing by sqrt(norm) - this step is easiest + // done using floating point operation + return (double)corr / sqrt((dnorm < 1e-9) ? 1.0 : dnorm); +} + void TDStretchMMX::clearCrossCorrState() { @@ -220,6 +287,7 @@ void TDStretchMMX::overlapStereo(short *output, const short *input) const FIRFilterMMX::FIRFilterMMX() : FIRFilter() { + filterCoeffsAlign = NULL; filterCoeffsUnalign = NULL; } diff --git a/3rdparty/soundtouch/sse_optimized.cpp b/3rdparty/soundtouch/source/SoundTouch/sse_optimized.cpp similarity index 93% rename from 3rdparty/soundtouch/sse_optimized.cpp rename to 3rdparty/soundtouch/source/SoundTouch/sse_optimized.cpp index 3566252cad..fa622efa55 100644 --- a/3rdparty/soundtouch/sse_optimized.cpp +++ b/3rdparty/soundtouch/source/SoundTouch/sse_optimized.cpp @@ -23,10 +23,10 @@ /// //////////////////////////////////////////////////////////////////////////////// // -// Last changed : $Date: 2012-11-08 16:53:01 -0200 (qui, 08 nov 2012) $ +// Last changed : $Date: 2015-02-21 21:24:29 +0000 (Sat, 21 Feb 2015) $ // File revision : $Revision: 4 $ // -// $Id: sse_optimized.cpp 160 2012-11-08 18:53:01Z oparviai $ +// $Id: sse_optimized.cpp 202 2015-02-21 21:24:29Z oparviai $ // //////////////////////////////////////////////////////////////////////////////// // @@ -71,7 +71,7 @@ using namespace soundtouch; #include // Calculates cross correlation of two buffers -double TDStretchSSE::calcCrossCorr(const float *pV1, const float *pV2) const +double TDStretchSSE::calcCrossCorr(const float *pV1, const float *pV2, double &anorm) const { int i; const float *pVec1; @@ -141,11 +141,11 @@ double TDStretchSSE::calcCrossCorr(const float *pV1, const float *pV2) const // return value = vSum[0] + vSum[1] + vSum[2] + vSum[3] float *pvNorm = (float*)&vNorm; - double norm = sqrt(pvNorm[0] + pvNorm[1] + pvNorm[2] + pvNorm[3]); - if (norm < 1e-9) norm = 1.0; // to avoid div by zero + float norm = (pvNorm[0] + pvNorm[1] + pvNorm[2] + pvNorm[3]); + anorm = norm; float *pvSum = (float*)&vSum; - return (double)(pvSum[0] + pvSum[1] + pvSum[2] + pvSum[3]) / norm; + return (double)(pvSum[0] + pvSum[1] + pvSum[2] + pvSum[3]) / sqrt(norm < 1e-9 ? 1.0 : norm); /* This is approximately corresponding routine in C-language yet without normalization: double corr, norm; @@ -182,6 +182,16 @@ double TDStretchSSE::calcCrossCorr(const float *pV1, const float *pV2) const } + +double TDStretchSSE::calcCrossCorrAccumulate(const float *pV1, const float *pV2, double &norm) const +{ + // call usual calcCrossCorr function because SSE does not show big benefit of + // accumulating "norm" value, and also the "norm" rolling algorithm would get + // complicated due to SSE-specific alignment-vs-nonexact correlation rules. + return calcCrossCorr(pV1, pV2, norm); +} + + ////////////////////////////////////////////////////////////////////////////// // // implementation of SSE optimized functions of class 'FIRFilter' @@ -249,14 +259,17 @@ uint FIRFilterSSE::evaluateFilterStereo(float *dest, const float *source, uint n assert(((ulongptr)filterCoeffsAlign) % 16 == 0); // filter is evaluated for two stereo samples with each iteration, thus use of 'j += 2' + #pragma omp parallel for for (j = 0; j < count; j += 2) { const float *pSrc; + float *pDest; const __m128 *pFil; __m128 sum1, sum2; uint i; - pSrc = (const float*)source; // source audio data + pSrc = (const float*)source + j * 2; // source audio data + pDest = dest + j * 2; // destination audio data pFil = (const __m128*)filterCoeffsAlign; // filter coefficients. NOTE: Assumes coefficients // are aligned to 16-byte boundary sum1 = sum2 = _mm_setzero_ps(); @@ -289,12 +302,10 @@ uint FIRFilterSSE::evaluateFilterStereo(float *dest, const float *source, uint n // to sum the two hi- and lo-floats of these registers together. // post-shuffle & add the filtered values and store to dest. - _mm_storeu_ps(dest, _mm_add_ps( + _mm_storeu_ps(pDest, _mm_add_ps( _mm_shuffle_ps(sum1, sum2, _MM_SHUFFLE(1,0,3,2)), // s2_1 s2_0 s1_3 s1_2 _mm_shuffle_ps(sum1, sum2, _MM_SHUFFLE(3,2,1,0)) // s2_3 s2_2 s1_1 s1_0 )); - source += 4; - dest += 4; } // Ideas for further improvement: diff --git a/PCSX2_suite.sln b/PCSX2_suite.sln index dc66fdc747..4efbd17435 100644 --- a/PCSX2_suite.sln +++ b/PCSX2_suite.sln @@ -185,25 +185,32 @@ Global {18E42F6F-3A62-41EE-B42F-79366C4F1E95}.Release|x64.Build.0 = Release SSE2|x64 {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Debug|Win32.ActiveCfg = Debug|Win32 {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Debug|Win32.Build.0 = Debug|Win32 - {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Debug|x64.ActiveCfg = Debug|Win32 + {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Debug|x64.ActiveCfg = Debug|x64 + {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Debug|x64.Build.0 = Debug|x64 {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Devel|Win32.ActiveCfg = Devel|Win32 {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Devel|Win32.Build.0 = Devel|Win32 - {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Devel|x64.ActiveCfg = Devel|Win32 + {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Devel|x64.ActiveCfg = Devel|x64 + {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Devel|x64.Build.0 = Devel|x64 {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Release AVX|Win32.ActiveCfg = Release|Win32 {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Release AVX|Win32.Build.0 = Release|Win32 - {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Release AVX|x64.ActiveCfg = Release|Win32 + {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Release AVX|x64.ActiveCfg = Release|x64 + {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Release AVX|x64.Build.0 = Release|x64 {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Release AVX2|Win32.ActiveCfg = Release|Win32 {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Release AVX2|Win32.Build.0 = Release|Win32 - {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Release AVX2|x64.ActiveCfg = Release|Win32 + {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Release AVX2|x64.ActiveCfg = Release|x64 + {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Release AVX2|x64.Build.0 = Release|x64 {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Release SSE4|Win32.ActiveCfg = Release|Win32 {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Release SSE4|Win32.Build.0 = Release|Win32 - {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Release SSE4|x64.ActiveCfg = Release|Win32 + {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Release SSE4|x64.ActiveCfg = Release|x64 + {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Release SSE4|x64.Build.0 = Release|x64 {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Release SSSE3|Win32.ActiveCfg = Release|Win32 {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Release SSSE3|Win32.Build.0 = Release|Win32 - {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Release SSSE3|x64.ActiveCfg = Release|Win32 + {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Release SSSE3|x64.ActiveCfg = Release|x64 + {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Release SSSE3|x64.Build.0 = Release|x64 {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Release|Win32.ActiveCfg = Release|Win32 {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Release|Win32.Build.0 = Release|Win32 - {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Release|x64.ActiveCfg = Release|Win32 + {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Release|x64.ActiveCfg = Release|x64 + {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Release|x64.Build.0 = Release|x64 {2F6C0388-20CB-4242-9F6C-A6EBB6A83F47}.Debug|Win32.ActiveCfg = Debug|Win32 {2F6C0388-20CB-4242-9F6C-A6EBB6A83F47}.Debug|Win32.Build.0 = Debug|Win32 {2F6C0388-20CB-4242-9F6C-A6EBB6A83F47}.Debug|x64.ActiveCfg = Debug|Win32 diff --git a/common/vsprops/3rdpartyDeps.props b/common/vsprops/3rdpartyDeps.props index 49f08104f2..12156558d3 100644 --- a/common/vsprops/3rdpartyDeps.props +++ b/common/vsprops/3rdpartyDeps.props @@ -6,7 +6,7 @@ - $(SvnRootDir)\3rdparty\;%(AdditionalIncludeDirectories) + $(SvnRootDir)\3rdparty\;$(SvnRootDir)\3rdparty\soundtouch\;%(AdditionalIncludeDirectories) $(SvnRootDir)\deps\$(Platform)\$(Configuration);%(AdditionalLibraryDirectories) diff --git a/old_plugins.sln b/old_plugins.sln index dd8eb5da34..f423fea38c 100644 --- a/old_plugins.sln +++ b/old_plugins.sln @@ -97,13 +97,16 @@ Global {5F78E90B-BD22-47B1-9CA5-7A80F4DF5EF3}.Release|x64.ActiveCfg = Release|Win32 {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Debug|Win32.ActiveCfg = Debug|Win32 {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Debug|Win32.Build.0 = Debug|Win32 - {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Debug|x64.ActiveCfg = Debug|Win32 + {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Debug|x64.ActiveCfg = Debug|x64 + {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Debug|x64.Build.0 = Debug|x64 {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Devel|Win32.ActiveCfg = Devel|Win32 {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Devel|Win32.Build.0 = Devel|Win32 - {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Devel|x64.ActiveCfg = Devel|Win32 + {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Devel|x64.ActiveCfg = Devel|x64 + {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Devel|x64.Build.0 = Devel|x64 {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Release|Win32.ActiveCfg = Release|Win32 {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Release|Win32.Build.0 = Release|Win32 - {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Release|x64.ActiveCfg = Release|Win32 + {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Release|x64.ActiveCfg = Release|x64 + {E9B51944-7E6D-4BCD-83F2-7BBD5A46182D}.Release|x64.Build.0 = Release|x64 {2F6C0388-20CB-4242-9F6C-A6EBB6A83F47}.Debug|Win32.ActiveCfg = Debug|Win32 {2F6C0388-20CB-4242-9F6C-A6EBB6A83F47}.Debug|Win32.Build.0 = Debug|Win32 {2F6C0388-20CB-4242-9F6C-A6EBB6A83F47}.Debug|x64.ActiveCfg = Debug|Win32 diff --git a/plugins/spu2-x/src/Wavedump_wav.cpp b/plugins/spu2-x/src/Wavedump_wav.cpp index 6875b3aef6..17e37f9ffd 100644 --- a/plugins/spu2-x/src/Wavedump_wav.cpp +++ b/plugins/spu2-x/src/Wavedump_wav.cpp @@ -19,7 +19,7 @@ #ifdef __linux__ #include "WavFile.h" #else -#include "soundtouch/WavFile.h" +#include "soundtouch/source/SoundStretch/WavFile.h" #endif static WavOutFile* _new_WavOutFile( const char* destfile ) diff --git a/plugins/zerospu2/zerospu2.cpp b/plugins/zerospu2/zerospu2.cpp index e9b899852f..1b35f6d12b 100644 --- a/plugins/zerospu2/zerospu2.cpp +++ b/plugins/zerospu2/zerospu2.cpp @@ -31,7 +31,7 @@ #ifdef __linux__ #include "WavFile.h" #else -#include "soundtouch/WavFile.h" +#include "soundtouch/source/SoundStretch/WavFile.h" #endif char libraryName[256]; diff --git a/plugins/zerospu2/zeroworker.cpp b/plugins/zerospu2/zeroworker.cpp index 3a95164a4e..547360997f 100644 --- a/plugins/zerospu2/zeroworker.cpp +++ b/plugins/zerospu2/zeroworker.cpp @@ -22,7 +22,7 @@ #ifdef __linux__ #include "WavFile.h" #else -#include "soundtouch/WavFile.h" +#include "soundtouch/source/SoundStretch/WavFile.h" #endif s32 g_logsound = 0; From 9565aaf469dfa8dd3a82fd57f10e782d55e22b03 Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Miguel=20A=2E=20Col=C3=B3n=20V=C3=A9lez?= Date: Sat, 22 Aug 2015 10:30:11 -0400 Subject: [PATCH 5/5] Backport wx30 fix for VS2015. This is commit f350babf36818ba805ab0b4510b6616aaf3063fc. . Reading "Please update wx/compiler.h to recognize this VC++ version" gets old pretty quickly. --- 3rdparty/wxwidgets3.0/include/msvc/wx/setup.h | 2 ++ 3rdparty/wxwidgets3.0/include/wx/compiler.h | 15 ++++++++++++++- 2 files changed, 16 insertions(+), 1 deletion(-) diff --git a/3rdparty/wxwidgets3.0/include/msvc/wx/setup.h b/3rdparty/wxwidgets3.0/include/msvc/wx/setup.h index 0ae5bbd7ff..4f508af7c8 100644 --- a/3rdparty/wxwidgets3.0/include/msvc/wx/setup.h +++ b/3rdparty/wxwidgets3.0/include/msvc/wx/setup.h @@ -63,6 +63,8 @@ #define wxCOMPILER_PREFIX vc110 #elif _MSC_VER == 1800 #define wxCOMPILER_PREFIX vc120 + #elif _MSC_VER == 1900 + #define wxCOMPILER_PREFIX vc140 #else #error "Unknown MSVC compiler version, please report to wx-dev." #endif diff --git a/3rdparty/wxwidgets3.0/include/wx/compiler.h b/3rdparty/wxwidgets3.0/include/wx/compiler.h index db8a7d36e0..c10f669453 100644 --- a/3rdparty/wxwidgets3.0/include/wx/compiler.h +++ b/3rdparty/wxwidgets3.0/include/wx/compiler.h @@ -53,7 +53,14 @@ # define __VISUALC11__ #elif __VISUALC__ < 1900 # define __VISUALC12__ +#elif __VISUALC__ < 2000 + /* There is no __VISUALC13__! */ +# define __VISUALC14__ #else + /* + Don't forget to update include/msvc/wx/setup.h as well when adding + support for a newer MSVC version here. + */ # pragma message("Please update wx/compiler.h to recognize this VC++ version") #endif @@ -102,7 +109,13 @@ # define wxVISUALC_VERSION(major) 0 # define wxCHECK_VISUALC_VERSION(major) 0 #else -# define wxVISUALC_VERSION(major) ( (6 + major) * 100 ) + /* + Things used to be simple with the _MSC_VER value and the version number + increasing in lock step, but _MSC_VER value of 1900 is VC14 and not the + non existing (presumably for the superstitious reasons) VC13, so we now + need to account for this with an extra offset. + */ +# define wxVISUALC_VERSION(major) ( (6 + (major >= 14 ? 1 : 0) + major) * 100 ) # define wxCHECK_VISUALC_VERSION(major) ( __VISUALC__ >= wxVISUALC_VERSION(major) ) #endif